(data stored in ACNUC7421 zone)

HOGENOMDNA: EDWTF_1

ID   EDWTF_1; SV 1; circular; genomic DNA; GRV; PRO; 3684607 BP.
XX
AC   CP002154_GR;
XX
DT   23-NOV-2010 (Rel. 127, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 2)
XX
DE   Edwardsiella tarda (strain FL6-60) chromosome, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Edwardsiella tarda (strain FL6-60)
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Edwardsiella.
XX
RN   [1]
RA   van Soest J.J., Henkel C.V., Jansen H.J., van den Hondel C.A.M.J.J.,
RA   Bloemberg G.V., Meijer A.H., Spaink H.P.
RT   "Genome comparisons of Edwardsiella bacteria analysed using deep
RT   sequencing technology.";
RL   Submitted (AUG-2010) to the EMBL/GenBank/DDBJ databases.
XX
CC   This Genome Reviews entry was created from entry CP002154.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3684607
FT                   /organism="Edwardsiella tarda"
FT                   /strain="FL6-60"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome"
FT                   /db_xref="taxon:718251"
FT   CDS_pept        1..1323
FT                   /codon_start=1
FT                   /gene_family="HOG000235659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409482"
FT                   /gene_name="dnaA"
FT                   /locus_tag="ETAF_0001"
FT                   /function="ATP binding"
FT                   /function="DNA replication origin binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40124.1"
FT                   /db_xref="GO:0003688"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="UniParc:UPI0001BD0416"
FT                   /db_xref="UniProtKB/TrEMBL:E0T438"
FT                   /transl_table=11
FT                   /translation="MWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLNDFCG
FT                   SDAPVLRFEVGSKPVAPAAVSSAASSGVSVAPAAVRTSSPARPSWERVTAQPELSYRSN
FT                   VNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIM
FT                   ARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKERSQEE
FT                   FFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMK
FT                   KADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREALRDLL
FT                   ALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIG
FT                   DAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS"
FT   CDS_pept        1348..2448
FT                   /codon_start=1
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409483"
FT                   /locus_tag="ETAF_0002"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40125.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniParc:UPI0001A59FD9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T439"
FT                   /transl_table=11
FT                   /translation="MKFIVEREHLIKPLQQVSSPLGGRPTLPILGNLLLQVEDGHLSLT
FT                   GTDLEMEMVARVPLVQPHEAGATTVPARKFLDICRGLPDGAEISVALDGDRMLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRLLDGGETPLRLQIGSNN
FT                   LRAHVGGFIFTSKLVDGRFPDYRRVLPKNPDKALEAGCDELKQAFARAAILSNEKFRGV
FT                   RLHVSHNQLKITANNPEQEEAEELLDVDYPGSDLEIGFNVSYVLDVLNALKCERVVMML
FT                   TDAVSSVQIEDAASQAAVYVVMPMRL"
FT   CDS_pept        2525..3601
FT                   /codon_start=1
FT                   /gene_family="HOG000269560" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409484"
FT                   /gene_name="recF"
FT                   /locus_tag="ETAF_0003"
FT                   /function="ATP binding"
FT                   /function="single-stranded DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /biological_process="SOS response"
FT                   /cellular_component="chromosome"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40126.1"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0009432"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="UniParc:UPI0001BD045C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T440"
FT                   /transl_table=11
FT                   /translation="MALTRLVIRDFRNIEDADLALAPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSLQAGRVIRHDCAAFVLHGRIDDGGGRELAVGLSKDRQGDSKVRIDGSDGH
FT                   KVAELAQMLPMQLITPEGFTLLNGGPKYRRAFLDWGCFHGDRGFFTAWNNLRRVLKQRN
FT                   AALRQVTRYAQIRPWDQELVPLAEQVSALRAAYSEAIAQDIAATCSQFLPEYALSFSFM
FT                   RGWDRESDYAALLERHFERDRALTYTALGPHKADFRIRADGTPVEDLLSRGQLKLLMCA
FT                   LRLAQGEYLTRHSGRQCLYLIDDFASELDAGRRRLLAERLKATGAQVFVSAVNADQVGD
FT                   MVDEKGKMFRVEQGKIAV"
FT   CDS_pept        3645..6059
FT                   /codon_start=1
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409485"
FT                   /locus_tag="ETAF_0004"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /biological_process="DNA topological change"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ADM40127.1"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001BD045D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T441"
FT                   /transl_table=11
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGYCKDIIVTIHSDNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRRDGHVHEQIYRHGVPAAPLKVVGDTEQT
FT                   GTRVRFWPSMETFSNVVEFQYDILAKRLRELSFLNSGVSIRLRDKRNDREDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LAGFRAAMTRTLNSYMENEGYTKKSKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKSAVESLMNERLAEYLLENPSDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPAHSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQMSIALDGAALHINAAAPALA
FT                   GEPLEKLVAEHYQVQKLIGRMERRYPKAVLNQLIYQPTLSEADLGNQAQVEQWINSLVA
FT                   TLNEKEQHGSVYSARVLENRERQMFEPLVRVRTHGVDTDYAFDFDFVHGAEYRRICALG
FT                   EKLRDLLEESAFVERGERRQPVASFEQALDWLVKESRRGLAIQRYKGLGEMNPEQLWET
FT                   TMDPEGRRMLRVTIKDAVAADQLFTTLMGDAVEPRRAFIEENALKASNLDF"
FT   CDS_pept        6158..6976
FT                   /codon_start=1
FT                   /gene_family="HOG000184780" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409486"
FT                   /locus_tag="ETAF_0005"
FT                   /function="hydrolase activity"
FT                   /protein_id="ADM40128.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR013200"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001BD045E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T442"
FT                   /transl_table=11
FT                   /translation="MPIKLIAIDLDGTLLNEAREITPAVKAAIADARRRGVKVVLATGR
FT                   PLIGVRPYLRELALDVAGEYCLCNNGGLIVHADSGETLFETALDYGDYRYLEALAREVD
FT                   CHFHALDAERLFTANRDISKYTVHESFITGIPLYFCPVEQMAPSLRFPKVMMIDHPEVL
FT                   EAAIARIPAQAYQRYTLLRSSPFFLEILHRDVDKGKGIARLAEHLGIDRQHVMCIGDHG
FT                   NDLAMIDYAGLGVAMGNAEPAILAAAQYVTASNREDGVAQAIQRWVLNAA"
FT   CDS_pept        7062..8360
FT                   /codon_start=1
FT                   /gene_family="HOG000126359" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409487"
FT                   /gene_name="yidR"
FT                   /locus_tag="ETAF_0006"
FT                   /protein_id="ADM40129.1"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniParc:UPI0001BD045F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4I4"
FT                   /transl_table=11
FT                   /translation="MRHPSELQLTDDARGHQLTNTHVWTPDSRWIAYDVRPRGSTFSGE
FT                   TIERVSVPDGQTQCLYRAVDGACVGVVTVAPTSPERYVFIHGPEHPDALWQYDFHHRRG
FT                   VIVSAEHPDVAETLDALDITPPYTPGALRGGSHVHVFSPDASRLSFTYNDHVMHEDCPE
FT                   RDQRNVGVALSGASVRSAKSHPREYDGSHFCVLVTHTTPAPRPGSDDITRAYEEGWVGH
FT                   RGYLKPDGLRQRWALAFIGDTLSEDGQRVPELFIVDLPEEDSAYRQAGVSPLQGTGSTL
FT                   PAPPAGVSQRRLTFTHSRRYPGLATLPRHWVRSAPDGGSLAFLMRDDNGVVQLWRVSPN
FT                   GGELRQVTHGGYDVQSAFNWHPDGRSVLMVMDNSVVRCDVASGAVTRITERTAQPPCAD
FT                   AVIPSPDGRWVAYMREVNGWAQIFVARLTTDDE"
FT   CDS_pept        complement(8367..8636)
FT                   /codon_start=1
FT                   /gene_family="HOG000126348" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409488"
FT                   /gene_name="yidQ"
FT                   /locus_tag="ETAF_0007"
FT                   /protein_id="ADM40130.1"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniParc:UPI0001BD0460"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4I5"
FT                   /transl_table=11
FT                   /translation="MTRVGPHQGYYAGTKNDLQMIGSEESGWAMRPLLALDLPLSAVAD
FT                   TLLLPYDYYRADDDPATASPRARVQRAEQASAASGMAPPAALEN"
FT   CDS_pept        8993..9406
FT                   /codon_start=1
FT                   /gene_family="HOG000251750" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409489"
FT                   /locus_tag="ETAF_0008"
FT                   /biological_process="response to stress"
FT                   /protein_id="ADM40131.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI0001BD0461"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4I6"
FT                   /transl_table=11
FT                   /translation="MRNFDLAPLYRSAIGFDRLFNLIESGQNNTNGGYPPYNVELVDDN
FT                   HYRISIAVAGFDEAELEITSHANSLMVKGSHQAIDKQRTYLYQGIAERNFERKFQLAEH
FT                   IHIKGARLENGLLFIDLERIIPESQQARKIAIK"
FT   CDS_pept        9522..9986
FT                   /codon_start=1
FT                   /gene_family="HOG000251750" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409490"
FT                   /locus_tag="ETAF_0009"
FT                   /biological_process="response to stress"
FT                   /protein_id="ADM40132.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI0001BD0462"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4I7"
FT                   /transl_table=11
FT                   /translation="MRNYDLSPLMRQWIGFDKLANAMQTSLEPQGFPPYNIEKSDDNHY
FT                   RISLALAGFRQSELDIEVEGPRLTVRGNPVKPEKPVEYLHQGLVCKAFELSFTLAEHLT
FT                   VEGAAFENGLLNIDLVRHVPEALQPQRIIIGAAQRDPAALECRDEPNTQQ"
FT   CDS_pept        10181..11440
FT                   /codon_start=1
FT                   /gene_family="HOG000269357" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409491"
FT                   /locus_tag="ETAF_0010"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="valine-pyruvate transaminase activity "
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40133.1"
FT                   /db_xref="GO:0009042"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001BD0463"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4I8"
FT                   /transl_table=11
FT                   /translation="MTFSAFGERFTRYSAITRLMDDLNNGLRTPGAVMLGGGNPARIAQ
FT                   MDAYFTSLCGELLEEGTLGEALCNYDGPQGKDTLLEALARLLSEQYGWPIGPQNIALTN
FT                   GSQSAFFYLFNLFAGRCSDGTRRRVLFPLAPEYIGYADAGLEDDLFVALKPSIALLPQG
FT                   QFKYHIDFDRLKIEDDIGLICVSRPTNPTGNVLTDEELTRLDALARQHRVPLLIDNAYG
FT                   VPFPGIIFTEATPLWNPNTILCMSLSKLGLPGVRCGIVVADERTIQALSNMNGVISLSP
FT                   GSMGPALALRMIERGDLLRLSREVIRPFYQQRVDQTLAIIRRYLPEERCLIHRPEGAIF
FT                   LWLWFKDLPIGSEELYQRLKQRGVLMVPGDYFFPGLAQAWPHTRQCMRMNYVPDPTLIE
FT                   RGVQILAEEVERAYREAGAA"
FT   CDS_pept        complement(11510..12229)
FT                   /codon_start=1
FT                   /gene_family="HOG000126013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409492"
FT                   /locus_tag="ETAF_0011"
FT                   /protein_id="ADM40134.1"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniParc:UPI0001BD0464"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4I9"
FT                   /transl_table=11
FT                   /translation="MTFAVKTWAQRLLMPVMALFLVMQLSGCGDSDKEQQKAFIDYLQN
FT                   TVMRGSVTIPTLSEAQKQQLGHYAGDYAVLVTFSQNFNRAMEASMTPLFSTLQQIRTPQ
FT                   EYLTQRDRLQQELGALNMLGQQIQSAKAQADGAYATLKQPEEVKAVFDKAFTKIVTGPS
FT                   NAVMPMIPQAADVAQTLVQVGDFLQNLGPQARFDNQGVQLQTQAQVDQYNQLMRDLSAK
FT                   YQTLMAAKQQNAGLLQN"
FT   CDS_pept        complement(12362..14431)
FT                   /codon_start=1
FT                   /gene_family="HOG000264302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409493"
FT                   /gene_name="glyS"
FT                   /locus_tag="ETAF_0012"
FT                   /function="ATP binding"
FT                   /function="arginine-tRNA ligase activity"
FT                   /function="glycine-tRNA ligase activity"
FT                   /biological_process="arginyl-tRNA aminoacylation "
FT                   /biological_process="glycyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40135.1"
FT                   /db_xref="GO:0004814"
FT                   /db_xref="GO:0004820"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006420"
FT                   /db_xref="GO:0006426"
FT                   /db_xref="InterPro:IPR002311"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniParc:UPI0001BD0465"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J0"
FT                   /transl_table=11
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAQAFADNFRTELDNAGLAHGDI
FT                   EWFAAPRRLALKVAALNAAQPDREIEKRGPAIAQAFDADGKPTKAAEGWARGCGISVDQ
FT                   ADRLSTDKGEWLLYRALQKGQRAQDLLPTRVANALSRLPIPKLMRWGDSDTQFVRPVHT
FT                   VTLLLGSESIPATILGVPSDRVIRGHRFMGEAEFTIDSADQYPQILLERGKVIADYDAR
FT                   KALIKRDAEAAAARIGGVADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDAAGKLLPNFIFVANIDSKDAQQIISGNEKVVRPRLADAEFFFKTDRKQ
FT                   RLEDNLPRLETVLFQQQLGSLRDKTDRITALAGWIAQQIGADVNMATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEADEVAVALNEQYMPRFAGDALPTSLVACAVAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIVVEKKLPLDLLTLTQEAVRLYGDKLSN
FT                   ANVVDDVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTRPADFDARVRAVSHFRTLPEA
FT                   ATLAAANKRVSNILAKSGDVLAEQVQAVLLKEPAEIRLAANLITLQEKLAPLFADGRYQ
FT                   EALVELATLRQPVDDFFEQVMVMADDEQVRINRLTLLNKLRDLFLQVADISVLQ"
FT   CDS_pept        complement(14441..15349)
FT                   /codon_start=1
FT                   /gene_family="HOG000264291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409494"
FT                   /gene_name="glyQ"
FT                   /locus_tag="ETAF_0013"
FT                   /function="ATP binding"
FT                   /function="glycine-tRNA ligase activity"
FT                   /biological_process="glycyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40136.1"
FT                   /db_xref="GO:0004820"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006426"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniParc:UPI0001A5A04C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J1"
FT                   /transl_table=11
FT                   /translation="MQKFDIKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKA
FT                   LGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFAC
FT                   FEQYEKEARMLLELEHPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   MVAEAYYASREALGFPMCKKD"
FT   CDS_pept        15563..16162
FT                   /codon_start=1
FT                   /gene_family="HOG000220753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409495"
FT                   /locus_tag="ETAF_0014"
FT                   /function="DNA-3-methyladenine glycosylase I activity "
FT                   /biological_process="base-excision repair"
FT                   /protein_id="ADM40137.1"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="GO:0008725"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniParc:UPI0001BD0466"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J2"
FT                   /transl_table=11
FT                   /translation="MDDHAPPRCAWVSADPLYIAYHDHEWGRPLYDGQALFELLCLEGQ
FT                   QAGLSWLTVLKKRQRYRQAFHGFDPAKVAAMTAEDIADLLLDQGLIRNRRKLEAIVTNA
FT                   RALLAMAQRGEAFSAFIWSFVGGAPLAPPEGGWQALTHTSVSDALARALKQRGFTFVGT
FT                   TICYAFMQACGMVNDHMPGCCLYHDASPVSASGQAR"
FT   CDS_pept        16122..16628
FT                   /codon_start=1
FT                   /gene_family="HOG000078517" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409496"
FT                   /locus_tag="ETAF_0015"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ADM40138.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001E3551C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J3"
FT                   /transl_table=11
FT                   /translation="MMRPLYLRPARPADTSALLALWLKLTIQAHPAIPPGYWRASLPWV
FT                   RDAYLPEGQTWLATDRGRIGGFICILPGHLLGALFVARRYRGRGVAQRLMRHAKRHHPW
FT                   LLLEAYCANLRAQAFYRRQGFHCIDRQIQAQTGQAVATLLWQRRAVLEKSERLDYTARS
FT                   SVMGE"
FT   CDS_pept        16824..17348
FT                   /codon_start=1
FT                   /gene_family="HOG000224540" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409497"
FT                   /locus_tag="ETAF_0016"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40139.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniParc:UPI0001BD0468"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J4"
FT                   /transl_table=11
FT                   /translation="MSSVALAEIGDKTQLLTLLLVARFGKPFLILLAIILATLVNHYFA
FT                   ALIGELVTQFLSPQIMRWMVAAGFLAMAVWVLFPDKDDGEIRGGHPFWTSLVVFFLAEI
FT                   GDKTQIATVLLGAHYQHITWVVLGSTLGMVLANAPMLWFGARLQPYLKSGWGRRLSSLL
FT                   FAILGVVTLIL"
FT   CDS_pept        17497..18156
FT                   /codon_start=1
FT                   /gene_family="HOG000189914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409498"
FT                   /locus_tag="ETAF_0017"
FT                   /cellular_component="cell outer membrane"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40140.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0009279"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="UniParc:UPI0001BD0469"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J5"
FT                   /transl_table=11
FT                   /translation="MKKSRFCIAGLISAALILSGCTTNPYTGESQAGKSGVGAGLGALL
FT                   GAGVGALSSSKSDRGKGALIGAAAGAALGGGIGYYMDVQEAKLRDKMRGTGVSVTRQGD
FT                   NIVLNMPNNVTFDSNSSNLKPAGANTLTGVAMVLKEYQKTAVNVVGYTDSTGSRDLNMR
FT                   LSQQRADSVASALIVQGVSAGRIRTIGMGPANPIATNSTAAGKAQNRRVEITLSPL"
FT   CDS_pept        complement(18195..18443)
FT                   /codon_start=1
FT                   /gene_family="HOG000259291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409499"
FT                   /gene_name="tusA"
FT                   /locus_tag="ETAF_0018"
FT                   /function="sulfurtransferase activity"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40141.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0016783"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="UniParc:UPI0001E3551D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J6"
FT                   /transl_table=11
FT                   /translation="MTDLFANPDKTLDALGLRCPEPVMMVRKAVRHMAAGETLLIIADD
FT                   PATTRDIPGFCRFMDHALLAQEIEQTPYRYLLRKGGA"
FT   CDS_pept        18723..19382
FT                   /codon_start=1
FT                   /gene_family="HOG000284591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409500"
FT                   /locus_tag="ETAF_0019"
FT                   /protein_id="ADM40142.1"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniParc:UPI0001BD046B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J7"
FT                   /transl_table=11
FT                   /translation="MFSFTPQQRFTALCWLSLFHVLIITSSNYLVQLPITVFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILAVMVPALLISYCVSALFFQGQWQGFAALGSV
FT                   NLMVARIACASFMAYVLGQILDVHVFNRLRQTRAWWVAPTASTLFGNISDTLSFFFIAF
FT                   YRSSDAFMATHWVEIALVDYAFKLLISMVFFLPMYGVMLNMLLKRIAFRQQQASLA"
FT   CDS_pept        19592..21586
FT                   /codon_start=1
FT                   /gene_family="HOG000285275" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409501"
FT                   /locus_tag="ETAF_0020"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ADM40143.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001E3551E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J8"
FT                   /transl_table=11
FT                   /translation="MYKYPILICALLSPLTATTYAADAEQPPVVSRVHPLLHVQGYTFR
FT                   DANGNGRLDPYEDWRLSAEQRSADLVARMTLREKAGMMMIDTFRVAPQGAIRQEDAALI
FT                   REQHMTRFIFRNPVVSQPQSGTNQLTPREVAEALNQAQEMAERTPHGIPALFKSNARNH
FT                   LDPQAREGINVISGAFSSWPKEAGLAATRDMSLIREFAGIMAQEWRAVGIRGMYGYMMD
FT                   LATEPRWYRVHETFTEDADLMSDIARQLILGLQGERLGRDSIALTIKHFPGGGPQENGG
FT                   DPHYAYGKNQNYAGQNFRYHLKPFITAIELGVSAIMPYYGIPVGQALTPNDVGMAFSAG
FT                   VITGLLREQLGFKGYVNSDTGIIGDRAWGIEHLPEQEQIAIAVNAGTDVLSGYHSNAIV
FT                   YDTIRAGKISQERVDLAVSRLLKEQFTLGLFENAYVDPERATQTLGNKAFQALASLAQR
FT                   KSIVLLKNGDDRAPLLPLAPAQTLYVVGMDKAIVEAYGFRVISGDRRGGALPAIPPQTA
FT                   RAIVRVVVSNPYVEARRFGGAAEDELNDLAFSAMARAKTWQITPSLADIQTIMARVGAA
FT                   NTILSINYRQPFVLDRASGMDRAGAILATFGVSDHALMDVLSGRFNPQGRLPFALPNQA
FT                   QAVVNQLSDMPGYRALDTWRPYGFGLRYQ"
FT   CDS_pept        21694..21858
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409502"
FT                   /locus_tag="ETAF_0021"
FT                   /protein_id="ADM40144.1"
FT                   /db_xref="UniParc:UPI0001BD046D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4J9"
FT                   /transl_table=11
FT                   /translation="MTPITLHSATPAAILALYRAIPEFAPRHSLADIQRRLAGRQASLL
FT                   IARSGGRDV"
FT   CDS_pept        21860..22141
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409503"
FT                   /locus_tag="ETAF_0022"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ADM40145.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001BD046E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K0"
FT                   /transl_table=11
FT                   /translation="MGYALDEQTFYSWLGGVLPGWRRKGIAQILLHAQQAWALNQGYRR
FT                   IEVKTRNGFSSMLMMLINNGYHIIQVQPQDEVVDYRLRLVRDLRLDAA"
FT   CDS_pept        22218..22793
FT                   /codon_start=1
FT                   /gene_family="HOG000125708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409504"
FT                   /locus_tag="ETAF_0023"
FT                   /protein_id="ADM40146.1"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="UniParc:UPI0001BD046F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K1"
FT                   /transl_table=11
FT                   /translation="MGNLVKLIGVGLLVTGLAACDGSSTAETNAPAQGASATQPSVPAG
FT                   AKVSLLDGKIGFTLPAGLSDQTSKLGSQTNNMSVYANKTGQQAVIVILAPMPQDNLNTL
FT                   STRLIDQQKSRDASLQLVSSESVKLGGKDVEKVVSMQQANGHAIYSSIILAQVGDQLMT
FT                   MQISLPGDNRQEAANIANGVLNTLSFAQ"
FT   CDS_pept        complement(22815..24512)
FT                   /codon_start=1
FT                   /gene_family="HOG000126237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409505"
FT                   /locus_tag="ETAF_0024"
FT                   /protein_id="ADM40147.1"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniParc:UPI0001BD0470"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K2"
FT                   /transl_table=11
FT                   /translation="MKVIGKLLLTLCVLILLALAAAYFIVQSRWGARQISDWVNQHTHY
FT                   RITLSALQHTLGQPATVQVNGFSLARAGQPPLIQSATLRLTFGWQQLSAPRHFSAISLS
FT                   GGKLTLTQDGIPPLPISAAALRLHDMQILWPHADWPLQASDVDGGIVPLRPGSTKVDFQ
FT                   FSAAALNIGEIPAKNVLVQGEYRDRQLWLNNLGADVANGQMTAQALRQADGTWRIDSLR
FT                   LSQIHWQSPQALRPFLHALQILPPLTLVRLDLLGANLEGKGWALGGLDATLRNVSLTDG
FT                   HWHSQRGSLAFNAADIVLGAVHLSDPLLSADLTPQGITLRQFNTRWSNALIRASGDWQR
FT                   DSGHLTLNDLAVVGLEYTLPSAWRTLWLRPLPAWLQEITLQRFSLSRTLLVDINPDFPF
FT                   QMTALDGFGSHVTLARQRRWGIWQGQMQFNASEATFNKVDLRRPSATLLADGGTVRVSD
FT                   LSAISQKGLLEASATLIQDDSLLTLALHGRGVPVSQLDAWGWPALTTLQGDMNLQLTLR
FT                   APLQAGTPFRQGVEATLQAQDGHGHTLHQRMVSGQLVAEPSPIATEGR"
FT   CDS_pept        complement(24711..26114)
FT                   /codon_start=1
FT                   /gene_family="HOG000038198" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409506"
FT                   /locus_tag="ETAF_0025"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40148.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniParc:UPI0001BD0471"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K3"
FT                   /transl_table=11
FT                   /translation="MTTQTTDLDPMAQPTTPPTTHSELIYRLDDCPPLAQTLFAACQHL
FT                   LAMFVAVITPALLICQALGLPAQDTQHIISMSLFASGLASLLQIKTWGPVGSGLLSIQG
FT                   TSFNFVTPLIMGGMALKNGGADIPTMMATLFGTLMLASCTEIILSRFLHLARRIITPLV
FT                   SGIVVMIIGLSLIQVGLISIGGGYSAMGDHSFGAPRNLLLAGAVLLVIILLNRQRNPYL
FT                   RVASLVIAMAVGYGLAWLMDMLPASAAQPNTAPLVTIPTPLYYGLGIDWNLLIPLMLVF
FT                   MVTSLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSMLSAIFNTFPNSCFGQN
FT                   NGVIQLTGVASRKVGFVVALMLVLLGLFPAVAGFVQHIPEPVLGGATIVMFGTIAASGV
FT                   RIVSREPLNRRAIMIMALSLAVGLGVSQQPEILQFAPQWLKTLLSSGIAAGGITAIVLN
FT                   LIFPHETHR"
FT   CDS_pept        26348..27562
FT                   /codon_start=1
FT                   /gene_family="HOG000282013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409507"
FT                   /locus_tag="ETAF_0026"
FT                   /function="glutamate:sodium symporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40149.1"
FT                   /db_xref="GO:0015501"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniParc:UPI0001BD0472"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K4"
FT                   /transl_table=11
FT                   /translation="MYHLDIYGTLVAATLVLLLGRQMVQKIPLLTKYTIPEPVAGGLLV
FT                   ALALLILKKSIGFEVDFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFLFVVVGL
FT                   LIVQNAIGISMAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFQNATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPDGTPDDNAVPSAFEKPQSGRMITSLVLIETLA
FT                   LIVICLTVGQLIAGWLRGSALELPTFVCVLFVGVILSNTLSKIGFYQVFERAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLAILAVQTLVMALYAIFVTYRVMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITERFGPSHLAFLVVPMVGAFFIDIANAIIIKLYLMLPLF
FT                   AQAIG"
FT   CDS_pept        complement(27579..29660)
FT                   /codon_start=1
FT                   /gene_family="HOG000036617" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409508"
FT                   /gene_name="recG"
FT                   /locus_tag="ETAF_0027"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ADM40150.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0001BD0473"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K5"
FT                   /transl_table=11
FT                   /translation="MQGRLLDAVPLTSLSGVGASQAGKLAKLGLVTIQDLLLHLPLRYE
FT                   DRTRLYRIGELQPGMVVTVEGEVLRTDVAFGRRRMLTSQISDGSGLLTLRFFNFSAAMK
FT                   NSLAPGKRVLAYGEIKRGHHGGEIIHPEYRMQGDDAAPALQEALTPVYPTTEGVRQATL
FT                   RKLSDQALALLDITPIPELLPDALKQGLLSLPDALRTLHRPPPDIHQEDLAQGRHPAQR
FT                   RLILEELLAHHLSMLAVRAGNQRHRALALATDDHLKQRFLAALPFTPTTAQRRVLGDIE
FT                   ADMAKSVPMMRLVQGDVGCGKTLVAALAALRAIAHGHQVALMAPTELLAEQHAANFRQW
FT                   FAPLGLSVGWLAGKQKGKARQTQMAAIAAGEVDMVVGTHALFQEQVQFAGLALVIIDEQ
FT                   HRFGVHQRLALWEKGEAQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIADTRRQQILDRVRHACLEEKRQAYWVCTLIEESDLLEAQAAEATAETLMQQLPE
FT                   LRIALVHGRMKAADKQRVMTQFKAGEVDLLVATTVIEVGVDVPNASLMIIENPERLGLA
FT                   QLHQLRGRVGRGAIASHCVLLYKAPLSQTAQRRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGNAEFRVADLLRDQALIPEVQRIARHLHSAYPQHARALIERWLPAGSRYSNA"
FT   CDS_pept        complement(29662..30321)
FT                   /codon_start=1
FT                   /gene_family="HOG000285175" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409509"
FT                   /locus_tag="ETAF_0028"
FT                   /function="RNA binding"
FT                   /function="tRNA (guanosine-2'-O-)-methyltransferase
FT                   activity"
FT                   /protein_id="ADM40151.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009020"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="UniParc:UPI0001BD0474"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K6"
FT                   /transl_table=11
FT                   /translation="MMAARQPDLTVCMEQVHKPHNVSAVIRTADAVGVHQVHAVWPGKS
FT                   MRTLVSTAAGSNSWVNVKTHRDIATAVGELKGQGMQILATNLSATAVDFREIDYTRPTC
FT                   ILMGQEKRGISAEALQLADRDIIIPMVGMVQSLNVSVASALILYEAQRQRQQAGMYGRS
FT                   QPSLSEEEQQRLLWEGGYPVLASVARRKGLARPHIGDDGQIDAPQAWWDAMQAARS"
FT   CDS_pept        complement(30360..32453)
FT                   /codon_start=1
FT                   /gene_family="HOG000018299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409510"
FT                   /locus_tag="ETAF_0029"
FT                   /function="GTP diphosphokinase activity"
FT                   /function="guanosine-3',5'-bis(diphosphate) 3'-
FT                   diphosphatase activity"
FT                   /function="kinase activity"
FT                   /biological_process="guanosine tetraphosphate metabolic
FT                   process"
FT                   /protein_id="ADM40152.1"
FT                   /db_xref="GO:0008728"
FT                   /db_xref="GO:0008893"
FT                   /db_xref="GO:0015969"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniParc:UPI0001BD0475"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K7"
FT                   /transl_table=11
FT                   /translation="MYLFESLNLLIQKYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIDG
FT                   RLTEAGMACQVNGREKHLYSIYRKMHLKEQRFHSIMDIYAFRVIVKDVDTCYRVLGQVH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEGESSTTAQIRAQRWMQSLLELQQSAGNSFEFIESVKSDLFPDEIYVFTPEGRIVEL
FT                   PAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQALSSGQTIEVITAPGARPNAAWLN
FT                   FVVSSKARAKIRQMLKNLKRDDSVSLGRRLLTHALGNGRKLASIPAPNIQRELERMKLQ
FT                   SLDDLLAEIGLGNAMSVVVARNLLGEQDTPPGGRKLPIKGADGVLLTFAKCCRPIPGDP
FT                   IIAHVSPGKGLVIHHESCRNIRGYQKEPEKFMPVEWDKEIDQEFIAEIKVDMFNHQGAL
FT                   ANLTAAINATASNIQSMNTEEKDGRVYSVYIRLTTRDRVHLANIMRKIRIMPDVIKVTR
FT                   NRN"
FT   CDS_pept        complement(32473..32748)
FT                   /codon_start=1
FT                   /gene_family="HOG000245721" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409511"
FT                   /gene_name="rpoZ"
FT                   /locus_tag="ETAF_0030"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="RNA polymerase complex"
FT                   /protein_id="ADM40153.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0030880"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="UniParc:UPI0001BD0476"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K8"
FT                   /transl_table=11
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQMQTGGKEPLVPEENDK
FT                   TTVIALREIEEGLINNQILDVRERQEQQEQEAAELQAVTAIAEGRR"
FT   CDS_pept        complement(32803..33426)
FT                   /codon_start=1
FT                   /gene_family="HOG000037638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409512"
FT                   /locus_tag="ETAF_0031"
FT                   /function="ATP binding"
FT                   /function="guanylate kinase activity"
FT                   /biological_process="purine nucleotide metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40154.1"
FT                   /db_xref="GO:0004385"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006163"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="UniParc:UPI0001BD0477"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4K9"
FT                   /transl_table=11
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPTYDSRVSVSHTTRASR
FT                   PGEQHGEHYYFVSVDEFKAMIARDDFLEHAEVFGNYYGTSRQAIEKVLAQGIDVFLDID
FT                   WQGARQVRSKMPQARSIFILPPSREELARRLHGRGQDSDDVIAGRMAKAVSEMSHYSEY
FT                   DYLIINDDFDVALQDLRTIIRAERLRRERQQLRHDALISKLLAD"
FT   CDS_pept        complement(33547..34167)
FT                   /codon_start=1
FT                   /gene_family="HOG000218257" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409513"
FT                   /locus_tag="ETAF_0032"
FT                   /protein_id="ADM40155.1"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniParc:UPI0001BD0478"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L0"
FT                   /transl_table=11
FT                   /translation="MLLSILYIVGITAEAMTGALAAGRRQMDTFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLSWVKHPENIVIVACAAVLTTWVAPLMSHLRRLFLLLDAVGLIVFSIIG
FT                   AQVALEMGHGPIVAVIAAVVTGVFGGVLRDLFCNQIPLVFQKELYAGISFAAAWLYLGL
FT                   LYLQVPQDLTVIITLVAGFSARLLALRFHLSLPVFDYKQPERE"
FT   CDS_pept        complement(34488..35351)
FT                   /codon_start=1
FT                   /gene_family="HOG000037752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409514"
FT                   /gene_name="yicC"
FT                   /locus_tag="ETAF_0033"
FT                   /protein_id="ADM40156.1"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniParc:UPI0001BD04D5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L1"
FT                   /transl_table=11
FT                   /translation="MIRSMTAYARREVKGNWGSAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERLRTRLTRGKVECNLRFELDPSAQSALILNESLAKQLVDAANWVKLQSDEGEI
FT                   NPLDVLRWPGVMAAAEQDLDAIGSELLAALDGTIDDFIDAREREGSALKQLIEQRLEAV
FT                   SAEVAKVRSRMPEILQWQRERLVSKLEEAQVQLENNRLEQELVLMAQRIDVAEELDRLD
FT                   AHVKETYVILKKKEAVGRRLDFMMQEFNRESNTLASKSINADITASAIELKVLIEQMRE
FT                   QIQNIE"
FT   CDS_pept        35484..36200
FT                   /codon_start=1
FT                   /gene_family="HOG000229516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409515"
FT                   /gene_name="rph"
FT                   /locus_tag="ETAF_0034"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="tRNA binding"
FT                   /function="tRNA nucleotidyltransferase activity "
FT                   /function="tRNA-specific ribonuclease activity "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ADM40157.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0004549"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0009022"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001BD04D6"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L2"
FT                   /transl_table=11
FT                   /translation="MRPEGRAAGQIRPLRLTRHYTKHAEGSVLVEFGDTKVLCTASVDE
FT                   GVPRFLKGQGQGWVTAEYGMLPRSTHSRMAREAAKGKQGGRTMEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVIQADGGTRTASITGACVALADALGALVAAGKLKESPLKGMVAAVS
FT                   VGIVADEAVCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLTLLALAR
FT                   DGIGQIIQAQKTALEQ"
FT   CDS_pept        36283..36924
FT                   /codon_start=1
FT                   /gene_family="HOG000037974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409516"
FT                   /locus_tag="ETAF_0035"
FT                   /function="orotate phosphoribosyltransferase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="ADM40158.1"
FT                   /db_xref="GO:0004588"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="UniParc:UPI0001BD04D7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L3"
FT                   /transl_table=11
FT                   /translation="MKAYQRRFIEFALSKQVLKFGEFTLKSGRTSPYFFNAGLFNTGRD
FT                   LALLGRFYAEALVDSGIAFDVLFGPAYKGIPIATTTAVALAEHHDRDMPYCFNRKEAKD
FT                   HGEGGTLVGSALVGRVMLVDDVITAGTAIRESMSIIQANGAALAGVLISLDRQERGRGE
FT                   LSAIQEVERDYGCRVISIITLGDLIRYLEEQPEMAQHLAAVKAYRAQYGV"
FT   CDS_pept        complement(36962..37558)
FT                   /codon_start=1
FT                   /gene_family="HOG000266053" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409517"
FT                   /gene_name="slmA"
FT                   /locus_tag="ETAF_0036"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="specific transcriptional repressor activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40159.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016566"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniParc:UPI0001BD04D8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L4"
FT                   /transl_table=11
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDTLTSRINLILQDEKDTFNRLRLILLLILGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIEAQLRQVLKERRLREGSGFDHDETLLASQLL
FT                   AFCEGMLSRFVRSEFRYRPTQEFETRWPLLACQLQ"
FT   CDS_pept        complement(37664..38122)
FT                   /codon_start=1
FT                   /gene_family="HOG000028968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409518"
FT                   /gene_name="dut"
FT                   /locus_tag="ETAF_0037"
FT                   /function="dUTP diphosphatase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="dUTP metabolic process"
FT                   /protein_id="ADM40160.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004170"
FT                   /db_xref="GO:0046080"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="UniParc:UPI0001BD04D9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L5"
FT                   /transl_table=11
FT                   /translation="MKKKIDVKILDARIGQQFPLPTYATPGSAGLDLRACLDRAVVLAP
FT                   GETTLLPTGLAIHIADPSLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNR
FT                   GQTPFTIEPGERIAQLVLVPVVQADFNLVESFEGSARGDGGFGHSGRH"
FT   CDS_pept        complement(38100..39317)
FT                   /codon_start=1
FT                   /gene_family="HOG000037526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409519"
FT                   /locus_tag="ETAF_0038"
FT                   /function="FMN binding"
FT                   /function="phosphopantothenate--cysteine ligase activity "
FT                   /function="phosphopantothenoylcysteine decarboxylase
FT                   activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /biological_process="pantothenate catabolic process "
FT                   /protein_id="ADM40161.1"
FT                   /db_xref="GO:0004632"
FT                   /db_xref="GO:0004633"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="GO:0015941"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniParc:UPI0001E3551F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L6"
FT                   /transl_table=11
FT                   /translation="MTVLRGKRILLGISGGIAAYKCPEIVRRLRERGAEVRVVMTKGAQ
FT                   AFITPLTLQAVSGYPVADDLFDPAAEASMGHIALGKWADLVLLAPATADLMARLAAGMA
FT                   DDLLATLCLASAAPLAIAPAMNQQMFRAAATQDNLATLARRGALIWGPDSGEQACGDVG
FT                   PGRMLDPLTLVSLTEQHFSQSQDLAAYRLIITAGPTREALDPVRFISNHSSGKMGFAIA
FT                   EAAARRGAQVTLISGPVALPTPPGVARVDVQSALDMQAAVAQRARDCDIFIACAAVADY
FT                   RAQQIAPEKMKKQQGDTLTLTLVKNPDIVAGVAAMTEARPFVVGFAAETQNVEEYAKQK
FT                   LARKGLDLICANDVSQDGQGFNSDTNALHLFWPQGDKRLPLSSKSRLGCTLINEIVRHY
FT                   EEKNRR"
FT   CDS_pept        39507..40193
FT                   /codon_start=1
FT                   /gene_family="HOG000273376" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409520"
FT                   /gene_name="radC"
FT                   /locus_tag="ETAF_0039"
FT                   /protein_id="ADM40162.1"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="UniParc:UPI0001BD04DB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L7"
FT                   /transl_table=11
FT                   /translation="MAQGKGEGGWPQGALPREKLLALGAAALSDRELLALFLRTGLPGV
FT                   HVIQLAERLLQRFGSLQGVLRADVDTFCASQGLGIAKFAQLQAVIELSRRVLRHRIGEE
FT                   SAITSPDLTALYLQNLFVSLEREIFVVLFLDNQHRVIRSEQMFSGTINCVDVYPREIVR
FT                   EALKLNAVALILAHNHPSGNPEPSVADRLLTERVAKACALVDIQVLDHMVIGHGQRVSF
FT                   AERGWI"
FT   CDS_pept        40468..40668
FT                   /codon_start=1
FT                   /gene_family="HOG000040462" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409521"
FT                   /locus_tag="ETAF_0040"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40163.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="UniParc:UPI0001BD04DC"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L8"
FT                   /transl_table=11
FT                   /translation="MTGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMR
FT                   VIDKKGIEAVLADLRARGEKY"
FT   CDS_pept        40680..40847
FT                   /codon_start=1
FT                   /gene_family="HOG000004839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409522"
FT                   /gene_name="rpmG"
FT                   /locus_tag="ETAF_0041"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40164.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="UniParc:UPI0001A5A0E4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4L9"
FT                   /transl_table=11
FT                   /translation="MAKGIREKIKLVSSAGTGHYYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVIYKEAKIK"
FT   CDS_pept        40941..41750
FT                   /codon_start=1
FT                   /gene_family="HOG000020881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409523"
FT                   /gene_name="mutM"
FT                   /gene_synonym="fpg"
FT                   /locus_tag="ETAF_0042"
FT                   /function="damaged DNA binding"
FT                   /function="oxidized purine base lesion DNA N-glycosylase
FT                   activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="base-excision repair"
FT                   /biological_process="nucleotide-excision repair "
FT                   /protein_id="ADM40165.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008534"
FT                   /db_xref="InterPro:IPR000191"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="UniParc:UPI0001BD04DD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M0"
FT                   /transl_table=11
FT                   /translation="MPELPEVETSRRGIAPFLEGKTLSHLTVRQPRLRWPVSETLLTLR
FT                   DRPILSVQRRAKYLLLALPEGWIVIHLGMSGSVRILPAQTPPQKHDHVDLLLTDGMMLR
FT                   YTDPRRFGAWLWYDDLATASVLAHLGPEPLSEAFSAEYLLERARGRRTAVKPWLMDNTL
FT                   VVGVGNIYASESLFSAQIHPDRLAGSLSADEASLLVQTIKAVLQRSIDQGGTTLRDFLQ
FT                   ADGKPGYFAQQLQVYGRAGEACLTCGTTIKSSKHGQRTTFYCPHCQR"
FT   CDS_pept        complement(41747..42232)
FT                   /codon_start=1
FT                   /gene_family="HOG000006518" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409524"
FT                   /gene_name="coaD"
FT                   /locus_tag="ETAF_0043"
FT                   /function="ATP binding"
FT                   /function="pantetheine-phosphate adenylyltransferase
FT                   activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40166.1"
FT                   /db_xref="GO:0004595"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001BD04DE"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M1"
FT                   /transl_table=11
FT                   /translation="MSRTAIYPGTFDPLTNGHLDIVTRAAHMFDRVILAIAASPGKRPL
FT                   FTLEERVAMAREVTAHLANVEVQGFSELMAHFAQRQRANILVRGLRAVSDFEYELQLAN
FT                   MNRHLMPTLESVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPEPVARTLMARLRNA"
FT   CDS_pept        complement(42229..43005)
FT                   /codon_start=1
FT                   /gene_family="HOG000262849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409525"
FT                   /locus_tag="ETAF_0044"
FT                   /function="transferase activity"
FT                   /protein_id="ADM40167.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI0001BD04DF"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M2"
FT                   /transl_table=11
FT                   /translation="MPPRLSVVLICKNAADLLPECLASVAWADEIIVLDSGSSDETQRI
FT                   AQAAGAKVYESRDWQGFGIQRQRAQQYASGDYILMIDSDERVTPALKEAIAQVLTQPVT
FT                   ERVYSIARRNLFLGRFMRHSGWYPDRVIRLYPRQRYGYDTSPVHESLACRGASVTPLQG
FT                   DLLHLTCRDFTGFQQKQLCYATAWAHERHARGKKTSMLGIFSHTVGALLKTLLLRGGVL
FT                   DGKQGWLLAVVNAQYTFNKYAELWALQHGYTEKTPL"
FT   CDS_pept        complement(43008..44282)
FT                   /codon_start=1
FT                   /gene_family="HOG000257156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409526"
FT                   /locus_tag="ETAF_0045"
FT                   /function="sugar binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ADM40168.1"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="UniParc:UPI0001BD04E0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M3"
FT                   /transl_table=11
FT                   /translation="MESLYTVLLYIIQPLIWLRLLLRSRKAPAYRKRWGERYGFCRNKV
FT                   APGGILLHSVSVGETLAAVPLVRALRHRYPTLPITVTTMTPTGSERVMSAFGNDVHHVY
FT                   LPYDLPGAMRRFLNTVRPKLVIVMETELWPNMISALHQRQIPLVIANARLSARSAKGYG
FT                   KLGGFMRRLLRKVTLIAAQNQEDGERFIALGLKRSQLAVTGSIKFDISVTPELAARAVT
FT                   LRRQWAPHRKVWIAASTHQGEEAIILQAHRRLLAQFPDLLLILVPRHPERFKETELLTQ
FT                   KEGFTYLMRSGGEIPTPQTQVVIGDSMGELMLLYGIADLAFVGGSLIERGGHNPLEPAA
FT                   HAIPVLMGPHTFNFKDICAKLHQADGLISVADGDALVNEVSTLLTDEDYRLWYGRHAVE
FT                   VLHQNQGALQRLLQLLLPYLPLRSH"
FT   CDS_pept        complement(44456..45538)
FT                   /codon_start=1
FT                   /gene_family="HOG000077289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409527"
FT                   /locus_tag="ETAF_0046"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40169.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0001E35537"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M4"
FT                   /transl_table=11
FT                   /translation="MIIDGLPGGGAEKVVLTLAQYFLAQGDSVSLFSLRDVCHYPLPDG
FT                   LDYRVIRDTCRAPWRKLSELSRRARQLDEAIASAEQKGRYDLVLSNLHKTDRIVARSHL
FT                   LRDHNLWFCLHGVFSTSYLGHRHGFSRWLKREKIRRIYQGRQIVAVSHAVGEDLCQQFN
FT                   VTPAQLQTIPNPFDLEAIRRAADAPCPLEGQDYLIHVGRFHPAKRHDRLLEAYAQSGLS
FT                   APLVLLGQGSPEQEHTLRALAKTLNVAERVHFAGFQANPYPWIRHARLLVVSSDSEGFG
FT                   NVLVEALTLGTAVVSTRCPGGPAEIMTGDLARGLCRPDAASLAQTLQDIYRHPPAIDDT
FT                   QLQQYGVAAVCTRYRQLGKA"
FT   CDS_pept        complement(45554..46681)
FT                   /codon_start=1
FT                   /gene_family="HOG000006663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409528"
FT                   /gene_name="waaG"
FT                   /locus_tag="ETAF_0047"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40170.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0001BD04E2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M5"
FT                   /transl_table=11
FT                   /translation="MTQFRLALVRQKYRPDGGAERFVSRALEALDSHDIELNVITRQWQ
FT                   GPVKPAWHIHLCNPWKWGRISRERGFAHAARTLWQQQRFDLVQSHERIPGCDLYRAGDG
FT                   VHQRWLTQRARILPGWKARMLWHDRYHRYVMNAEQAMYQAPELRAVICNADMIKQEIIA
FT                   DFGVPESKIHVIYNAIDHHRFLPPDEAQRAALRRRWQIPQSASCLIYVGSGFERKGLRA
FT                   AIEAIAPTERYLLVVGKDKEEARYRALANTLGCAQRVRFLGMQPETLPFYQMADGLLLP
FT                   TLYDPFPNVILEAMACGLPVITSTGCGGAEFIRSGDNGYVCDALDIAALRDAAMALPAQ
FT                   ALGSHAGRLARERIMECTAERLSAQLIGLYRQLVK"
FT   CDS_pept        complement(46678..47754)
FT                   /codon_start=1
FT                   /gene_family="HOG000010798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409529"
FT                   /locus_tag="ETAF_0048"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="ADM40171.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniParc:UPI0001BD04E3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M6"
FT                   /transl_table=11
FT                   /translation="MVSNSTLPAAFSPQRILVIKLRHHGDMLLVTPVISTLKRHYPSAQ
FT                   IDVLLYAETRDMLSANQDIHQLYCIDRQWKKQGVRHQLSQEWRLLRTLRAQRYDLVVNL
FT                   ADQWRSAIVTALSAAPVRIGFDFTKRRHPLWRTSHTHLASTAEHGKQHTVEQNLSILAP
FT                   LGLADDDSRVTMGYSEQDWQSASALIPTAWQAGYVVIQPTSRWFFKCWQEARMSEVINA
FT                   LSQAGYPILLTSGPDARERAMIDAIMQGCPTAQVTSLAGQLTLRQLAAIIDHARLFIGV
FT                   DSVPMHMAAALQTPLVALFGPSKLVFWRPWQARGDVIWAGDFGTLPDPDAIDTQTAERY
FT                   LDLIPSSAVIAAAKRLLE"
FT   CDS_pept        47887..48858
FT                   /codon_start=1
FT                   /gene_family="HOG000294585" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409530"
FT                   /locus_tag="ETAF_0049"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ADM40172.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniParc:UPI0001BD04E4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M7"
FT                   /transl_table=11
FT                   /translation="MSHPAFIITIDTEGDNLWQNHDRITTENARYLPRFQQLCEKYGFK
FT                   PVYLTNYEMASDPVYVEFAQDVIARGCGEVGMHLHAWNSPPEIPLTDNDWANKPYLIEY
FT                   PAEVIQQKVDYMTHLLEDTFQTKMVSHRAGRWAMNAFYLQLLLAHGYQVDCSVTPRVDW
FT                   RGARGAPQGNGGSDYSGYPDNAYFVDADDLRREGTSTLLEVPMSTRLKHAPLFNHLRGA
FT                   YDRLRGKRRPASVQWLRPRGGNLQEMQRVAEYHLSQGRDYVEFMLHSSEFMPGGSPTFR
FT                   NEQDIERLYHDLEALFDWLAPQVMGQTLAEYYQIKRGQRPAM"
FT   CDS_pept        complement(48944..50155)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409531"
FT                   /locus_tag="ETAF_0050"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40173.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0001BD04E5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M8"
FT                   /transl_table=11
FT                   /translation="MIDLRKVGGVETMFCDFLRYATQAYPHIQHTLIMEHSGIANALRP
FT                   RLQGLQQVSIQTIKRCGSFSLPNRPKLFRAWNRLRLIRDSAPDIVLIWNQFTEWHLSGS
FT                   RTARYLRCPVVYYEHGMSWYQHTPTLPQRFFAQVTHCLAVSHACKRMLELKHHITQPIA
FT                   VELNAPRSLPAHATPKPARHRGQPIIFGSAGRWVPLKCLGLLLLTSQVLQQRGIPHHCY
FT                   IAGEGKEADYLQHLRTALGVEKETTLLGFVSDMEAFYAKLDLYICPSMHETASLTALEA
FT                   GTYGIPTITSNIDGLPETVRHQQTGLCLTPTLSVEQYAHISAASTDFSPLVYDPVQDRL
FT                   TPPLILSPEQLADSIEDLYNNPETYQQLSDGAREYAAASRRFNDLAQALCQRLLTLAPP
FT                   RPHD"
FT   CDS_pept        complement(50362..51468)
FT                   /codon_start=1
FT                   /gene_family="HOG000012420" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409532"
FT                   /locus_tag="ETAF_0051"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40174.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0001BD04E6"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4M9"
FT                   /transl_table=11
FT                   /translation="MNIAHFETSMDWGGQELRIVEQAEWLNQNGYPTWIIARPGSAILA
FT                   KAQEKNLPTFAIRVRGSVHPKTLAPLLKFIRAQRIDILDCHGSRDAVYGALVKLLTGVK
FT                   VIRSRHVTDPIKMSGLHGLVWRHGNHGIITTAKKIQEMLETQGIPNKDKTLVAPAGVDP
FT                   QRFSPEHDAQQLRARLGIAADSLVIANIGMIRPDKGQNYYVEACKQLLDKGVPITCIQV
FT                   GEATSQTADFKRQVLELAQPYVDKQIRFLGYHNDIENYLAIADIVVVASVATEAQTRLV
FT                   SQAFLMKKNVVATTTGGLPEMIAHEQTGLLCPPHDAKALADAVCRLIEQPPLRAQLREN
FT                   AYQHALQYMTFDYMIKEMVKFYQATLHQ"
FT   CDS_pept        complement(51472..52629)
FT                   /codon_start=1
FT                   /gene_family="HOG000156604" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409533"
FT                   /locus_tag="ETAF_0052"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40175.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0001BD04E7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N0"
FT                   /transl_table=11
FT                   /translation="MAEKSIVHLVNLRDFGGVERLILDYVINGKEHNWVIINTANSLNK
FT                   RFNEHANSIIFCNRAIQSAAIQIPSFIRKKALWNKIKKINPSHVVIWNQIVSLEDKPDS
FT                   IKAIYYDHGAVWEVEKNKKTIDFFKRIDGCICVSQASKKILENKFEHRCDISVILNRTS
FT                   VESRDSIIADEKKKTFTIGCAARFSPLKALGLLPLIAEETALRGFNFNFIIAGTGEEES
FT                   ALASLIDKKNLKKSIKTIGFLDNLNDFYKHIDVYISTSAHETCSLSCIEAMSFGIPIIS
FT                   ANIDGQPEIISNGHTGFCISPTLSMEDYCKKTGMSLPFQKDIYYPENDTIGPPRLLSPK
FT                   DAADKIIEIYLHGVDDYKKNSRHRAKELFDDKTFEENLIKIVRNF"
FT   CDS_pept        complement(52631..53764)
FT                   /codon_start=1
FT                   /gene_family="HOG000156606" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409534"
FT                   /locus_tag="ETAF_0053"
FT                   /protein_id="ADM40176.1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniParc:UPI0001BD04E8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N1"
FT                   /transl_table=11
FT                   /translation="MKTNFIDKLPIYISALFCAFISLLSISDDNNIVSNIYYVSFALFI
FT                   VWCIRERKNIFNKASLLLGAFLLLSAISTYWSDHSKDTSRYIQHAVYIFIFSSIIYELR
FT                   GTLFFKNILFKSYVATCSIFVIINGFLFYSKYNLYDRFYPILGPSNTIDYAGILCLAII
FT                   FCCYLYQHEKNKAPYVIAGIVLLAGVILSQSRTPIIALAISLMVLFIKSKRSAIISLVT
FT                   ILAIIFLIHTVYPSIFTRDAVNGAPTPRIFTWLYTIQQVSEHHPWLGFGYNDTFAHYFK
FT                   PRNFTYNNAHSVFMSMLYYSGIIGVILFFSYILNIFFAAIKVFNENRYPIAFILISLIF
FT                   SSTQGYLYIYHPREIWLVLWLPLFLAIPMSKISSEQV"
FT   CDS_pept        complement(53754..54719)
FT                   /codon_start=1
FT                   /gene_family="HOG000257134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409535"
FT                   /locus_tag="ETAF_0054"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /protein_id="ADM40177.1"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniParc:UPI0001BD04E9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N2"
FT                   /transl_table=11
FT                   /translation="MRILMVKTSSMGDVIHTLPALTDAQQAIPGLCVDWVVEEGFAQIP
FT                   SWHAAVDRVIPVAIRRWRKNLLSAQTRQEWRTFKQQLRQERYDAVIDAQGLLKSALLVT
FT                   HNALGTRHGFDRRSAREPLASLFYDRRHRVARDQHAVERTRQLVAQSLGYPLPAQRGDY
FT                   AIARHFTQQLPMDAGQYMVFLHATTRDEKHWPEAHWRELIAWVGRHTTQRIKLPWGAEH
FT                   EHQRALRLAEGFPHVDVLPKMALSDVATVLAGASQVISVDTGLSHLAAALDRPNITLYG
FT                   PTDPGLIGGYGKNQLEIIEPTHSLDALPSLAVVEYLKNEN"
FT   CDS_pept        complement(54707..55768)
FT                   /codon_start=1
FT                   /gene_family="HOG000237541" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409536"
FT                   /locus_tag="ETAF_0055"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /protein_id="ADM40178.1"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniParc:UPI0001BD04EA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N3"
FT                   /transl_table=11
FT                   /translation="MKILVIGPSWVGDMMMSQSLYRTLKATYPEAEIDVMAPNWCRPLL
FT                   ERMPEVHQAIPMPLGHGTLGLGERYRLGRQLREREYDRAYVLPNSFKSALIPFFARIPV
FT                   RTGWKGELRYGLLNDLRQLDKSAFPLMVERYAALAYPATQIRRAADLPQPLLWPALQVR
FT                   DEEIAETAAAFNLTDHRPVIGFCPGAEFGPAKRWPHYHYAALAQRLIGQGYQIALFGSA
FT                   KDTDAGEEIRRTLDEESREYCLNLAGHTSLDQAVALIAACQAIVSNDSGLMHIAAALDK
FT                   PLVALYGPSSPDFTPPLSQHARVIRLISGYHKVRRGEGETGYHQSLIDITPDRVEQTLQ
FT                   ALLHDEKESGCVS"
FT   CDS_pept        complement(55792..56721)
FT                   /codon_start=1
FT                   /gene_family="HOG000167987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409537"
FT                   /gene_name="hldD"
FT                   /locus_tag="ETAF_0056"
FT                   /function="ADP-glyceromanno-heptose 6-epimerase activity "
FT                   /function="NADP or NADPH binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ADM40179.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008712"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001BD04EB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N4"
FT                   /transl_table=11
FT                   /translation="MIIVTGGAGMIGSNIVKALNDKGYTDILVVDNLKDGTKFVNLVDL
FT                   DITDYMDKEDFIAGIVAGDDFGDIDAVFHEGACSSTTEWDGKYVMDNNYQYSKELLHFC
FT                   LERQIPFLYASSAATYGMTDKFVEDRRYEGPLNVYGYSKFLFDQYVRRILPHAESQICG
FT                   FRYFNVYGPREGHKGGMASVAFHLNTQINNGEQPKLFEGSENFRRDFIYVGDVADVNLW
FT                   FWENGVSGIFNCGTGNAESFQAVADAVVAYHQKGSVTYIPFPDKLKGRYQAFTQADTTQ
FT                   LRAAGYSRPFKTVAQGVREYMEWLNRKP"
FT   CDS_pept        57012..58208
FT                   /codon_start=1
FT                   /gene_family="HOG000221022" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409538"
FT                   /locus_tag="ETAF_0057"
FT                   /function="glycine C-acetyltransferase activity "
FT                   /function="ligase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40180.1"
FT                   /db_xref="GO:0008890"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001BD052E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N5"
FT                   /transl_table=11
FT                   /translation="MSADFYQQLAQQLVATRAEGLYKNERIITSAQQAEIAVADGSRVL
FT                   NFCANNYLGLADHPALIAAAKAGMDSHGFGMASVRFICGTQDSHKALEQQLADFLGMED
FT                   AILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKARRYRYANNDMAELKA
FT                   RLELARAEGARHIMIATDGVFSMDGVIADLRSICDLADEYDALVMVDDSHAVGFVGAHG
FT                   RGTPEYCGVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAI
FT                   VAASSQVLTLLAQGDDLRARLWDNARLFREKMTAAGFTLAGADHAIIPVMLGEAKLAQR
FT                   FADLLLQEGIYVTGFFYPVVPQGQARIRTQMSAAHTPAQIEQAVAAFIRVGKQLGVIA"
FT   CDS_pept        58218..59243
FT                   /codon_start=1
FT                   /gene_family="HOG000294686" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409539"
FT                   /gene_name="tdh"
FT                   /locus_tag="ETAF_0058"
FT                   /function="L-threonine 3-dehydrogenase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40181.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006567"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008743"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001BD052F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N6"
FT                   /transl_table=11
FT                   /translation="MKALSKLKAEEGIWMTDVPLPALGHNDIMIKIRKTAICGTDVHIY
FT                   NWDAWSQKTIPVPMVVGHEYVGEVVAVGQEVSGFRIGDRVSGEGHITCGHCRNCRAGRT
FT                   HLCRNTIGVGVNRQGAFAEYLVIPAFNAFKIPDNIPDTLAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCRHVGARHVVITDVNDYRLDLARKMGVTRAVNVSRESLPE
FT                   VMQALGMSEGFDVGLEMSGAPPAFRTMLDTMNHGGKIAMLGIPPGDMAIDWNQVIFKGL
FT                   LIKGIYGREMFETWYKMAALIQSGLDLTPIITHQYAIDDFQKGFDAMRSGHSGKVILNW
FT                   S"
FT   CDS_pept        complement(59299..60819)
FT                   /codon_start=1
FT                   /gene_family="HOG000246698" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409540"
FT                   /locus_tag="ETAF_0059"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="magnesium chelatase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA replication"
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="ADM40182.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0016851"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001BD0530"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N7"
FT                   /transl_table=11
FT                   /translation="MTLATVYTRAALGIQAPEVRIEAHIGNGLPGFTLVGLPETAVREA
FT                   KDRVRCAMLNSGFQFPPKRITLNLAPADLPKEGGRYDLPMALALLLASEQLAPRVSVGD
FT                   YEFIGELALSGDLRSVQGTLPAALSAARAKRTLIAPSDNAAELGLLAAPRPPVAPSLLA
FT                   VCAFLSGQASLETAPAGKMTSDCAGAGDMADIIGQAQARRALEIAAAGGHNLLLIGPPG
FT                   TGKTMLACRLPGLLPPMTPDEALEQAAISSLAYPGAMPPRYGMRPFRAPHHSASMAALI
FT                   GGGPLPKPGEISLAHHGVLFLDELAEFDRRTLDALREPLESGVVHLSRARIKVSFPARV
FT                   QLVAAMNPSSGGHADGRDRRAAPQQVLRYLSRLSGPLLDRFDLSIDVPPLSPGLLARQR
FT                   ADGEDSATLRRRVCAARARQYARGGRLNAHLEGAARDRDCRLAPDDALYLEQALTRLAL
FT                   SVRAWHRLLKVARTLADLEGCDDIARRHLAEALSYRAMDRLLLSLQRG"
FT   CDS_pept        61107..62342
FT                   /codon_start=1
FT                   /gene_family="HOG000259757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409541"
FT                   /locus_tag="ETAF_0060"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40183.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001BD0531"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N8"
FT                   /transl_table=11
FT                   /translation="MLGWSAQQRNVAIASFLSWTLDSFDFFILVFLLSDIARTFHVGVE
FT                   QVTLAILLTLAVRPIGALIFGRAAEKYGRRPILMLNIICFSLFELLSAAAPSLLIFLLL
FT                   RALYGVAMGGIWGVASSLTMETIPDRSRGLMSGIFQAGYPFGYLLAAVIYGLCAQTLGW
FT                   RGMFIVGAVPIVLLPFIYFYVPESPVWLAARAQHQSVALLPVLRRHWTLCVYLVALMAA
FT                   FNFFSHGTQDLYPTFLRVQHGFSTNVISIIAVAYNIASIIGGVFFGILSERIGRKRAIM
FT                   LAALLALPVIPLWAFSSGSLMLGVGAFLMQFMVQGAWGVIPTYLNELVPANARAVLPGF
FT                   VYQLGNLIASVNATMQASIAADHGQNYALAMAITAACVALTIVALIAFGRDTRGVSMAE
FT                   KIPRQDKSIKIS"
FT   CDS_pept        62751..64355
FT                   /codon_start=1
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409542"
FT                   /locus_tag="ETAF_0061"
FT                   /function="acetolactate synthase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="ADM40184.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="UniParc:UPI0001E35538"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4N9"
FT                   /transl_table=11
FT                   /translation="MNQVFGYPGGAIMPLYDALYDGGVAHLLCRHEQGAVMAAIGYARA
FT                   SGRVGVCIATSGPGATNLITGLADAMMDSVPLVAITGQVASALIGTDAFQEMDVLGLSL
FT                   ACTKHSFMVTSLAELPEVMDRAFAIAMQGRPGPVLIDIPKDIQLAQGELATPLCSVASA
FT                   QAPCQPAALAQARAMLAQAQRPVLYVGGGVGMADAVLALRSLVSRSGMPVAATLKGLGA
FT                   ADDRHPAYLGMLGMHGCKAANLAVQQCDLLIAVGARFDDRVTGRLDAFAPQAQVIHLDI
FT                   DPAELGKLRQAHVSLCGDLNPLLSALTMPLDIAPWLQQVAALKAQHAWRYDHPGEAIYA
FT                   PLFLRQLSECKPPQAVVTTDVGQHQMWSAQHMQFSLPQDFITSSGLGTMGFGIPAAVGA
FT                   QVARPDDCVICVSGDGSFMMNVQELGTIKRARLPLKIVLLDNQRLGMVRQWQQLFFDAR
FT                   YSETDLSDNPDFLTLAQAFDIPGQRISCKAQVAGALEALFSTPGPYLLQVAIDEFENVW
FT                   PLVPPGAGNESMLENVS"
FT   CDS_pept        64352..64642
FT                   /codon_start=1
FT                   /gene_family="HOG000286146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409543"
FT                   /locus_tag="ETAF_0062"
FT                   /function="acetolactate synthase activity"
FT                   /protein_id="ADM40185.1"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="UniParc:UPI0001BD0533"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P0"
FT                   /transl_table=11
FT                   /translation="MMQSPSFQHHLAIQARRRPEILERVLRVVRHRGFEIHAMNMAQDG
FT                   DCDSVSIELTVASTRPVTLLSSQLSKLLDVARVDVSAPRSLRMLPRRQALG"
FT   CDS_pept        64695..65624
FT                   /codon_start=1
FT                   /gene_family="HOG000276706" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409544"
FT                   /locus_tag="ETAF_0063"
FT                   /function="L-isoleucine transaminase activity"
FT                   /function="L-leucine transaminase activity"
FT                   /function="L-valine transaminase activity"
FT                   /biological_process="branched chain family amino acid
FT                   metabolic process"
FT                   /protein_id="ADM40186.1"
FT                   /db_xref="GO:0009081"
FT                   /db_xref="GO:0052654"
FT                   /db_xref="GO:0052655"
FT                   /db_xref="GO:0052656"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniParc:UPI0001BD0534"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P1"
FT                   /transl_table=11
FT                   /translation="MTTKKADYIWFNGDMVPWGEARVHVMSHALHYGTSVFEGVRCYDT
FT                   HRGPAVFRHREHMQRLHDSARIYRMPLAYSVDELMAACRETLRRNQLSSAYIRPLVFIG
FT                   DVGMGVNPPAGYSTDVILAAFPWGAYLGEEALEQGIDAMVSSWHRAAPNTIPTAAKAGG
FT                   NYLSSLLVGSEARRHGYQEGIALDVHGYVSEGAGENLFMVKNGVIFTPPFTSAALPGIT
FT                   RDAIITLAQAQGLEVREQVLSREALYLADEIFMSGTAAEITPVRSVDGIQVGIGRCGPI
FT                   TKRVQQAFFGLFNGQTEDRFGWLDPVNP"
FT   CDS_pept        65726..67576
FT                   /codon_start=1
FT                   /gene_family="HOG000173155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409545"
FT                   /gene_name="ilvD"
FT                   /locus_tag="ETAF_0064"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="dihydroxy-acid dehydratase activity "
FT                   /function="metal ion binding"
FT                   /biological_process="isoleucine biosynthetic process "
FT                   /biological_process="valine biosynthetic process "
FT                   /protein_id="ADM40187.1"
FT                   /db_xref="GO:0004160"
FT                   /db_xref="GO:0009097"
FT                   /db_xref="GO:0009099"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniParc:UPI0001BD0535"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P2"
FT                   /transl_table=11
FT                   /translation="MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGRLVAAQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMMMAALRLNIPVIFVSGGPMEAGKTKLSDRLIKLD
FT                   LVDAMIQGANPQVSDAQSEQIERAACPTCGSCSGMFTANSMNCLTEALGLALPGNGSLL
FT                   ATHADRRALFEEAGRRIVALTHRYYEQDDASALPRSIAGKAAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEGEIDFTLADIDRLSRQVPHLCKVAPSTPDYHMEDVHRAGGVMGLLGELD
FT                   RAGLLNRGVVNVLGLDLNETLARYDIMRSDDEALRRLYSAGPAGLRTVEPFSQSCRWDA
FT                   LDRDRQHGCIRAREHAYSQDGGLAVLSGNLAQDGCIVKTAGVDPESLIFRGPARVFESQ
FT                   EGAVEAILGGRIQPGDVLVIRYEGPKGGPGMQEMLYPTAYLKSMGLGKQCALITDGRFS
FT                   GGTSGLSIGHVSPEAASGGAIALVRDGDPIEIDIPARHIRIAIAESELALRRQQEQARG
FT                   AQAWTPRDRRRAVSLALRAYASLATSADRGAVRDRAKLGG"
FT   CDS_pept        67579..69123
FT                   /codon_start=1
FT                   /gene_family="HOG000046975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409546"
FT                   /locus_tag="ETAF_0065"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="isoleucine biosynthetic process "
FT                   /protein_id="ADM40188.1"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0009097"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="UniParc:UPI0001BD0536"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P3"
FT                   /transl_table=11
FT                   /translation="MTSKPLISSAPDGAEYLRAVLRSPVYEVAQVTPLQAMEKLSGRLG
FT                   NHILVKREDRQPVHSFKLRGAYAMIAGLSEAQRACGVITASAGNHAQGVALSASRLGIA
FT                   ATIVMPRATAEIKVEAVRGFGGRVLLYGANFDEAKAHAIQMAQETGMTFIPPFDHPAVI
FT                   AGQGTLALELLQQDAHLDRIFVPVGGGGLAAGVAVLIKQLMPQVKVIGVEAEDSACLRA
FT                   ALDAGQPVDLPRVGLFAEGVAVKRIGDETFRLCQRYLDDVITVDSDAICAAVKDLFEDV
FT                   RAVAEPSGALALAGLKQYVQRHALRGERLAHVLSGANLNFHGLRYVSERCELGEQREAL
FT                   LAVTIPERKGSFLAFCQLLGGRSVTEFNYRYADADSACIFVGVRLTNGRGEREEIIASL
FT                   RGGGYQVVDLSDDEMAKLHVRYMVGGRPSKPLQERLYSFEFPEAPGALLKFLHTLGTHW
FT                   NISLFHYRSHGTDFGRVLAAFERPDSDASFEARLKELGYECHDETGNPAFRFFLQG"
FT   CDS_pept        complement(69127..70023)
FT                   /codon_start=1
FT                   /gene_family="HOG000269751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409547"
FT                   /gene_name="ilvY"
FT                   /locus_tag="ETAF_0066"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40189.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001BD0537"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P4"
FT                   /transl_table=11
FT                   /translation="MDIRDLKLFLHLSESRHFGRTAAAVHVSPSTLSRQIQRLEEELGQ
FT                   PLLLRDNRDVRLTAAGEQLQDFARQTLLHYRQLRGGLDSHGAALCGELHLFCSVTAAYS
FT                   HLPPILDRFRAHHPQVDIRLTTGDAADAVSKVQGGAADLAIAGRPQSLPAHVEFCPIGE
FT                   IPLRLIAPAQPCPVRRQAQSPRPDWAQIPFILPQHGPARQRIDQWFRRRRIPAPRIYAT
FT                   VAGHEAIVSMVALGCGIALLPEVVIDNSPDSVRARIVTLDNDVAIAPFELGVCVQHKRL
FT                   REPPIAAFWSLLARATP"
FT   CDS_pept        70222..71700
FT                   /codon_start=1
FT                   /gene_family="HOG000286135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409548"
FT                   /gene_name="ilvC"
FT                   /locus_tag="ETAF_0067"
FT                   /function="NADP or NADPH binding"
FT                   /function="isomerase activity"
FT                   /function="ketol-acid reductoisomerase activity "
FT                   /biological_process="isoleucine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="valine biosynthetic process "
FT                   /protein_id="ADM40190.1"
FT                   /db_xref="GO:0004455"
FT                   /db_xref="GO:0009097"
FT                   /db_xref="GO:0009099"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001BD0538"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P5"
FT                   /transl_table=11
FT                   /translation="MTNYFNTLNLRQQLAQLGKCRFMARAEFADGVNALRGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRAEAIAERRDSYRRATEHGFSVGDYQTLIPQADLVIN
FT                   LTPDKQHAAVVSAVQPLMKQGAALGYSHGFNIVEVGQQIRPDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPRGEGMAIAKAWASATGGDRAGVLVSSFVAEVKSDLMGEQ
FT                   TILCGMLQTGSLLCYERLVAEGADPAWAGKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYALAEQLKTLMAPLFAKHMDDILSGAFSQGMMADWAADDDHLLTWRAETGESAFE
FT                   KAPPFEGKIDEQTYFDRGVLLVAMVKAGVELAFETMVASGIVAESAYYESLHELPLIAN
FT                   TIARRRLYEMNVVISDTAEYGNYLFANAAVPLLRQAFMATLQPGDLGQSLPAEAVDNAA
FT                   LREVNQAIRQHPIETVGERLRGYMTDMKRVAVAG"
FT   CDS_pept        complement(71697..71978)
FT                   /codon_start=1
FT                   /gene_family="HOG000275329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409549"
FT                   /gene_name="ppiC"
FT                   /locus_tag="ETAF_0068"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ADM40191.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniParc:UPI0001BD0539"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P6"
FT                   /transl_table=11
FT                   /translation="MARRAAALHILVESQAEAESLLQKLKRGAQFQTLARRHSRCPSKR
FT                   QGGDLGEFTKGSMVPEFDRAVFSGPLLTPIGPIKTRFGYHIIKVLYRS"
FT   CDS_pept        72039..74219
FT                   /codon_start=1
FT                   /gene_family="HOG000033015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409550"
FT                   /locus_tag="ETAF_0069"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40192.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="UniParc:UPI0001BD053A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P7"
FT                   /transl_table=11
FT                   /translation="MRSPAGAMKTCVVYGGGAAQAMRRRRGFFSAVAFCYNRLPPTGVI
FT                   ISRNIVMRLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRVCGYQARHIAAV
FT                   TFTNKAAREMKERVAQTLGRKEARGLMISTFHTLGLEIIKREYKALGMKSNFSLFDDQD
FT                   QLALLTDLTERWLEKDKTQLQQLIATISNWKNDLIDPAQAAAQARSARERLFADCYGLY
FT                   DTQLKSCNVLDFDDLILLPTLLLRRDPEVRERWQQRIRYLLVDEYQDTNTSQYELVKLL
FT                   VGTRARFTVVGDDDQSIYSWRGARPQNLVLLKEDFPALQVVKLEQNYRSSQRILKAANI
FT                   LIANNPHVFEKRLFSELGYGEPLKVITANNEDHEAERVVGELIAHHFIHKTAYSDYAIL
FT                   YRGNHQSRVFEKMLMQNRIPYKISGGTSFFSRAEIKDLLSYLRVLTNPDDDSAFLRIVN
FT                   TPRREIGPSTLQKLGAWANQRGISLFRASFDVGLEQTLSGRGLASLQHFTRWMDELSQL
FT                   CERDATAAVRDLIHGIDYESWLFETSASPRAAEMRMKNVNQLFGWMTDMLQGSDLDEPM
FT                   TLTQVVNRFTLRDMMERGESEEEADQVQLMTLHASKGLEFPYVYLVGMEEGLLPHQSSI
FT                   DEDNVDEERRLAYVGITRAQKELVFTLCRERRQYGELMRPEPSRFLLELPQDDLSWESA
FT                   RKVVSPQERMQRGQSHLANLKAQLARAKSAQD"
FT   CDS_pept        complement(74290..75792)
FT                   /codon_start=1
FT                   /gene_family="HOG000258672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409551"
FT                   /locus_tag="ETAF_0070"
FT                   /function="guanosine-5'-triphosphate,3'-diphosphate
FT                   diphosphatase activity"
FT                   /protein_id="ADM40193.1"
FT                   /db_xref="GO:0008894"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniParc:UPI0001BD053B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P8"
FT                   /transl_table=11
FT                   /translation="MSKSAALYAAIDLGSNSFHMLVVREMAGGIQTLARIKRKVRLAAG
FT                   LDADNILSPDAMQRGWQCLHLFAERLQDIPTDHIRVVATATLRIARNADAFIARAQEIL
FT                   GRPVRIISGEEEARLIYQGVAHTTGGARRRLVVDIGGGSTELACGEGAKADVLFSLQMG
FT                   CVTWLERYFSDRHLTQANFARAGDAAHAMIAPVRDTLLRHGWQACVGASGTVQALQEIM
FT                   VAQGMDERITLDKLCQLRDRAIECGKLEELEIDGLTLERALVFPSGLAILIALFEALHI
FT                   DSMTLSGGALREGLVYGMLALPVGCDVRTRTLHNIQRRFLIDEGQAERVWRLADGLARQ
FT                   LSTPWPLDSCAHTLLHAACLLHELGLSVDVRQAPQHAAYLVRHLDLPGFTPAQKKLLAT
FT                   LLANQSGPLNLALFGQQNAVPLRTAQRLCRLLRLAIIFASQRHDGALPPLLTQVCEEDA
FT                   LRLILPVDWLADHPLRAESLQQESLWQGYAHWPLQIVDATSA"
FT   CDS_pept        complement(75798..77072)
FT                   /codon_start=1
FT                   /gene_family="HOG000268807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409552"
FT                   /gene_name="rhlB"
FT                   /locus_tag="ETAF_0071"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ADM40194.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001BD053C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4P9"
FT                   /transl_table=11
FT                   /translation="MTEQKFADFALHPMVIKALESKGFHSCTPIQALALPLAIAGRDVA
FT                   GQAQTGTGKTLAFLASTFHYLLTHPAIAERKTNQPRALIMAPTRELAVQIHSDAEPLAQ
FT                   ETGLRLGLAYGGDGYDKQLRVLEQGVDILIGTTGRLIDYAKQGHVDLGAIQVVVLDEAD
FT                   RMFDLGFIKDIRWLFRRMPPTAQRLNMLFSATLSYRVRELAFEHMNNAEYVEVEPEQKT
FT                   GHRIQEELFYPSNEEKMRLLQTLLEEEWPDRCIIFANTKHRCEDIWGHLAADGHRVGLL
FT                   TGDVPQKKRLRILEDFTKGHIDILVATDVAARGLHIPAVTHVFNYDLPDDCEDYVHRIG
FT                   RTGRAGASGKSISLACEEYVLNLPAIESYIGHSIPVSKYNSDALLKDLPAPKRLSRSRN
FT                   GAGARRPGSPRRGSGAPRPNRKRSG"
FT   CDS_pept        77233..77559
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409553"
FT                   /locus_tag="ETAF_0072"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="ADM40195.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI0001A5A16B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4Q0"
FT                   /transl_table=11
FT                   /translation="MSDKIVHLSDSGFEADVLKAEGPILVDFWAEWCGPCKMIAPILDE
FT                   IAAEYAGKLTIAKLNIDENPATAPKYGIRGIPTLLLFKNGAVAATKVGALSKTQLKEFL
FT                   DANL"
FT   CDS_pept        77993..79252
FT                   /codon_start=1
FT                   /gene_family="HOG000076952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409554"
FT                   /locus_tag="ETAF_0073"
FT                   /function="ATP binding"
FT                   /function="RNA binding"
FT                   /function="hydrolase activity, acting on acid anhydrides,
FT                   catalyzing transmembrane movement of substances "
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="transcription termination factor activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, catalytic domain"
FT                   /protein_id="ADM40196.1"
FT                   /db_xref="GO:0003715"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016820"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0033178"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0001A5A16C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4Q1"
FT                   /transl_table=11
FT                   /translation="MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTPEELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNDEFFDMMKRS"
FT   CDS_pept        79529..80617
FT                   /codon_start=1
FT                   /gene_family="HOG000275125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409555"
FT                   /locus_tag="ETAF_0074"
FT                   /function="magnesium ion binding"
FT                   /function="manganese ion binding"
FT                   /function="phospho-N-acetylmuramoyl-pentapeptide-
FT                   transferase activity"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40197.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0008963"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniParc:UPI0001BD053D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4Q2"
FT                   /transl_table=11
FT                   /translation="MNLLTLSSKFFLIFIFSMAFLLVARRVAKKIGLVDKPNYRKRHQG
FT                   LIPLVGGISVYAGICFTFLFFKPYIPHATLYLICAGILVLVGALDDRFDISVKFRATVQ
FT                   ALIAIAMMVAGGLYLRSLGFVLGPWEMILGPFGYLVTLFAVWAAINAFNMVDGIDGLLG
FT                   GLSCVTFAAMGILLQWDGQPDLALWCFAIIAATLPYILLNLGVVGPRFKVFMGDAGSTL
FT                   IGFTVIWILLESTQGRGHPMNPVTALWVIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIH
FT                   HLIMRAGFTSRQAFVLITLAAALLAAIGVLGEIWLPEYVMMALFLLAFALYGYCIKRAW
FT                   RVARMVKRFKRRLRRKSAGMHV"
FT   CDS_pept        80648..81685
FT                   /codon_start=1
FT                   /gene_family="HOG000126437" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409556"
FT                   /locus_tag="ETAF_0075"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40198.1"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniParc:UPI0001BD053E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4Q3"
FT                   /transl_table=11
FT                   /translation="MVSQNPMPVENELDVRGLCRALWRGKPWIVGTAALFAALALGVSL
FT                   LMPQKWSAAAITASPGVNSLGGYYSQQQFLRNLAQLSAPSGAVAQGSIADEAYAEFTTQ
FT                   LASYDTRREFWLHSPYYQSHKEGSAQADAALLDELINQIVFTPGDAAKHSDDSIRLTAD
FT                   GAAQANQLLRQYVAFATHRASANLNESLQGAWAARSIFLKAQVKRQEAVAQAIYQRELN
FT                   GLEQGLKIAAQQGITRSMATTAQVEVPDAELFMLGQPMLRARLEALRAVGPSYDIDYDR
FT                   NRAMLTTLSVGPVLDAAFQPYRYLRTPEEPVKRDSPRRLFMMVMWGAIGALVGAGIALS
FT                   RRARI"
FT   CDS_pept        81769..82899
FT                   /codon_start=1
FT                   /gene_family="HOG000076048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409557"
FT                   /locus_tag="ETAF_0076"
FT                   /function="UDP-N-acetylglucosamine 2-epimerase activity "
FT                   /biological_process="UDP-N-acetylglucosamine metabolic
FT                   process"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /protein_id="ADM40199.1"
FT                   /db_xref="GO:0006047"
FT                   /db_xref="GO:0008761"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="UniParc:UPI0001BD053F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4Q4"
FT                   /transl_table=11
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALAADAAFDARVCVTAQHREMLDQ
FT                   VLGLFQIVPDYDLNIMRPGQDLSDITCRILEGLKPVLAEFRPDVVLVHGDTTTTLAASL
FT                   AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLASLHFAPTLTARANLLREGIRE
FT                   QTIHLTGNSVVDALLWVRDRICADAALQTRLAASYPFLAADKPLLLVTGHRRESFGGGF
FT                   ERICGALAQIARSHPQVQVVYPVHLNPNVSEPVNRILRDIENVFLIPPQDYLPFVYLMG
FT                   RAQLILTDSGGIQEEAPSLGKPVLVMRETTERPEAVQAGTVRLVGTDTATIVSQVSQLL
FT                   EDEQQYRAMSHATNPYGDGQACQRILSALKNYRATL"
FT   CDS_pept        82896..84158
FT                   /codon_start=1
FT                   /gene_family="HOG000153774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409558"
FT                   /locus_tag="ETAF_0077"
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40200.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR014028"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="UniParc:UPI0001BD0540"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4Q5"
FT                   /transl_table=11
FT                   /translation="MSFDTISVIGLGYIGLPTAVAFAGCRKQVIGVDVSQHAVETINRG
FT                   EIHIVEPDLDRAVKRAVEGGFLRAVMRPEPADAFLIAVPTPFKGDHEPDLTYVEAAARS
FT                   IAPVLKKGDLVILESTSPVGATEQMCAWLAECRTDLRFPHQDGEQADIRVAYCPERVLP
FT                   GKIMVELLRNDRVIGGMTPTCSAQACALYKLFLEGECVETNARTAEMCKLTENSFRDVN
FT                   IAFANELSLICDAQGIDVWQLIALANRHPRVNILQPGPGVGGHCIAVDPWFIVAQNPQL
FT                   ARLIHTARLVNDGKPLWVVDRVKAALADCLAAEDKRASEATIACFGLAFKPDIDDLRES
FT                   PAMEIAEMVAQWHSGTTLVVEPNIHQLPARLAGMAQLTDCATALAQADVVVLLVDHQPF
FT                   RALAPQAVTQRFVVDTKGVWR"
FT   CDS_pept        84149..85219
FT                   /codon_start=1
FT                   /gene_family="HOG000168006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409559"
FT                   /locus_tag="ETAF_0078"
FT                   /function="coenzyme binding"
FT                   /function="dTDP-glucose 4,6-dehydratase activity "
FT                   /biological_process="nucleotide-sugar metabolic process "
FT                   /protein_id="ADM40201.1"
FT                   /db_xref="GO:0008460"
FT                   /db_xref="GO:0009225"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001BD0541"
FT                   /db_xref="UniProtKB/TrEMBL:E0T4Q6"
FT                   /transl_table=11
FT                   /translation="MAVRRILVTGGAGFIGSAVVRHIIMDTADSVVVVDKLTYAGNLAS
FT                   LAPAAGSDRYAFERADIGDRAAMDRILAQYRPDAIMHLAAESHVDRSIDGPADFIQTNI
FT                   VGTYTLLEATRRYWSALPAAPRAAFRFHHISTDEVYGDLHGPQALFREDTPYAPSSPYS
FT                   ASKAASDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLTIINALAAKPLPVYGNG
FT                   LQVRDWLYVEDHARALYRVLMTGRVGETYNIGGHNERRNIDVVTTLCALLQEMVPEKPA
FT                   GVRHFADLITYVADRPGHDVRYAIDASKIERELGWRPQETFESGIRKTVAWYLANERWW
FT                   RAVMDGSYAGERLGLA"
FT   CDS_pept        85252..86133
FT                   /codon_start=1
FT                   /gene_family="HOG000283473" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409560"
FT                   /locus_tag="ETAF_0079"
FT                   /function="glucose-1-phosphate thymidylyltransferase
FT                   activity"
FT                   /biological_process="extracellular polysaccharide
FT                   biosynthetic process"
FT                   /protein_id="ADM40202.1"
FT                   /db_xref="GO:0008879"
FT                   /db_xref="GO:0045226"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="UniParc:UPI0001BD0542"
FT                   /db_xref="UniProtKB/TrEMBL:E0T554"
FT                   /transl_table=11
FT                   /translation="MKGIILAGGSGTRLYPITRGVSKQLLPIYDKPMIYYPLSVLMLAG
FT                   IRDILLISTPQDLPAFQRLLGDGSDIGVRLQYAEQPRPEGLAQAFLIGESFLDGDSCCL
FT                   VLGDNIFFGQGFSPKLRQVAQRERGATVFGYQVMDPERFGVVEFDDDFRALSIEEKPQR
FT                   PRSNWAVTGLYFYDAQVVDFARRVTPSVRGELEITSINQMYLQRGELNVELLGRGFAWL
FT                   DTGTHDSLLEASAFVQTVEKRQGFKIACLEEIAWRNGWLDDHGVARAAASLGKTAYGAY
FT                   LRELLHVRPRQY"
FT   CDS_pept        86111..86806
FT                   /codon_start=1
FT                   /gene_family="HOG000126448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409561"
FT                   /gene_name="rffC"
FT                   /locus_tag="ETAF_0080"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ADM40203.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001BD0543"
FT                   /db_xref="UniProtKB/TrEMBL:E0T555"
FT                   /transl_table=11
FT                   /translation="MSVHASIEPLAWESAFFALRSGRLRFDDRAPPLQASACDAYQLLQ
FT                   AKVDARDLARCDALQALGFRLAEGEADFVLPVSSAPTFGGQRQAQAQDCLWLRALARNA
FT                   FALSRFRAPWYRAEDSARFYAEWVEKAVYGTFDHACLLALDDEGTPQGFVTLRRQVDGS
FT                   ARIGLLAVDNASFRCGVGRRLVAQAQAWCHAQSLSRLYVATQIGNLAAQRLYLGCGAQL
FT                   AATAYWLYR"
FT   CDS_pept        86832..87962
FT                   /codon_start=1
FT                   /gene_family="HOG000230162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409562"
FT                   /gene_name="rffA"
FT                   /locus_tag="ETAF_0081"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ADM40204.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001BD0544"
FT                   /db_xref="UniProtKB/TrEMBL:E0T556"
FT                   /transl_table=11
FT                   /translation="MIPFNAPPVTGSESDYMQAAMASGKLCGDGGFTRRCQQWMEQRFG
FT                   SAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSFTFVSTANAFVLRGARIVFVDVRPDT
FT                   MNIDETRIEAAITEKTRAIVPVHYAGVACEMDTIMALAQQYGLYVVEDAAQGVMATYKG
FT                   RALGTIGHIGCYSFHETKNYTAGGEGGATLINDAALIERAEIIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWAQLEVADRINQRRLQLWQQYHDALAPLAEAGRLTLPT
FT                   TPAHCGHNAHMFYLKLRDMRERSAFIDFLKEAEIMAVFHYIPLHCSPAGARFGRFVGED
FT                   RYTTCESERLVRLPLFYNLPDVNQRTVINSIQSFFR"
FT   CDS_pept        87962..89212
FT                   /codon_start=1
FT                   /gene_family="HOG000126459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409563"
FT                   /gene_name="wzxE"
FT                   /locus_tag="ETAF_0082"
FT                   /biological_process="polysaccharide biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40205.1"
FT                   /db_xref="GO:0000271"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniParc:UPI0001BD0545"
FT                   /db_xref="UniProtKB/TrEMBL:E0T557"
FT                   /transl_table=11
FT                   /translation="MSLARASLWTAGSTLIKIGAGLVVVKLLAVAFGPVGVGQAANFRQ
FT                   VITVLGVLSGAGIFNGITKYVAEYRQQPQRLRALLGTASTMILGFSLLLALIFTLGAAP
FT                   ISVALFGHDRYQAVIRLVALLQMGIACANYCLAVIKGYRDARGNALAVSLGSLLGVAAY
FT                   TLSYFLGGYRGALAGLALVPAAATLPALWVLWRQRHIPWRYVRPSWDRPLAASLGKFTL
FT                   MAVMTAVTMPVAYVMMRNQLAALDGWEAVGIWQGVSGISDAYLQFITASFSVYLLPTLA
FT                   GLHSRQAVGQEILRALRFVLPAVAAVSFTVWLLRDLVIWLLLSGKFSAMRDLFAWQLTG
FT                   DVFKVGAYVFGYLVIAKASLRFYLLCEISQFILLTLLSRILIPLHGALGAAQAYMATYI
FT                   IYFLLCGSVFWIYRNRA"
FT   CDS_pept        89209..90285
FT                   /codon_start=1
FT                   /gene_family="HOG000249654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409564"
FT                   /locus_tag="ETAF_0083"
FT                   /function="fucosyltransferase activity"
FT                   /biological_process="enterobacterial common antigen
FT                   biosynthetic process"
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40206.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008417"
FT                   /db_xref="GO:0009246"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniParc:UPI0001BD0546"
FT                   /db_xref="UniProtKB/TrEMBL:E0T558"
FT                   /transl_table=11
FT                   /translation="MTTLIHVLGADIPHHNLTLLRFFDGMLSQRAATAPRRRFMVVARD
FT                   AAPFADLTTLDIEVWPDKRALARALLARASADRALRFFLHGQFNPWLWLALLCGRLRPQ
FT                   QVLWHVWGADLYEEARGWKYRLYYGLRRRAQGRVGHVFATLGDLDYYRRRHPRVATSTL
FT                   YFPTRMDPALTCNQRARVTSGALTVLVGNSGDRSNRHLVALQRLHDTFGAQTRVIVPLG
FT                   YPANNQAYIAQVRERAEGLFGHNATLLTQQVAFTDYLALLARCDLGYFIFERQQGIGTL
FT                   CLLLQQGIPLVLSRQNPFWRDMVDQQLPVLFDDDAPDDAAVRAAQRQLAQRDLSRLAFF
FT                   DPNYTDGWLQALALGERP"
FT   CDS_pept        90282..91670
FT                   /codon_start=1
FT                   /gene_family="HOG000219137" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409565"
FT                   /locus_tag="ETAF_0084"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40207.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniParc:UPI0001BD0547"
FT                   /db_xref="UniProtKB/TrEMBL:E0T559"
FT                   /transl_table=11
FT                   /translation="MTLMQFAGLALVYFFSLLFVAFLTYKEFRRVRFNFNVFFSLLFLL
FT                   TFYFGFPLTCTLVFRFDVATVPAEEMLYALLSATAFYAIYYVTYKTRLRSATSASSGGS
FT                   AWLQLNRVEAQLTWILLALVALVTVTIFFLNNGFLLFKLHSYSQIFSSGVSGVALKRFF
FT                   YFFIPAMLVVYFLRQTQAAWLFFLVSTVVFGLLTYVIVGGTRANIIIAFALFLFIGIQR
FT                   GWITLWMLALAGVVGVVGMFWLALKRYGLAVSGDEAFYTFLYLTRDTFSPWENLALLLQ
FT                   HYTQIDFQGLAPIARDFYVFIPGWMWPDRPHLVLNSANYFTWQVLDNHSGLAISPTLIG
FT                   SLVVMGGAAFIPLGAIAVGLIIKWFDWLYTRGCAASNRYRGAVIQAFCFGAVFNMIVLA
FT                   REGLDAFVSRVVFFCIIFGCCLLLAKLLYWLFDAAGLIRARAAIAAPSVGKGSPARKDR
FT                   NDGE"
FT   CDS_pept        91660..92400
FT                   /codon_start=1
FT                   /gene_family="HOG000075380" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409566"
FT                   /locus_tag="ETAF_0085"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40208.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniParc:UPI0001BD0548"
FT                   /db_xref="UniProtKB/TrEMBL:E0T560"
FT                   /transl_table=11
FT                   /translation="MESNGSIPHYAIRGIDIWGFRDSDQFLRHLLTETAVRPGTLVAIN
FT                   AEKVMTAEDDAALRALIAAAEYKYADGISIVRAIRRKYPGAQVSRIAGADLWEALMQRA
FT                   GELGIPVFLVGGQPDVLAQTEAALRRRWGVNVVGAQDGYFSPEQRNALFERIHASGAQI
FT                   VTVAMGSPRQEILMRDCRAYYPQALYMGVGGTYDVFTGRVRRAPHLWRRFGLEWLYRLL
FT                   SQPTRWRRQVKLLRFVAYYYARKL"
FT   CDS_pept        complement(92382..92534)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409567"
FT                   /locus_tag="ETAF_0086"
FT                   /protein_id="ADM40209.1"
FT                   /db_xref="UniParc:UPI0001BD0549"
FT                   /db_xref="UniProtKB/TrEMBL:E0T561"
FT                   /transl_table=11
FT                   /translation="MLSSAFLQKYRVWLHFAHSAVKAHAAEPKPTVRSRRHGLREATAR
FT                   YSFLA"
FT   tRNA            92575..92651
FT                   /gene_name="tRNA-Arg"
FT   tRNA            92710..92785
FT                   /gene_name="tRNA-His"
FT   tRNA            92800..92886
FT                   /gene_name="tRNA-Leu"
FT   tRNA            92911..92987
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        complement(93594..94793)
FT                   /codon_start=1
FT                   /gene_family="HOG000270888" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409568"
FT                   /locus_tag="ETAF_0087"
FT                   /function="binding"
FT                   /biological_process="heme metabolic process"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40210.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0042168"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001BD054B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T562"
FT                   /transl_table=11
FT                   /translation="MLKVLLLFIILIAGIVLGPMLAGHQGYVLIQTDSYNIETSVTSLV
FT                   IMLILLMLVLFALEWLLRRLLRTGARTRGWFMGRKRTRARRQTRAGLLKLTEGDYGQVE
FT                   KLLARNADHADQPLVNYLLAAEAAQQRGDELRANQYLERAAEVAGSDPLPVDITRVRLQ
FT                   LARGENHAARHGVDALLNYAPRHPEVLRLAEQAYLRTDAFGPLLEILPTLAKQGLHSDD
FT                   DIEKLQIRAYIGLMDQAMANGGSEGLKQWWKAQARKTRHETALQVALAEHLIECDDHGA
FT                   AQQIVVDGLKRRFDERLVQLMPRLKSGNPEQLEKLLQQQIRQHGASALLNSTLGQLLMR
FT                   HGEWQQAAEALRAALKQRPDAYDYAWLADTLDKLHRPEEAAQMRRDGLLLTLHQDQPTT
FT                   "
FT   CDS_pept        complement(94796..95944)
FT                   /codon_start=1
FT                   /gene_family="HOG000270899" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409569"
FT                   /locus_tag="ETAF_0088"
FT                   /protein_id="ADM40211.1"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniParc:UPI0001BD054C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T563"
FT                   /transl_table=11
FT                   /translation="MTEPTTPPDKAAAAETTTEQAQPLERAHKQDKQIVKKSAAGGPAL
FT                   GAIAIVLVIALGAGLYYHGHQQAQRQQASEQSLQEQLSALHTAQAQEKLRMEALLNKQA
FT                   KALDVATQLQASQSQQLKELEQKVAAISGNDANTWKLAQADFMVKLAERKLWSDQDVTT
FT                   AIALLKSADATLAGLDDPSLLGVRRALTEDISTLSTLNQIDFDGIILQLNQLANQVDDL
FT                   RLADNDSDEAPMDQDDGELSASLSQWRQNLAKSWHSFISEFITIRRRDSSAEPLLAPSQ
FT                   DVYLRENIRSRLLIAAQAVPRHQNQIYQQSLESVSAWVRAYFDVNDPSTKAFLNQIDAL
FT                   SQQSVSMILPDALKSQPLLDKLLHARSNALTAAPAAPATQGE"
FT   CDS_pept        complement(95963..96709)
FT                   /codon_start=1
FT                   /gene_family="HOG000247993" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409570"
FT                   /locus_tag="ETAF_0089"
FT                   /function="uroporphyrinogen-III synthase activity "
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="ADM40212.1"
FT                   /db_xref="GO:0004852"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="UniParc:UPI0001BD0599"
FT                   /db_xref="UniProtKB/TrEMBL:E0T564"
FT                   /transl_table=11
FT                   /translation="MSILVTRPSPAGEQLVERLRALGMEAWHTPLIDVAPGRQLALLPE
FT                   AVAALQRGDLLLAVSRHAVLYAAEALRLAGRGWPTTPRYAAIGHSTAQSLGAACHQSVI
FT                   FPPAPETSEALLALPAIRQLRARRALILRGNGGRDLIADALRARGVSVTLCECYRRVAI
FT                   AYPGDELCARWRQQKVSTLVVTSGEMLQQLYDLVPEYDRQRWLLSCRLIVVSERLAQRA
FT                   RDLGWQEIRVAESANNDALLRTLQIN"
FT   CDS_pept        complement(96716..97669)
FT                   /codon_start=1
FT                   /gene_family="HOG000228588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409571"
FT                   /gene_name="hemC"
FT                   /locus_tag="ETAF_0090"
FT                   /function="hydroxymethylbilane synthase activity "
FT                   /biological_process="peptidyl-pyrromethane cofactor linkage"
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="ADM40213.1"
FT                   /db_xref="GO:0004418"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0018160"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="UniParc:UPI0001BD059A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T565"
FT                   /transl_table=11
FT                   /translation="MQSMTTATQPTLRIATRQSPLALWQAHYVRDQLLTHWPQLTIELV
FT                   PMVTRGDVLLDTPLAKVGGKGLFVKELELALLEGRADIAVHSMKDVPVAFPDGLGLVTI
FT                   CQREDPRDAFVSPRFASLEQLPPGSVVGTSSLRRQCQLRAARPDLQIRDLRGNVGTRLA
FT                   KLDAGDYDAIILAAAGLKRLQLDDRIRTPLTPEQSLPAVGQGAVGIECRLADDATRRLL
FT                   APLNHADTALRVCAERAMNTRLEGGCQVPIGSYAEIDGDQLWLRALVGAPDGSRIIRGE
FT                   RRGPLTQAEAMGTALADELLARGARTILDAVYCQKA"
FT   CDS_pept        97972..100527
FT                   /codon_start=1
FT                   /gene_family="HOG000270910" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409572"
FT                   /locus_tag="ETAF_0091"
FT                   /function="adenylate cyclase activity"
FT                   /protein_id="ADM40214.1"
FT                   /db_xref="GO:0004016"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="UniParc:UPI0001BD059B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T566"
FT                   /transl_table=11
FT                   /translation="MYLYIETLKQRLDAINQLRVDRALSAMGPAFQQVYTLLPTLLHFH
FT                   HPLMPGYLEGNVPHGICFFTPDEPQQNYLLHLEQRAPGSIPPVTGSDQMPITGLYTMGS
FT                   TSSIGQSCSSDLDIWVCHHSWLDASERSQLQQKCTLLEEWAASLGVEVSFFLIDENRFR
FT                   HNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWSMVPGEEEEHYDEYVLSLYAQ
FT                   GALTPNEWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNTEL
FT                   LAMDIKQRLHKGEIVSFGLDPYCMMLDRVTHYLEQIGDHARLDLARRCFYLKVCEKMSR
FT                   ARACVGWRREILSQLVAHWGWDEALIRSLDNRANWKIGQVREAHNELLDAMMQSYRNLI
FT                   RFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSERDLTFIYVPVG
FT                   RANRSGWYLYNQAPTIDSIVSHQPLEYNRYLNKLVAWAYFNGLLTEETRLHIKANSSQC
FT                   DLNKLRELVRDVSNHFPLRLSAPTPKALYSPCEIRHLAIIVNLEHDPTATFSNQVVHFD
FT                   FRQLDVFSFGEQQQCLVGSVDLLYRNSWNEVRTLHFSGEQAVLEALKTILGKMHQDAAP
FT                   PEAVEVFCYSRHLRGLIRTRLQQLVSECIDLRLSSSRQEPGRFKAVRVAGQTWGLFFER
FT                   LSVSVQKLENAVEFYGAISNNKLHGLSMQVETDQAHLPAVVDGYASEGIIQFFFEDGER
FT                   DGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQI
FT                   VTVEGRAQVIPFRSKAVTPPGAETEGDGDAAPRQQFKVY"
FT   CDS_pept        complement(100535..100858)
FT                   /codon_start=1
FT                   /gene_family="HOG000190728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409573"
FT                   /gene_name="cyaY"
FT                   /locus_tag="ETAF_0092"
FT                   /protein_id="ADM40215.1"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="UniParc:UPI0001BD059C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T567"
FT                   /transl_table=11
FT                   /translation="MNDSEFHLLADGLMQALEEALDACQSDADIDCETNGGVMTLSFEN
FT                   GSKIVINRQEPLHQIWLATRAGGYHFDYRDGQWRCSRSGAPLHQVLNEACSAQAGVPVT
FT                   LDR"
FT   CDS_pept        100936..101163
FT                   /codon_start=1
FT                   /gene_family="HOG000219138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409574"
FT                   /locus_tag="ETAF_0093"
FT                   /protein_id="ADM40216.1"
FT                   /db_xref="UniParc:UPI0001BD059D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T568"
FT                   /transl_table=11
FT                   /translation="MNRQFRSALLVLCAATLGGCGLKGPLYFPPAQQAPAAQKAPDAYS
FT                   VQAPSHEPVAQTPNTQTPNTAPAAEAGKAH"
FT   CDS_pept        101221..102045
FT                   /codon_start=1
FT                   /gene_family="HOG000220466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409575"
FT                   /gene_name="dapF"
FT                   /locus_tag="ETAF_0094"
FT                   /function="diaminopimelate epimerase activity"
FT                   /biological_process="lysine biosynthetic process via
FT                   diaminopimelate"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40217.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008837"
FT                   /db_xref="GO:0009089"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniParc:UPI0001BD059E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T569"
FT                   /transl_table=11
FT                   /translation="MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQL
FT                   LVVEPPYDPDLDFHYRIFNADGSEVAQCGNGARCFARFVRIKGLTNRRDIRVSTQNGRM
FT                   TLHVGEDDRVTVNMGEPQFEPGRIPFKAAKAEKTYILRVAQQTVLCGAVSMGNPHCVLQ
FT                   VEDVSRAQVELLGPVLESHERFPERVNVGFMQVVERDHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGIQQGLLDEQVQVDLPGGTLHIRWPGPGTPLLMTGPAAHVYDGFIHL"
FT   CDS_pept        102059..102763
FT                   /codon_start=1
FT                   /gene_family="HOG000265997" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409576"
FT                   /locus_tag="ETAF_0095"
FT                   /protein_id="ADM40218.1"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="UniParc:UPI0001BD059F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T570"
FT                   /transl_table=11
FT                   /translation="MSERDSRDLLQPSLADEQVVAYLQQHPDFFIRNARQVEQMMIPHP
FT                   VRGAVSLLEWQLGRQRRQIAALDQEIEQLITLARDNERLFGSLLALQSHLASAQDMDDF
FT                   LQRLQRWARSLGLSGAYIRLFADRWRLGAPSRFSHLAIARSDVELLRIQRLGDANHYLG
FT                   SLNGQELLLLLPQARHVGSVALSLMGDFADLGLLVFTSADAQHYQQGMGTALLEQLARL
FT                   IPPMLTRWIERQ"
FT   CDS_pept        102760..103671
FT                   /codon_start=1
FT                   /gene_family="HOG000045294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409577"
FT                   /gene_name="xerC"
FT                   /locus_tag="ETAF_0096"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40219.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniParc:UPI0001BD05A0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T571"
FT                   /transl_table=11
FT                   /translation="MTSLPEALSTPVAAFLQMMRVERQLSPRTVETYRRQLAASAALLL
FT                   EGGLCDWAALDTTRVRSLVARSRRQGLEPASLALRLSALRSFLDWQVSRGALTANPAKG
FT                   VAAPRQGRHLPKNLDVDDVNRLLDIDEGDTLAVRDRAMLEVMYGGGLRLSELVGLDCRH
FT                   VDLTTGEVWVLGKGSKERRLPVGREAVRWLQTWLSLRLSLQPQDDALFVSRLGGRISPR
FT                   SVQKRFAEWGVKQGVTSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLSTTQIYTH
FT                   LDFQHLATVYDAAHPRAKRGKT"
FT   CDS_pept        103671..104387
FT                   /codon_start=1
FT                   /gene_family="HOG000248345" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409578"
FT                   /locus_tag="ETAF_0097"
FT                   /function="(S)-2-haloacid dehalogenase activity "
FT                   /function="phosphoglycolate phosphatase activity "
FT                   /protein_id="ADM40220.1"
FT                   /db_xref="GO:0008967"
FT                   /db_xref="GO:0018784"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001BD05A1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T572"
FT                   /transl_table=11
FT                   /translation="MHFYRPLQRPAALTFDLDDTLYDNHPVIVRSEQAALDFLRRRFPA
FT                   LQDFQSADWQRLRAELRASDPEIYHDVTQWRWRTVYEALWRAGLSPTYCHDGADEAMAH
FT                   FAQWRSRITVSTETHQILAALAARLPLAAITNGNADPARCGLGAYFRFVLRAGPDGRAK
FT                   PYSDMYLAAARHFNLAPGQILHVGDDLTTDVAGAVRSGMQACWVNDRGRSLLCAADGRL
FT                   LPHVEISRLDSLLALI"
FT   CDS_pept        104464..106623
FT                   /codon_start=1
FT                   /gene_family="HOG000033016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409579"
FT                   /locus_tag="ETAF_0098"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40221.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="UniParc:UPI0001BD05A2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T573"
FT                   /transl_table=11
FT                   /translation="MDVSDLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAW
FT                   LLAVENCSPFSIMAVTFTNKAAAEMRHRIEALIGTSQGGMWIGTFHGLAHRLLRAHHLD
FT                   AGLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPARQGMWYINGKKDDGLRPQHIESYG
FT                   NPVEQTWLRIYQAYQEACDRAGLVDFAELLLRAHELWLHKPQILEHYRARFNNILVDEF
FT                   QDTNRIQYAWIRMLAGDSGRVMIVGDDDQSIYGWRGAQVENIQKFLDDFPGAQTIRLEQ
FT                   NYRSSGNILRAANALIENNDGRLGKKLWTEDGEGEPISLYCAFNELDEARFVVNRIKAW
FT                   QDNGGALKECAILYRSNAQSRVLEEALLQAATPYRIYGGMRFFERQEIKDALAYLRLLS
FT                   NRNDDAAFERVVNTPVRGIGDRTLDVVRQTARDRQLTLWQATRALLQEQVFPGRAANAL
FT                   RRFLELIEALAQDSDDLPLHVQTDRVIRDSGLRQMYEQEKGEKGQTRIENLEELVTATR
FT                   QFSYEDDDDLSPLQAFLSHAALESGEGQADAYQDAVQLMTLHSAKGLEFPQVFIVGMEE
FT                   GMFPSQMSLDEGGRLEEERRLAYVGVTRAMRKLTLTYAESRRLYGKEVYHRPSRFVGEL
FT                   PETCVEEVRLRASVTRPVSHARMGTPLSQSDSGYRLGQRVAHAKFGEGTIINLEGSGEH
FT                   TRLQIAFKGEGIKWLVAAYARLEVL"
FT   CDS_pept        106969..107877
FT                   /codon_start=1
FT                   /gene_family="HOG000276873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409580"
FT                   /gene_name="corA"
FT                   /locus_tag="ETAF_0099"
FT                   /function="cobalt ion transmembrane transporter activity "
FT                   /function="magnesium ion transmembrane transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40222.1"
FT                   /db_xref="GO:0015087"
FT                   /db_xref="GO:0015095"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniParc:UPI0001BD05A3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T574"
FT                   /transl_table=11
FT                   /translation="MELDDTDHLTASLWVDLVEPEEDERRRVQSELGQSLATRPELDDI
FT                   EASARFFEDEDGLHIHSFFYYEDAEDHAGNSTVAFTIREGRLFTLRERELPAFRLYRMR
FT                   ARNQMLVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSRVIMEGQQGDEYDDALST
FT                   LAELEDIGWKVRLCLMDTQRALNFLVRKARLPASQLEQAREVLRDIESLLPHNESLFQK
FT                   VNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGA
FT                   ILLMILAGLAPYLYFKRKKWL"
FT   CDS_pept        107988..109043
FT                   /codon_start=1
FT                   /gene_family="HOG000076013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409581"
FT                   /locus_tag="ETAF_0100"
FT                   /function="monooxygenase activity"
FT                   /protein_id="ADM40223.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniParc:UPI0001BD05A4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T575"
FT                   /transl_table=11
FT                   /translation="MERLAHAEQWSILAVLSLGLGGLFLWLRLPAALLLGPMLAAVALG
FT                   LRGATIRVHRLAMPIAQAILGCMIARALSLSLLSPLLDDWPVVLLVLLCTQLCSAITGW
FT                   LLVRLSDLPGPTGAWGSSPGGASAMVAMAGEFGADVRLVAFMQYLRVLFVAAAAALVVR
FT                   VGLGDAPQGVPLAPPWFPALGWAFVATLLLAGGGAWLGRRLRIPAGALLLPMLIGALCN
FT                   TTGVMTPQTPEWLLAIAYALIGWQVGLLFTRTLFVLALRALPQIILSIAALMLCCALMA
FT                   WGLTQVLPIDPLSAYLATSPGGLDTIAIIAAGSQVNLAFVMALQMLRLFTILLMGPAVA
FT                   RWISRHAASAP"
FT   CDS_pept        complement(109032..109922)
FT                   /codon_start=1
FT                   /gene_family="HOG000262547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409582"
FT                   /gene_name="rarD"
FT                   /locus_tag="ETAF_0101"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40224.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniParc:UPI0001BD05A5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T576"
FT                   /transl_table=11
FT                   /translation="MDTQHTRQGVILALTAYLIWGIAPIYFKLLQQVPATEILTHRVIW
FT                   SFFFMLILLAIGRSWRQLYALRHTPYKIALLALSACLIGGNWLLYIWAVNHNHMLEASL
FT                   GYFINPLVNVLLGMLFLGERFRRMQWLAVALAIVGVMVQLWQFGSVPVIALGLAFSFAF
FT                   YGLLRKKIAIDAQSGMLMETLWLLPLALYYLFVAADSPTSHLSANPLSLNLLLIAAGVV
FT                   TTVPLLCFTAAATRLRLSTLGFFQYLGPTLMFLLATLCYGEQMTRDKLIAFGFIWSALL
FT                   LFIIDALYTQRRLRR"
FT   CDS_pept        110130..111017
FT                   /codon_start=1
FT                   /gene_family="HOG000288150" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409583"
FT                   /locus_tag="ETAF_0102"
FT                   /function="phospholipase A1 activity"
FT                   /function="phospholipase A2 activity"
FT                   /biological_process="lipid metabolic process"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40225.1"
FT                   /db_xref="GO:0004623"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008970"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="UniParc:UPI0001BD05A6"
FT                   /db_xref="UniProtKB/TrEMBL:E0T577"
FT                   /transl_table=11
FT                   /translation="MNACKKYLMAGVAALPLVAQAAPSASESGAAPALSDNEGVIANML
FT                   RHYDNPFTLYPYSTNYVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISLAFPIWRGIA
FT                   GDNSVLGAAYTQQSWWQAFNRSESSPFRETNYEPRLFLGWATDYPLFGGWVLRDIEAGG
FT                   VHQSNGRSDPTSRSWNRVYTRFLAQNGNFQVQLMPWYRIPESPNKDDNPDITKYMGYYE
FT                   AEMGYRLGESVFSLRGRYNWNSGYGAAELGWSYPLTRHVRFYTQLFSGYGESLIDYNFR
FT                   QTRFGVGVMLNDIL"
FT   CDS_pept        111086..112915
FT                   /codon_start=1
FT                   /gene_family="HOG000044388" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409584"
FT                   /gene_name="recQ"
FT                   /locus_tag="ETAF_0103"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent 3'-5' DNA helicase activity "
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /biological_process="SOS response"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADM40226.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0009432"
FT                   /db_xref="GO:0043140"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="UniParc:UPI0001BD05A7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T578"
FT                   /transl_table=11
FT                   /translation="MATAAVINTERLAEGVLKDTFGYQQFRPGQQAIVEAAIAGRDCLV
FT                   VMPTGGGKSLCYQIPALVRDGLTIVVSPLISLMKDQVDQLQANGVNAACLNSTLNREQQ
FT                   QAVYAGCRSGEIRLLYIAPERLMMDNLLDTLPQWNPTLLAVDEAHCISQWGHDFRPEYS
FT                   ALGQIKRRFPQMPVIALTATADDATRQDILGLLDLRDPLVQVSSFDRPNIRYTLIEKFK
FT                   PLDQLWHFVQSQRGKSGIIYCNSRAKVEDTAARLQSRGLSVGAYHAGLDNGRRAEVQEA
FT                   FQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEALLFY
FT                   DPADMAWLRRCLEEKPEGAQKEIERHKLNAMNAFAEAQTCRRLVLLNYFGEGRQESCDN
FT                   CDICLDPPKRYDGLLDAQKALSTVARVGQRFGIGYVVEVLRGANSARIREWGHDKLSVY
FT                   GIGREHSTEHWVSILRQLIHLGLVTQNIALHSALQLTEAARPVLRGEVALPLAVPRVIN
FT                   LKARSSAQKSYGGNYDRKLFAKLRKLRKAIADEENIPPYVVFNDATLLEMAEQMPLRAG
FT                   DLLSINGVGQRKLERFGAPFMTLIREHLDEGQD"
FT   CDS_pept        complement(112922..113821)
FT                   /codon_start=1
FT                   /gene_family="HOG000079691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409964"
FT                   /locus_tag="ETAF_0104"
FT                   /protein_id="ADM40227.1"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniParc:UPI0001BD05A8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T579"
FT                   /transl_table=11
FT                   /translation="MRIIRLTLLLLGTLYIHGALAAQALVLQTDFSLRDGAVSAMKGVA
FT                   FGVDSQIHLFDLTHEIPPYDIWQAAYRLHQTARYWPAGTVFVSVVDPGVGSERRSVVLK
FT                   TKNGQFFVSPDNGTLTLVAQTLGIDSVREIDEQTNRLQGSEKSYTFHGRDVYAYTGARL
FT                   ASGTIRFEQVGPRLPNQITEIPYQQAQWQPGKVSGTIAILDVQYGNLWSNIGDEMLEKA
FT                   GIALNDRLCITIAQQGQTRYQGHAPYVHSFADVPPGQPLVYLNSLLNVAVALNMDSFAE
FT                   KQRIAAGAEWQITLQKCR"
FT   CDS_pept        113977..114585
FT                   /codon_start=1
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409965"
FT                   /locus_tag="ETAF_0105"
FT                   /biological_process="amino acid transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40228.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006865"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniParc:UPI0001BD05A9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T580"
FT                   /transl_table=11
FT                   /translation="MMLFLTVAVVHLLALMTPGPDFFFVSQTALSRSRAEALRGVAGIS
FT                   LGIVIWAGVALMGLHLLLMKMAWLHSIITVGGGLYLCWMGLQMLRAARRPQGDAPQGVT
FT                   SLHGGAFWRGFLTNLSNPKAVIYFGSVFSLFVGDEVTGAQRIGLFILIVSETFIWFSLV
FT                   ASVFALPVMRRGYQRMARWIDGVAGTLFAAFGLHLILSR"
FT   CDS_pept        complement(114659..115975)
FT                   /codon_start=1
FT                   /gene_family="HOG000237114" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409966"
FT                   /gene_name="gntU"
FT                   /locus_tag="ETAF_0106"
FT                   /function="gluconate transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40229.1"
FT                   /db_xref="GO:0015128"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniParc:UPI0001E35555"
FT                   /db_xref="UniProtKB/TrEMBL:E0T581"
FT                   /transl_table=11
FT                   /translation="MTAVGSVLLLLFLVMKARMHAFVALMLVSIGAGIFSGMPIDKIAQ
FT                   TMQNGMGGTLGFLSIVVALGAMFGKILHETGALDQIAARLLKSFGEKRAHYALGIAGLV
FT                   CALPLFFDVAIVLLIGVVFAVARRTGGNVVKLAIPLFAGVAGAAAFLLPGPTPMLLASQ
FT                   MGADYGWMILIGLCAAIPGMILAGPLYGNFISKHVTLALPKDIQEPSLGKGQLPSFSFS
FT                   LALVLFPLVLVGLKTIGARFVEQGSELYKWLEFIGHPFTAILLACLVATYGLAIRRGMS
FT                   KEKVMDICSAAIQPAGIILLVTGAGGVFKQVLVDSGVGPALGNSLIGAGLPIAVACFVL
FT                   AAAVRVIQGSATVACLTTVGLVLPVIGELGYSGAQLAALSVCIAGGSIVLSHVNDSGFW
FT                   LYGKFTGATEAQTLKTWSVMETILGTTGAIVGMLFFMAL"
FT   CDS_pept        complement(116008..116538)
FT                   /codon_start=1
FT                   /gene_family="HOG000032567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409967"
FT                   /locus_tag="ETAF_0107"
FT                   /function="ATP binding"
FT                   /function="gluconokinase activity"
FT                   /function="shikimate kinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ADM40230.1"
FT                   /db_xref="GO:0004765"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0046316"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="UniParc:UPI0001BD05AB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T582"
FT                   /transl_table=11
FT                   /translation="MSESQQQKHVFVLMGVSGSGKSAVANAVAQRLGAAFLDGDFLHPR
FT                   ANISKMADGHALNDDDRTPWLQALNDAVFAMQRTNDVSLIVCSALKKRYRDMLRDGNTN
FT                   LSFIYLQGDFALIESRLLARKGHFFKPQMLVSQFAALEEPTTEERDVYAIDISQPLDSV
FT                   VADTLNTIKSIIA"
FT   CDS_pept        complement(116758..117762)
FT                   /codon_start=1
FT                   /gene_family="HOG000220181" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409968"
FT                   /locus_tag="ETAF_0108"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADM40231.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniParc:UPI0001BD05AC"
FT                   /db_xref="UniProtKB/TrEMBL:E0T583"
FT                   /transl_table=11
FT                   /translation="MKMKKKRPVLQDIADRVGVTKMTVSRYLRNPELVSLPLRGKIAAA
FT                   LDELGYIPNRAPDILSNATSRAIGVLLPSLTNQVFAEVLRGIESVTDQHHYQTMLAHYG
FT                   YRKEKEEERLTSLLSYNIDGLILAERDHTPRTLKMIEVAGIPVVELMDSVSPCLDMAVG
FT                   FDNVEAARAMTQAIIARGHRRTVYFGARLDERTVMKQRGYEAAMRAADLTPRSVMIPRS
FT                   SSYSVGGELLREALKRYPDMDSIFCTNDDLAVGAAFECQRLGLRIPQDMAIAGFHGHDI
FT                   GQVMEPQLASVLTPRQRMGQLAAERLLARLRGERSVEAAAIDVGFTLLHGGSI"
FT   CDS_pept        117980..120286
FT                   /codon_start=1
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409969"
FT                   /locus_tag="ETAF_0109"
FT                   /function="ATP binding"
FT                   /function="cadmium-exporting ATPase activity"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /function="zinc-exporting ATPase activity"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40232.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0008551"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016463"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006404"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001BD05AD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T584"
FT                   /transl_table=11
FT                   /translation="MTHKHIHSGGPDAACGCGHQHAAMQHGCSRPAHGALKISMASPLT
FT                   PAADGACCMAIHDHDGVEEDADPHPLPPLASGRQRFSWRVEGMDCPSCARKIETAVAQI
FT                   SGVERAAVLFATQKLVVDAQQDLSPTIERAVRQAGFSLQAVGAKRAESAALRWHEVMPP
FT                   IALALLMLLSYGLTLMDPSLGRVAFIATTLVGLAPIMLKAMRLMRSGSYFAIETLMSIA
FT                   ALGALFIGATQEAAMVLLLFMLGERLESYAANRARKGVSALMALVPDDAVVIEQERRRT
FT                   LAVSALRPGMEIEVAPGGRLPADAELLQESVSFDESALTGESLPVDRQPGARVPAGALV
FT                   VDRVCRLRVISQPGQNAIDRILQLIEEAEERRAPIERFLDRFSRYYTPAIMALALLVIL
FT                   IPPLAFAQPWDTWIYRGLTLLLIGCPCALVISTPAAITSGLAAASRHGALIKGGAALEQ
FT                   LGRVRTIAFDKTGTLTQGTPQVSGVFGVEGVSAERLLTLAAAVEVGSHHPLAKAVILAC
FT                   EQRGLPVVQAQARQAQAGIGVAGEVDGVAVQVAAPSRLAPETLSEALLTQIAAWEALGQ
FT                   TVVAVLLDGVAIGAIAMSDTLRPDAAEALDALRALGIEAVMLTGDNPRAAAAIAGSLGI
FT                   DFRAGLLPQDKVHQVEALSRRADTAMVGDGINDAPAMKAASIGIAMGGGTDVALETADA
FT                   ALTHNRLIGLAQMIALSRATHANIRQNITLALGLKGVFLITSLLGITGLWLAVLADSGA
FT                   TALVTANALRLLRRR"
FT   CDS_pept        120439..121500
FT                   /codon_start=1
FT                   /gene_family="HOG000218430" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409970"
FT                   /locus_tag="ETAF_0110"
FT                   /protein_id="ADM40233.1"
FT                   /db_xref="UniParc:UPI0001E3556A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T585"
FT                   /transl_table=11
FT                   /translation="MLSCLSGVLMSGVTHAATQDNTTELSSTLPTYYGLPQSQAHAADS
FT                   VPTAQTSAPEAQKGSILPIWGDEARARGYDLPEPFGINVNYMNMRQNIVVDSISFSGLG
FT                   WDSYSLPTDLFNIKVGSTRQRSVTQTIKLDAWVLPFMNVYGIVGKTRGSSLSKVSVDAD
FT                   PSQYPLGSMDWIIATVVKGMNKSGQLRDLDFQLNFKGTTYGAGTVLAGGYGNWFGLVDM
FT                   NYTQTRFDILDGSIDAFTLSPRVGYRFTTPGIDAVGLPDGKLSLWVGSMYQDVQQEFKG
FT                   SLSDLSMPGGLSALMEIANKQGQGRFDVRQHLSSPWNVLIGAQYEITRNFNLTTEVGFA
FT                   ERNSFFIAGEYRF"
FT   CDS_pept        121500..122633
FT                   /codon_start=1
FT                   /gene_family="HOG000218429" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409971"
FT                   /locus_tag="ETAF_0111"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ADM40234.1"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI0001BD05AF"
FT                   /db_xref="UniProtKB/TrEMBL:E0T586"
FT                   /transl_table=11
FT                   /translation="MRRPLMTLALVCALSPLAGQAALLPTRAQIDEWLGHLGGDDRFDP
FT                   DKGIDWGILPGPFFNPELGLGIGAAVAGLYRPDPSDTTSQNSSITLSGYLSSTGAFGLG
FT                   VRSYSFFDNDRWRIFVTGGISDTPTYYWGQGFRAGADDDGRQKYTAQSLRLQPEVLYRV
FT                   ASQTYLGVGWSLSAMHAADVKQTDRLAQIHYGRSVFSSGPSLSLQYDSRDFVPNPRRGM
FT                   LASLRYTHYTPETGSDTRFDNLTTRFSTYHALDETRVLAWEIDGEFTQGAVPWNMLPSL
FT                   GGDQRMRGYYQGRYRDRNLISSQLEYRQKLSWRHGVVAWAGAGTMGPNVRELGSSRWLP
FT                   TVGVGYRFAFKPGINIRLDYGIGRGSSGFYFQVGEAF"
FT   CDS_pept        122633..123766
FT                   /codon_start=1
FT                   /gene_family="HOG000218428" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409972"
FT                   /locus_tag="ETAF_0112"
FT                   /protein_id="ADM40235.1"
FT                   /db_xref="UniParc:UPI0001BD05B0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T587"
FT                   /transl_table=11
FT                   /translation="MAVVRGCCVALLAWCGLAGAFGLPMSLDLAQLQPLQAAHAWPVSA
FT                   PLPPPDGLRPCCAFGYDLNAEALGVPIPFYRLNNVVEADALGGHRYNDSLFGALASLAG
FT                   LGSERNGLVYTRRGGFLDLAHVRDSADMTVYIFSHLYPRLGQPFHLALGDELAQRQLVF
FT                   SAFTPPSAARERYTLAAYLAARLAFEVAAWHEIAQWYGYESIPGFSEGVSAFSPEDLYS
FT                   NLLGTRLALTLILNGHAASLGQYSAALTTLLPQALCQLQAQPAVLTRFQFDMLDGKWWD
FT                   SRQAVPQKFLVLKRNYDTRDDRLPTPVSGELTPPLRLMLPGQVYRYDLATLAELRLLPG
FT                   TSMKRLPAPPHYYTWRDFAHLAAFAGTQDALQLSRKR"
FT   CDS_pept        123886..124785
FT                   /codon_start=1
FT                   /gene_family="HOG000269445" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409973"
FT                   /locus_tag="ETAF_0113"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40236.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniParc:UPI0001BD05B1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T588"
FT                   /transl_table=11
FT                   /translation="MFLLLATTLLWAFSFSLIGVYLAGQVDSWFAVLVRVALATLVFLP
FT                   FLRWRGVRPRQALAYMLVGAFQLGLMYLFYYPAFLYLTVPEVLLFTILTPLYVTLIYDL
FT                   LQGRRLRPGYLGSALLAVLGALIIRYNPLSSQFLLGFALIQGANLCFALGQVGYKRLME
FT                   VMPLPQYRAFSWFYLGALTVALPAWWLYGNPQMLPTTSLQWGILLWLGVGASGLGYFMW
FT                   NYGATQVDAGTLAIMNNALIPAGLLVNLAIWQQHPDWFRLTLGGTVIALSLWVHRRWIV
FT                   PHHGQTAGRRRRGGAPAE"
FT   CDS_pept        complement(124664..125626)
FT                   /codon_start=1
FT                   /gene_family="HOG000218906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409974"
FT                   /gene_name="metR"
FT                   /locus_tag="ETAF_0114"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40237.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001E3556B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T589"
FT                   /transl_table=11
FT                   /translation="MIELKHLRTLQALRGGGSLAAAAARLHQTQSALSHQFSELEQRLG
FT                   YRLFVRKSQPLRFTPQGEILLALAEQVLPQVQQALQTCQVPPQQTLRLAIECHSCIQWL
FT                   TPALTQFQAQFPQVTLDFRSGVTFDPQPALQQGELDLVLTSDILPRDTLYYAPLFDYEV
FT                   RLVMAPGHPLARRGAVRPQDLAQETLLIYPVARQRLDVWNHFLQPAGIAPRLKQVDNTL
FT                   LLLQMAAAGMGIAALPHWVAESAERQGALTTRPLGEGLWRRLYAALRTGEQRQSVMDGF
FT                   IQLARRHACDALPFVRDVVRSNAGAPKATGRSLSHPASA"
FT   CDS_pept        125750..128026
FT                   /codon_start=1
FT                   /gene_family="HOG000246221" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409975"
FT                   /gene_name="metE"
FT                   /locus_tag="ETAF_0115"
FT                   /function="5-methyltetrahydropteroyltriglutamate-
FT                   homocysteine S-methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="microtubule cytoskeleton organization "
FT                   /cellular_component="microtubule"
FT                   /protein_id="ADM40238.1"
FT                   /db_xref="GO:0000226"
FT                   /db_xref="GO:0003871"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="UniParc:UPI0001BD05B2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T590"
FT                   /transl_table=11
FT                   /translation="MQVISHTLGFPRIGLQRELKKALEAYWSGSAPQSALLACGAELRA
FT                   RHWRQQHQAGIDLLPVGDFAWYDHVLATSLMLGNVPARHRRADGVIDLDTLFGIARGRA
FT                   PGGKPAAAAEMTKWFNTNYHYIVPEFTRGQRFSFGWRQLLEEVDEALALGYRVKPVLLG
FT                   PLTYLWLGKVKGAPFDRLSLLEEVLAVYRQVLAALAERGVEWVQVDEPALVLTLPPAWR
FT                   DAYQHAYQALRGPVKLLLTTYFGDIGHHLPTICALPVQGLHVDLVQGAGDALALHRQLP
FT                   ADWVLSLGAIGGRNVWRADLADWQTRLQPLVGQRPVWLGSSCSLLHTPIDLSAETQLDE
FT                   EVKSWFAFALQKCSELALLTQALNDPASRREALLSYSAPLYLRRRSERVHNPAVTERLA
FT                   ALSDADTQRTSAYPQRARRQRQRFALPLWPTTTIGSFPQTPAIRTLRLDFRRGQLTPQH
FT                   YHRGIAEHIRQAIREQERLGLDVLVHGEAERNDMVEYFGEQLAGFVFTCNGWVQSYGSR
FT                   CVKPPVIVGDISRPAPLTVEWTTFAQAQTSRPVKGMLTGPITMLCWSFAREDVPREVIA
FT                   RQLALALRDEVDDLQRAGIGIIQIDEPALREGLPLRQDEWQAYLAWAVAAFRLTAAVAY
FT                   DDTQIHTHMCYCEFNDIMAAIAALDADVITIETARSDMELLEAFSRFDYPNEVGPGVYD
FT                   IHSPNVPTQAAMVSLLRRAAQHIPAERLWVNPDCGLKTRGWEETRRALSNMVAAARLLR
FT                   AQTQA"
FT   CDS_pept        complement(128073..128840)
FT                   /codon_start=1
FT                   /gene_family="HOG000274897" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409976"
FT                   /locus_tag="ETAF_0116"
FT                   /function="uridine phosphorylase activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="nucleotide catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40239.1"
FT                   /db_xref="GO:0004850"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniParc:UPI0001BD05B3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T591"
FT                   /transl_table=11
FT                   /translation="MSKPEVFHLGLAKSDLHGATLAIVPGDPERVEKIAKLMENPVKLA
FT                   SHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRVGTTGAIQPHINV
FT                   GDVLVTTASVRLDGASLHFAPMEFPAVADFTCTTALVDAARAVGAATHVGITASSDTFY
FT                   PGQERYDTFSGRVTRRFRGSMKEWQEMGVMNFEMESATLLTMCSSQGLRAGMVAGVIVN
FT                   RTQQEIPNAETMKQTESHAVKIVVDAARRLLQD"
FT   CDS_pept        129208..131016
FT                   /codon_start=1
FT                   /gene_family="HOG000220271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409977"
FT                   /locus_tag="ETAF_0117"
FT                   /biological_process="cellular response to starvation "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40240.1"
FT                   /db_xref="GO:0009267"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="UniParc:UPI0001BD05B4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T592"
FT                   /transl_table=11
FT                   /translation="MQHAITFVLATLCILAICYRLYGLFFVRKVLRADDSEVTPSHTYE
FT                   DGKDYVPTKKWVNFGSHFAAIAAAGPLVGPVLAAQFGYLPGFLWLLIGCVIGGAVHDTV
FT                   VLFASMKHQGKSLSEVAKSELGPIAGWCTGLAMLFIITITMAGLSMVVVHALERNPWGT
FT                   FAVFMTIPIAICVGLWERITGSMKGATYAGIAAIILCVFAGPYIQHTTFGEWLTWKSST
FT                   VSLLLPAYAFFATALPVWMLLTPRGYLSSFMKIGVFGALVVGVVFINPEIQFPAITQFI
FT                   HGGGPVLSGPVWPFISITIACGAISGFHAFIGSGTTPKQIDKWSDILPVGFGAMLAECV
FT                   VGVMALIAATSLHPADYFAINSSAQAWAGLGMEVVHLPQLSQEIGLDLYGRTGGAVTLA
FT                   VGMTDIFIRVPWFSSLASYFFQFVIMFEAVFILTAVDSGTRVARYLLQDFLGDLWAPLK
FT                   RTDWLPGSIFCSVVACLLWGYLLNSGDINSVWALFGVSNQLMASVGLIIGATIILRLAT
FT                   KRIYMLTCIIPLVYLFITVNYAGYWMVKHVYFNPQAAGYNLFNGTISIIMLVLGMVILL
FT                   SALRKWRELWIKRGDELAAAQAEATA"
FT   CDS_pept        131135..131662
FT                   /codon_start=1
FT                   /gene_family="HOG000105368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409978"
FT                   /locus_tag="ETAF_0118"
FT                   /protein_id="ADM40241.1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniParc:UPI0001BD05B5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T593"
FT                   /transl_table=11
FT                   /translation="MLDSIIQGTIEFVRLHQGWAVPLVFFLAFGESLAFISLLLPATVI
FT                   LFALSALLGEGGVPFVPVWLAAAGGAFLGDWLSYWLGYHYQHQIGHMWPLSRSPQILQR
FT                   GHRYFARWGFWGVFFGRFLGPLRAAVPLVAGICAMRQRYFQLANLLSALIWGAGILAPG
FT                   MLGIRWLGQWIG"
FT   CDS_pept        131765..133174
FT                   /codon_start=1
FT                   /gene_family="HOG000270056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409979"
FT                   /gene_name="rmuC"
FT                   /locus_tag="ETAF_0119"
FT                   /protein_id="ADM40242.1"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniParc:UPI0001BD05B6"
FT                   /db_xref="UniProtKB/TrEMBL:E0T594"
FT                   /transl_table=11
FT                   /translation="MENVTLWILAASLAGMAIGWLAAALRAQQARVAHEQALGALDSQL
FT                   AAAQERIAQQRLWHEECERLNQELRAQRDVNSAQEAELREVTIRLEETRMGAEEKQRLL
FT                   LNAEQRLNVQFENLANRIFEHSGRRVEEQNRQSLDALLTPLREQLDGFRRQINDSFGQE
FT                   ARERHTLTHEIRSLQQMNAQMAREALNLTRALKGDNKMQGNWGEVVLSRVLESSGLREG
FT                   HEYRTQVSVQTEESGRMQPDVVVHLPQGKDVVVDAKMSLVAYERFFNAEDERERELALQ
FT                   QHILSLRAHIRQLGRKDYQRLPGLRTLDYVLMFIPLEPAFLAAIERDPELISEALRHNI
FT                   MLVSPTTLLVALRTINNLWRYEYQSQNAQKIADRAAKLYDKVRLFVDDMSTLGQSLERA
FT                   QSSYRQAMNKLSHGRGNLIGQVESFRGLGVEVKRPISPALVQEACQLPQDGDPAAVSGE
FT                   VVAHHGTPSVQ"
FT   CDS_pept        133297..134052
FT                   /codon_start=1
FT                   /gene_family="HOG000249463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409980"
FT                   /gene_name="ubiE"
FT                   /locus_tag="ETAF_0120"
FT                   /function="methyltransferase activity"
FT                   /biological_process="menaquinone biosynthetic process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="ADM40243.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0009234"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="UniParc:UPI0001BD05B7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T595"
FT                   /transl_table=11
FT                   /translation="MVDQTPETTHFGYKTVAAADKAGKVAQVFHSVAGKYDLMNDLMSF
FT                   GIHRLWKRFTIDCSGVRQGQRVLDLAGGTGDLAAKFSRMVGEQGEVVLADINDSMLKIG
FT                   REKLRNMGIAGNLNYVQANAEALPFPENYFDCITIAFGLRNVTDKDKALRSMFRVLKPG
FT                   GRLLVLEFSKPQFAALSKAYDAYSFHILPRIGEMVAHDGDSYRYLAESIRMHPDQETLK
FT                   GMMASAGFENTTYDNLTGGIVALHRGYKF"
FT   CDS_pept        134068..134673
FT                   /codon_start=1
FT                   /gene_family="HOG000269583" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409981"
FT                   /gene_name="yigP"
FT                   /locus_tag="ETAF_0121"
FT                   /function="sterol binding"
FT                   /protein_id="ADM40244.1"
FT                   /db_xref="GO:0032934"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniParc:UPI0001BD05B8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T596"
FT                   /transl_table=11
FT                   /translation="MLTPLCTALLETALNAALYRDRALQSARQRLAGRVLQISLAELED
FT                   PFFLIFSQRQVDVLAQWEGAVDCQVTTRLSVLPQLRARRQLAALMQCGDLRVDGDIQVV
FT                   QQLVALLDLAEWAPAELLAPYTGDIVAQGLCSVAQRSGHALLGSLRRQRHYARDALIEE
FT                   WRLAPGTLEFTWFQEEAAALQRQASALEQRLARLEKCV"
FT   CDS_pept        134670..136301
FT                   /codon_start=1
FT                   /gene_family="HOG000264440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409982"
FT                   /gene_name="ubiB"
FT                   /locus_tag="ETAF_0122"
FT                   /function="monooxygenase activity"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40245.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001BD0606"
FT                   /db_xref="UniProtKB/TrEMBL:E0T597"
FT                   /transl_table=11
FT                   /translation="MTPSELRRLCLIIRVFLAYGLDELIPPMRITLPLRIGRRCLFWMR
FT                   NRHGDKPLGERLRLALQTLGPVWIKFGQMLSTRRDLFAPAIADQLALLQDRVAPFDGAL
FT                   ARRQIEAALGGPLEQWFDDFDSQALASASIAQVHTATLRENGREVVLKVIRPDIQPIIR
FT                   ADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFDAS
FT                   PMLYVPEVFSDYCRESVLVMERIYGVPVSDIAALRAQNTNMKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPQDPQYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRKVA
FT                   ELHVDSGWVPPDTNVEEFEFAIRTVCEPIFEKPLDQISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLENWLHDQVGLPALMRALKAKAPYWSE
FT                   KLPELPELLYDSLQQQRRLQHSMDSMTHRLGQQGNRQGRARYLFGIGATLLLSGTILTM
FT                   ANIALWPIGLYVAGVVIWLAGWRYTR"
FT   CDS_pept        136414..136683
FT                   /codon_start=1
FT                   /gene_family="HOG000245363" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409983"
FT                   /gene_name="tatA"
FT                   /gene_synonym="tatA1"
FT                   /gene_synonym="tatA2"
FT                   /locus_tag="ETAF_0123"
FT                   /function="protein transporter activity"
FT                   /biological_process="protein secretion"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40246.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniParc:UPI0001BD0607"
FT                   /db_xref="UniProtKB/TrEMBL:E0T598"
FT                   /transl_table=11
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAIGD
FT                   EEKTPPSTNANSSAAPQDADFKSIVEQQPEVKKEESKSQNKEQV"
FT   CDS_pept        136687..137211
FT                   /codon_start=1
FT                   /gene_family="HOG000245368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409984"
FT                   /gene_name="tatB"
FT                   /locus_tag="ETAF_0124"
FT                   /function="protein transporter activity"
FT                   /biological_process="protein secretion"
FT                   /biological_process="protein transport by the Tat complex "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40247.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0043953"
FT                   /db_xref="InterPro:IPR003998"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniParc:UPI0001BD0608"
FT                   /db_xref="UniProtKB/TrEMBL:E0T599"
FT                   /transl_table=11
FT                   /translation="MFDIGFSELLLVMVIGLVVLGPERLPVAVRTVAGWIRALRSLATS
FT                   VQNELSQELKLQELQDSLKKAESAGLQNLTPELKASMDELKQAAESMKRSYHSEITGSD
FT                   TEKEPSAAETIPHADMPKPEADAALAPRQSAVQEAPAAQAAPATHADAVTASAQPASSP
FT                   STSHDSSQHGR"
FT   CDS_pept        137201..137989
FT                   /codon_start=1
FT                   /gene_family="HOG000245379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409985"
FT                   /gene_name="tatC"
FT                   /locus_tag="ETAF_0125"
FT                   /protein_id="ADM40248.1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="InterPro:IPR019822"
FT                   /db_xref="UniParc:UPI0001BD0609"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A0"
FT                   /transl_table=11
FT                   /translation="MAVEDTQPLISHLIELRKRLLNAIICILVVFLALVYFANDIYHLV
FT                   SAPLINQLPHGASMIATDVASPFFTPIKLTMIVSVFVSAPFILYQVWAFVAPALYKHER
FT                   RMLTPLLVSSTLLFYIGMAFAYFVVFPLAFGFFAKTAPAGVTIATDINNYLDFVMALFM
FT                   AFGVSFEVPVAIILLCWTGVTTPAELKKKRPYVVVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   CLLFEVGVFFARFYVGKRRRDPEEEDEDEASHDEEQPKAS"
FT   CDS_pept        138163..138945
FT                   /codon_start=1
FT                   /gene_family="HOG000201523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409986"
FT                   /gene_name="tatD"
FT                   /locus_tag="ETAF_0126"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="ADM40249.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012278"
FT                   /db_xref="InterPro:IPR015992"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniParc:UPI0001BD060A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A1"
FT                   /transl_table=11
FT                   /translation="MLDIGVNLTNGQFSGDVPQVVARARQAGLNGMIITGTNLTESAQA
FT                   LHLAQAYPDFCWATAGVHPHDAHRWNENSAADLEPLLRSPAVVAVGECGLDFARNFSTP
FT                   AQQEAAFEAQLALAAQIGKPVFLHCREAHARFIALLRPWLSRLPGAVLHCFTGTRDELD
FT                   ACLSLGLYIGITGWICDERRGMPLRALLPHIPAERLLLETDAPYLLPRDIQPKPKSRRN
FT                   EPCFLPHIAEQAARWRQQDANWLKQVTENNARQLFRLA"
FT   CDS_pept        138961..139983
FT                   /codon_start=1
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409987"
FT                   /locus_tag="ETAF_0127"
FT                   /function="metal ion binding"
FT                   /function="porphobilinogen synthase activity"
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="ADM40250.1"
FT                   /db_xref="GO:0004655"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001BD060B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A2"
FT                   /transl_table=11
FT                   /translation="MSYAFPGAFPGRRLRRLRRHDFSRRLCAENVLTVDDLIYPVFVME
FT                   GNNHQEAVSSMPGVQRMTIDVLVREAEAVAKLGVPVLSLFPVVGTDKKSLYAEEAYSSD
FT                   GLVQRAVRALKDAVPELGILTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSH
FT                   AEAGADIVAPSDMMDGRIGAIRSMLESQKLVNTQIMAYSAKYASCYYGPFRDALGSSGN
FT                   LKGGNKKTYQMDPANGDEALQEVAQDLQEGADMVMVKPGMPYLDVLRRVKDTFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLQEKPAIMESLICFKRAGADGVLTYFAKRVAQWLHDAEMTR
FT                   "
FT   CDS_pept        complement(140055..140546)
FT                   /codon_start=1
FT                   /gene_family="HOG000272711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409988"
FT                   /gene_name="rfaH"
FT                   /locus_tag="ETAF_0128"
FT                   /function="transcription elongation regulator activity "
FT                   /biological_process="positive regulation of transcription
FT                   elongation from RNA polymerase II promoter"
FT                   /protein_id="ADM40251.1"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0032968"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI0001BD060C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A3"
FT                   /transl_table=11
FT                   /translation="MESWYLLYCKRGQLTRAREHLTRQEIPCVTPMITLEKVVRGKRTQ
FT                   VQEPMFPNYMFIELDPERIHTTTVQSTRGVSHFVRFGKLPATVPFSIVKQLMMAPTPTA
FT                   IAPQTPIPGDRVRITQGAFSGMEAIYRESDGEKRAILLLNLLNQEVSHTLSNSAFEKIL
FT                   "
FT   CDS_pept        140797..141522
FT                   /codon_start=1
FT                   /gene_family="HOG000281834" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409989"
FT                   /locus_tag="ETAF_0129"
FT                   /function="dipeptidase activity"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40252.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016805"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="UniParc:UPI0001BD060D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A4"
FT                   /transl_table=11
FT                   /translation="MELFLLSNGKVSGESELLGYAKGMIQSMLLEKKIRRALLIPYALI
FT                   RSSYDARAAELEHSLGITVESIHHHADPVKALEEAECILISGGNTWVLNQMLHEHGLIV
FT                   PIQRAVRERGIPYIGWSAGCNVATPSIRTTNDMPVRNSVVLPSLGLFPVQINPHYIDAH
FT                   LSGHMGETRDERIAEFCAVNPSESVIALREGSLLHVSGETLQYYSAKAQGYKVFRHGEE
FT                   THEYHDTQALAALVPFHCR"
FT   CDS_pept        141593..143128
FT                   /codon_start=1
FT                   /gene_family="HOG000227663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409990"
FT                   /locus_tag="ETAF_0130"
FT                   /function="lyase activity"
FT                   /protein_id="ADM40253.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="UniParc:UPI0001E3556C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A5"
FT                   /transl_table=11
FT                   /translation="MKNAYNGLFTRIDKNAMKYRDLREFIALLEQRGELKRIQQSIDPY
FT                   LEMTEIADRTLRAGGPALLFENPKGYDIPVLCNLFGTPQRVALGMGQEEVGALRDVGKL
FT                   LAFLKEPDPPKGFRDLVEKLPQFKQILNMPTKRLSKAPCQARVFQGDDVDLATLPVMHC
FT                   WPQDVAPLVSWGLTVTRGPCKSRQNLGIYRQQVLGKNKLIMRWLSHRGGALDFQEWCQA
FT                   HPGERFPVAVALGADPATLLAAVTPVPDSLSEYAFAGLLRGHKSEVVKCLSCDLEVPAS
FT                   AEIVLEGYIEPGETAPEGPYGDHTGYYNEVERFPVFTVTHLTQRDRPIYHSTYTGRPPD
FT                   EPAVLGLALNEVFVPLLQKQFPEIVDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVW
FT                   SFLRQFMYTKFVIVCDDDINARDWQDVIWALTTRMDPARDTLLIENTPIDYLDFASPVS
FT                   GLGSKMGLDATNKWPGETQREWGHPIVMDEAVRVRVDTLWNELDIFANDKDAQ"
FT   CDS_pept        143218..143868
FT                   /codon_start=1
FT                   /gene_family="HOG000269618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409991"
FT                   /locus_tag="ETAF_0131"
FT                   /function="FMN reductase activity"
FT                   /function="aquacobalamin reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40254.1"
FT                   /db_xref="GO:0008752"
FT                   /db_xref="GO:0047138"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI0001BD060F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A6"
FT                   /transl_table=11
FT                   /translation="MYRVRLVPGRAVDFRAGQYLMVVMDERDKRPFSMASTPLQSDCIE
FT                   LHIGASELNLYAMAVMDRILQDRTLCVDMPHGDAWLREDSLRPLVLIAGGTGFSYTRSI
FT                   LLMALSQQPQREISLYWGGRELKHLYDLNELYALSARYPQLKVIPTVEQPDADWQGRSG
FT                   TVISAVMQDFGSLAQHDIYIAGRFEMAKIARERFCAEREANPDHIYGDAFAFI"
FT   CDS_pept        144011..145342
FT                   /codon_start=1
FT                   /gene_family="HOG000290531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409992"
FT                   /gene_name="pepQ"
FT                   /locus_tag="ETAF_0132"
FT                   /function="dipeptidase activity"
FT                   /function="metal ion binding"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40255.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0016805"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="UniParc:UPI0001BD0610"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A7"
FT                   /transl_table=11
FT                   /translation="MDTLASLYTKHLATLQQRARTILERHQLDALLIHSGEPIARFLDD
FT                   QDYPFKINPHFKAWVPVTQVPNCWLWIDGVNKPKLWFYAPQDYWHSVSPLPQAFWTEQV
FT                   EMTALRHADDIAALLPAARGNVAYIGPNADRARSLGIDEAHQNPQAVLNFLHYHRAYKS
FT                   EYEQACMREAQKIAVDGHQAALEAFRAGMSEFDINLAYLSATGQGENDVPYDNIIALNR
FT                   HAAVLHYTHLERRAPSEMHSFLIDAGAEFHGYAADLTRTYAANGQSDFAALVAEVNQAQ
FT                   QALIATLQTGVRYTDYNLQFHQRLAAILRHHHILTGISDEAAVAQGLTTPFLPHGLGHP
FT                   LGLQVHDVAGFMQDELGTQMAAPDRYPYLRCTRIMEPGMVMTIEPGLYFIDTLLAPWLE
FT                   GEFGQHFNRSRIDALRPYGGIRIEDNVIFHAHGVENMTRDLHLA"
FT   CDS_pept        145360..145956
FT                   /codon_start=1
FT                   /gene_family="HOG000075267" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409993"
FT                   /locus_tag="ETAF_0133"
FT                   /function="GTP binding"
FT                   /protein_id="ADM40256.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="UniParc:UPI0001BD0611"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A8"
FT                   /transl_table=11
FT                   /translation="MPAQPVSVCEEIKKSRFITLLAHTPGVDAAKAFVQETRRAHPDAR
FT                   HHCWAFVAGAPGDTQRLGFSDDGEPSGTAGKPMLAQLMGSGVGEVCAVVVRYYGGIKLG
FT                   TGGLVRAYGSGVQQALQALVRRQKVPMAAYTLCCDYAQLTLVEGIVAQAGGSVLDSAFS
FT                   AQVMLRLSLPLGSQDEVDEKLRNASRGALQLQATS"
FT   CDS_pept        146009..147460
FT                   /codon_start=1
FT                   /gene_family="HOG000225541" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409994"
FT                   /gene_name="trkH1"
FT                   /locus_tag="ETAF_0134"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40257.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniParc:UPI0001BD0612"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5A9"
FT                   /transl_table=11
FT                   /translation="MHFRAIIRIVGLLVILFSGTMFVPGLVALIYRDGAGRAFVETFFV
FT                   ALGIGMLLWWPQRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSVTDAFFE
FT                   SFSGLTTTGATTLVGLDALPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGLQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVMLTIACAIALWGAGMDVFDAISHSFSTIAIGG
FT                   FSTHDASIGYFNSPTINTIIAVFLLISGCNFSLHFAFLSGRSPRVYWRDPEFRMFIAVQ
FT                   LTLVSVCTLVLWLHNVYASGWQTLNQAFFQVVSMATTAGFTTDSIAKWPLFLPVLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFLQGSRELKRLVHPNAVYTIKLGNRALPERILEAVWG
FT                   FFSAYALVFIISMLAIIATGVDDFSAFAAVVATLNNLGPGLGVVADNFTSMNDVAKWIL
FT                   VVTMLFGRLEVFTLLVLFTPTFWRN"
FT   CDS_pept        147478..148026
FT                   /codon_start=1
FT                   /gene_family="HOG000251295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409995"
FT                   /gene_name="hemG"
FT                   /locus_tag="ETAF_0135"
FT                   /function="FMN binding"
FT                   /function="electron carrier activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40258.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="UniParc:UPI0001BD0613"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5B0"
FT                   /transl_table=11
FT                   /translation="MKTLVLYSSHDGQTKAIATAIATAMSETLDCELRDLEQAGDIDLN
FT                   AYQAVAIGAAVRYGHFPRALYRFASDHTSQLNTMPSAFFAINLTARKPEKRTPQTNGYT
FT                   RKFLLSTPWKPAQCVVFAGALRYPRYGWLDRTMIKMIMKMTGGETDTTKEVEYTDWQQV
FT                   DRFARDFARFVSTLAKETA"
FT   rRNA            148501..149929
FT                   /gene_name="rrsA"
FT                   /locus_tag="ETAF_3219"
FT   tRNA            150028..150103
FT                   /gene_name="tRNA-Glu"
FT   rRNA            150272..153200
FT                   /gene_name="rrlA"
FT                   /locus_tag="ETAF_3221"
FT   rRNA            153289..153408
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="ETAF_3222"
FT   CDS_pept        complement(153664..154485)
FT                   /codon_start=1
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409996"
FT                   /locus_tag="ETAF_0136"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="ADM40259.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001E3556D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5B1"
FT                   /transl_table=11
FT                   /translation="MRILCHLFGIHRSVYYALVKRPVNVQRIELRSRVRAFHALSRGAA
FT                   GSRAISQMLRQSGVNAVRWLARQLMRECGLTSRQPVKHRYRVNEDNSPPLPNLLNRQFN
FT                   PTAPNRVWCGDISFIRLRDRRCHLALVVDLYSRRIIGSALSLTADADLACRALRNALET
FT                   RSRDGRLLFHSDQGVQYKSNKYRRLLWRYGVMQSMSRRGNCLDNSPMERVFRSFKSEWL
FT                   PKGGYGDFSHAVRDINQWINGYYNVYRPHTNNGGLSPCLHEEKWKQVITVS"
FT   CDS_pept        complement(154512..154700)
FT                   /codon_start=1
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409997"
FT                   /locus_tag="ETAF_0137"
FT                   /protein_id="ADM40260.1"
FT                   /db_xref="UniParc:UPI0001E353DD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5B2"
FT                   /transl_table=11
FT                   /translation="MRKWIRLYKQELQGIEPTGNAITPEQREIQQLKAQIKRLEMEKEI
FT                   LKQAAVLMSEIPGKLSR"
FT   CDS_pept        155087..156124
FT                   /codon_start=1
FT                   /gene_family="HOG000284356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409998"
FT                   /gene_name="murB"
FT                   /locus_tag="ETAF_0138"
FT                   /function="UDP-N-acetylmuramate dehydrogenase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /biological_process="regulation of cell shape"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40261.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008360"
FT                   /db_xref="GO:0008762"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniParc:UPI0001BD0616"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5B3"
FT                   /transl_table=11
FT                   /translation="MSKHLTSLTEFTTFGLPARAEQILTADSSAALLSHWQAATARRQP
FT                   VLILGGGSNVLFMEDFAGSVILNRIPGIQVDEDEESWHLHVGAGENWHDLVRYTLDHGM
FT                   AGLENLALIPGCVGSAPIQNIGAYGVELQHVCDYVDAMDLRNGTLQRLPAAACGFGYRE
FT                   SIFKHRYRDGYAIVAVGLRLSKRWQPMLSYGDLTRLDAMTATPRAVFDAVCHMRRTKLP
FT                   DPAQQGNAGSFFKNPVVSAEAAEAIRARYPQAPCYPQENGEVKLAAGWLIDRCELKGYQ
FT                   IGGAAVHRQQALVLINQHQASAQDVIALARYVRRRVGEAFSVWLEPEVRFIAAQGEVNA
FT                   VEVLS"
FT   CDS_pept        156121..157080
FT                   /codon_start=1
FT                   /gene_family="HOG000041812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22409999"
FT                   /locus_tag="ETAF_0139"
FT                   /function="biotin-[acetyl-CoA-carboxylase] ligase activity "
FT                   /function="transcription repressor activity"
FT                   /biological_process="protein modification process "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40262.1"
FT                   /db_xref="GO:0004077"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016564"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniParc:UPI0001BD0617"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5B4"
FT                   /transl_table=11
FT                   /translation="MKDITVPLKLISQLADGDFHSGEHLGESLGMSRAGINKHIQTLRD
FT                   WGIDVFTVPGKGYCLPTPMQLLNADTIGTLLPQGRVTVLPVVDSTNQYLLERIGELASG
FT                   DACVAEYQQAGRGRRGRHWFSPFGANLYLSMYWKLEQGPAAAMGLSLVIGIVMAEVLQA
FT                   LGAAGVKVKWPNDLYLNDRKLAGILVELTGKTGDAANIVVGAGINLMMRNPDTSVVDQQ
FT                   WINLQEAGVNIDRNQLVACLLSRLRSTLADFEVRGLSPFIARWRALDNFIDRPVRLIIG
FT                   EQVIHGIARGIDAQGALLLERDGVITPFIGGEISLRAG"
FT   CDS_pept        complement(157156..158103)
FT                   /codon_start=1
FT                   /gene_family="HOG000248571" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410000"
FT                   /gene_name="coaA"
FT                   /locus_tag="ETAF_0140"
FT                   /function="ATP binding"
FT                   /function="pantothenate kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40263.1"
FT                   /db_xref="GO:0004594"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="UniParc:UPI0001BD0618"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5B5"
FT                   /transl_table=11
FT                   /translation="MKKEQSLATPYLQFDRHQWAALRNSVPLTLTEEEIARLKGINEDL
FT                   SLDEVAQIYLPLSRLLNFYFSSSVSRQAVLEKFLGTHSPRIPYIIGIAGSVAVGKSTTA
FT                   RVLQALLSQWPEHRRVELITTDGFLHPNKVLQERGLMKKKGFPQSYDMHRLVKFVSDIK
FT                   SGVPRVTAPQYSHLIYDVIPDSRKVIEQPDILILEGLNVLQSGMDYPHDPHRVFVSDFV
FT                   DFSIYVDADEHQLQAWYINRFLKFREGAFSNPDSYFHHYSQLPESEAIAIATGLWNEIN
FT                   GLNLRQNILPTRERASLIMTKGSNHAIESVRLRK"
FT   tRNA            158534..158609
FT                   /gene_name="tRNA-Thr"
FT   tRNA            158631..158715
FT                   /gene_name="tRNA-Tyr"
FT   tRNA            158840..158914
FT                   /gene_name="tRNA-Gly"
FT   tRNA            158922..158997
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        159125..160309
FT                   /codon_start=1
FT                   /gene_family="HOG000229290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410001"
FT                   /gene_name="tuf1"
FT                   /locus_tag="ETAF_0141"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40264.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI0001A599CD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S0"
FT                   /transl_table=11
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVIRGSALKALEGEAEWEAKIIELAETLDSYIPEPERDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIKVGDEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEIERGQVLAKPGSITPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIE"
FT   CDS_pept        160652..160987
FT                   /codon_start=1
FT                   /gene_family="HOG000219148" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410002"
FT                   /gene_name="secE"
FT                   /locus_tag="ETAF_0142"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="protein secretion"
FT                   /biological_process="protein targeting"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40265.1"
FT                   /db_xref="GO:0006605"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="UniParc:UPI0001BD061A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S1"
FT                   /transl_table=11
FT                   /translation="MKWLVVAVLLIVAIVGNYIYRDVSLPLRALAVVVIIAAAGGIALM
FT                   TAQGKATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVMALILWGLDGILVRLVS
FT                   FITGLRF"
FT   CDS_pept        160989..161534
FT                   /codon_start=1
FT                   /gene_family="HOG000219264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410003"
FT                   /gene_name="nusG"
FT                   /locus_tag="ETAF_0143"
FT                   /function="transcription elongation regulator activity "
FT                   /biological_process="positive regulation of transcription
FT                   elongation from RNA polymerase II promoter"
FT                   /biological_process="transcription antitermination "
FT                   /biological_process="transcription termination, DNA-
FT                   dependent"
FT                   /protein_id="ADM40266.1"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0006353"
FT                   /db_xref="GO:0031564"
FT                   /db_xref="GO:0032968"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="UniParc:UPI0001BD061B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S2"
FT                   /transl_table=11
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNEGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFSQVEKA"
FT   CDS_pept        161695..162123
FT                   /codon_start=1
FT                   /gene_family="HOG000082123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410004"
FT                   /gene_name="rplK"
FT                   /locus_tag="ETAF_0144"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40267.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniParc:UPI0001BD061C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S3"
FT                   /transl_table=11
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TDSIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGVKSGSGKPNKDKVGKVTRA
FT                   QVREIAETKAADMTGSDVEAMARSIEGTARSMGLVVED"
FT   CDS_pept        162127..162831
FT                   /codon_start=1
FT                   /gene_family="HOG000207015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410005"
FT                   /gene_name="rplA"
FT                   /locus_tag="ETAF_0145"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /function="tRNA binding"
FT                   /biological_process="RNA processing"
FT                   /biological_process="regulation of translation "
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="ADM40268.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI0001A599D1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S4"
FT                   /transl_table=11
FT                   /translation="MAKLTKRMRVIREKVDATKQYDINEAVALLQELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRTVRVAVFTQGPNAEAAKAAGADLVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHSTIGKASFSAEQLKENLEALMVALKKAKPATAKGVYIKKVCLSTTMGAGV
FT                   TIDQATLSAVAN"
FT   CDS_pept        163148..163645
FT                   /codon_start=1
FT                   /gene_family="HOG000004851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410006"
FT                   /gene_name="rplJ"
FT                   /locus_tag="ETAF_0146"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="ribosome biogenesis"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40269.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniParc:UPI0001A599D2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S5"
FT                   /transl_table=11
FT                   /translation="MALNLQDKQAIVAEVTEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLMRRVVEGSQFECLKDTFVGPTLIAFSMEHPGAAARLFKAFAKDNA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMATMKEAAAGKLVRTLAALRDQKE
FT                   AA"
FT   CDS_pept        163712..164080
FT                   /codon_start=1
FT                   /gene_family="HOG000248813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410007"
FT                   /gene_name="rplL"
FT                   /locus_tag="ETAF_0147"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40270.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniParc:UPI0001E353C8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S6"
FT                   /transl_table=11
FT                   /translation="MSITKEQILDAVAEMSVMDVVELISMMEEKFGVSAAAAVAVAAGG
FT                   AAEAVEEKTEFDVVLTAAGGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEAISKDD
FT                   AEALKKTLEEAGASVEVK"
FT   CDS_pept        164412..168440
FT                   /codon_start=1
FT                   /gene_family="HOG000218612" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410008"
FT                   /gene_name="rpoB"
FT                   /locus_tag="ETAF_0148"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /protein_id="ADM40271.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="UniParc:UPI0001BD061D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S7"
FT                   /transl_table=11
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALDFTTEQILD
FT                   LFFDKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDD
FT                   VKLIEVPVEYIVGKVAAKDYIDESTGELICAANMELSLDLLAKLSQSGYKRIETLFTND
FT                   LDHGPYMSETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLMRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDMLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGIVTDEIHYLSAIEEGNFVIAQANSNLDEEGRFVEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGMVQYVDASRIVIKVNEDEMFPGEAGIDIYNL
FT                   TKYTRSNQNTCISQMPCVSLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTSIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHDVLVAGGVEAEKL
FT                   EKLPRDRWLELGLADEAKQNQLEQLAEQYDELKAEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQKAYDLGDHTRQQVDLNTFTD
FT                   EEVLRLAENLKKGLPVATPVFDGAKEREIKGLLELGGIPTSGQITLYDGRTGERFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGSHQMEPGMPESFNVLLKEIRSLGINIELEDE"
FT   CDS_pept        168520..172740
FT                   /codon_start=1
FT                   /gene_family="HOG000218386" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410009"
FT                   /locus_tag="ETAF_0149"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="ADM40272.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="UniParc:UPI0001BD061E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S8"
FT                   /transl_table=11
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKGMDLEAECEQLREELGETNSETKRKKLTKRIK
FT                   LLEAFILSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGDPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLSGPKEAERIYRAGLASLHARVKVRITQYSKSADGEMVPNTGLIDTTVGR
FT                   AILWMIVPKGLPYTIVNQPLGKKAISKMLNACYRALGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEKKAGIIAEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSTETVINRDGEEERQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVLKPGTADILVPRNTLLNEKWCDL
FT                   LEEHSVDSVKVRSVVSCETDFGVCAHCYGRDLARGHLVNKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGNLKLTNAKFVVNTDGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGATLAKGDGAEVNGGETVANWDPHTMPVITEVSGFIRFADMIDGQTVTR
FT                   QTDELTGLSSQVVLDSAERTGSGKDLRPALKIVDANGDDVLLPGTDMPAQYFLPGKAIV
FT                   QLEDGIAISAGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGVVSFG
FT                   KETKGKRRLVITPLDGSDAYEEMIPKWRQLNVFEGERVERGDVISDGPESPHDILRLRG
FT                   VNAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKATIANAGSSEFLEGEQVEVSR
FT                   VKIANRLLESDGKIAATYMRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRAADTSSAPQVSAEEASANLAELLNAGLLG
FT                   GNDE"
FT   CDS_pept        complement(172852..173496)
FT                   /codon_start=1
FT                   /gene_family="HOG000155781" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410010"
FT                   /gene_name="thiE"
FT                   /locus_tag="ETAF_0150"
FT                   /function="magnesium ion binding"
FT                   /function="thiamine-phosphate diphosphorylase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="ADM40273.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004789"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniParc:UPI0001BD061F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5S9"
FT                   /transl_table=11
FT                   /translation="MRQPLFAPVPTRLGLYPVVDSVEWIERLLRAGVRTLQLRIKDCRE
FT                   DQIGDELAQAIALGHHYQARLFINDYWRQAIRLGAYGVHLGQEDLDRADLAAIRRAGLR
FT                   LGLSTHDDAEMDRALAAGPSYVALGHVFPTDSKQMATAPQGLSDLRRQVARLGTYPSVA
FT                   IGGISIARVPDVLACGVGSIALVSAITRAPDWLAATDTLLQLIEGRHANDA"
FT   CDS_pept        complement(173496..175427)
FT                   /codon_start=1
FT                   /gene_family="HOG000224484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410011"
FT                   /gene_name="thiC"
FT                   /locus_tag="ETAF_0151"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="lyase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="ADM40274.1"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="UniParc:UPI0001BD0620"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T0"
FT                   /transl_table=11
FT                   /translation="MSTLTHRDAPRRQRRAQAQAFIDNLQAQAYPSSQRIYLQGSRADI
FT                   RVPLREISLSPTLIGGTPEQPQWRDNEAIAVYDTSGAYGDPQAEIDLRRGLPAIRSAWI
FT                   AERNDSEILPGRSSDYTRRRQADRDLETLRFEQRSSARRARPGHRVTQLYYARQGIITP
FT                   EMEFIALRENMGRERIRSAVLRQQHPGIAFGAHLPDNITPAFVRDEVAAGRAIIPANIN
FT                   HPESEPMIIGRNFLVKVNANIGSSSVTSSIEEEVEKLVWATRWGADTVMDLSTGRYIHE
FT                   TREWILRNSPVPIGTVPIYQALEKVNGIAENLDWPLVRDTLLEQAEQGVDYFTLHAGLL
FT                   LRFIPMTAERLTGIVSRGGAIMAKWCLSHHQENFLYTHFREICEICSAYDIALSLGDGL
FT                   RPGSIQDANDPAQFAELHTLGELTRIAWEYDVQVMIEGPGHVPMHMIQRNMEEELSHCH
FT                   EAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPDKDDVKQGL
FT                   ITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPVTARAYHDATLPQA
FT                   SGKLAHFCSMCGPKFCSMKISREVREHAARQQAADPGMAQMAQQFRDQGGEIYLADVTD
FT                   SAPSRKES"
FT   CDS_pept        175821..176594
FT                   /codon_start=1
FT                   /gene_family="HOG000247937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410012"
FT                   /gene_name="nudC"
FT                   /locus_tag="ETAF_0152"
FT                   /function="NAD+ diphosphatase activity"
FT                   /function="magnesium ion binding"
FT                   /function="manganese ion binding"
FT                   /protein_id="ADM40275.1"
FT                   /db_xref="GO:0000210"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniParc:UPI0001BD0621"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T1"
FT                   /transl_table=11
FT                   /translation="MAQQLSDSDSGWWVVSDRGRIWLPEGELPYGSAAQWHLVGETAYR
FT                   IGEWQGMPVWLLCLTYPQDMTSVRQLIDADRGLFQLAGRGVQLAEFFQSHRFCGSCGHP
FT                   MHASQQEWARLCAHCQQRYYPQIAPCIIVAIRRDDHILLARHNRHRNGIYTVLAGFVEV
FT                   GETLEQAAAREIFEESRLQVKNLRYVTSQPWPFPHSLMMAFLADYAAGDLCHDPKELQE
FT                   ADWYRYDRLPQLPPAGTVARRLIEDTVALCRAQHE"
FT   CDS_pept        176642..177706
FT                   /codon_start=1
FT                   /gene_family="HOG000253896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410013"
FT                   /gene_name="hemE"
FT                   /locus_tag="ETAF_0153"
FT                   /function="uroporphyrinogen decarboxylase activity "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40276.1"
FT                   /db_xref="GO:0004853"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="UniParc:UPI0001BD0622"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T2"
FT                   /transl_table=11
FT                   /translation="MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYNATRAQAGN
FT                   FIALCKNAELACEVTLQPLRRFPLDAAILFSDILTVPDAMGLGLYFEAGEGPRFTHPVT
FT                   CHADIQRLPIPDPEQELGYVMDAVRTIRRDLRGDVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKIKKMMYSDPAALHLLLDKLAQSVILYLNAQIRAGAQAVMIFDTWGGVLTGRDYREF
FT                   SLRYMHQIVDGLQRESEGRRVPVTLFTKGGGQWLEAMADTGCDALGLDWTCDIADARRR
FT                   VGDRVALQGNMDPSLLYAPPARIEQEVATILAGFGQGEGHVCNLGHGIHPDVPPEHAGV
FT                   FVDAVHRLSVPYHR"
FT   CDS_pept        177721..178407
FT                   /codon_start=1
FT                   /gene_family="HOG000229135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410014"
FT                   /gene_name="nfi"
FT                   /locus_tag="ETAF_0154"
FT                   /function="deoxyribonuclease V activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40277.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0043737"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniParc:UPI0001BD0623"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T3"
FT                   /transl_table=11
FT                   /translation="MDLQALRSEQRARAVQVERADRWEAPVLIAGADVGFEQDGAVTRA
FT                   ALAVLCYPELTLVEYQVARIETQMPYIPGFLSFREYPALLQSWGQLRHRPQLVMVDGHG
FT                   IAHPRRLGIASHFGLLVDVPTIGVAKRRLCGQFAPLDETPGSTVALMDGGEQLGWVLRS
FT                   KARCNPLFISGGHRVSTDSALAWVQRCLRGYRLPEPTRWADAIASRRPAFLRWQSAQPR
FT                   SAVQVE"
FT   CDS_pept        178513..179103
FT                   /codon_start=1
FT                   /gene_family="HOG000283285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410015"
FT                   /locus_tag="ETAF_0155"
FT                   /protein_id="ADM40278.1"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="UniParc:UPI0001BD0624"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T4"
FT                   /transl_table=11
FT                   /translation="MLRNPIHKRLEKLESWQQLTFMACLTERMYPNYQAFCQQSAFGEA
FT                   AVYRRILDLVWELLTVKDVKINFDSQLEKLEAAIPDADAYDMYGVYPAIDACVALSEIL
FT                   HAQLGGEMLAHAIAVSETSLYTVSMLEMTQSGREMSDDELKALPAIQDELDIQWEIYRL
FT                   LSEAEERDLELIKGLRADLREAGVSNIGIELAQ"
FT   CDS_pept        179293..179565
FT                   /codon_start=1
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410016"
FT                   /locus_tag="ETAF_0156"
FT                   /function="DNA binding"
FT                   /protein_id="ADM40279.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniParc:UPI0001BD0625"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T5"
FT                   /transl_table=11
FT                   /translation="MNKTQLIDVIADKADLSKTQAKAALESTLAAITESLKAGDAVQLV
FT                   GFGTFKVNHRNERTGRNPQTGNEIKIAAANVPAFVSGKALKDAVK"
FT   CDS_pept        179627..180283
FT                   /codon_start=1
FT                   /gene_family="HOG000126775" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410017"
FT                   /locus_tag="ETAF_0157"
FT                   /protein_id="ADM40280.1"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniParc:UPI0001BD0626"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T6"
FT                   /transl_table=11
FT                   /translation="MCRRVRGLLPVALLLTGCHSTAPVAPFTATGYIADGGIVRLWRLE
FT                   GAGHQPQAMMRVFTPLDGTETQIDRYTYRDGHLYQIRQQTGQGNDDVLQLRFDMQGSLS
FT                   YMQRLRNGSKEMPGSDEVAKAQYQARHAQEMATTLAAGGVNLIQGRWQGGIFTRCDGQV
FT                   APLPLSGWQAAQLARREANSRGPLWVAWLSAPEGAQLLQVANHNICAWAPTEKTV"
FT   CDS_pept        complement(180318..181595)
FT                   /codon_start=1
FT                   /gene_family="HOG000033463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410018"
FT                   /locus_tag="ETAF_0158"
FT                   /function="ATP binding"
FT                   /function="phosphoribosylamine-glycine ligase activity "
FT                   /biological_process="purine base biosynthetic process "
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /protein_id="ADM40281.1"
FT                   /db_xref="GO:0004637"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="GO:0009113"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniParc:UPI0001BD0041"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T7"
FT                   /transl_table=11
FT                   /translation="MNILIIGSGGREHALAWKAAQSPLAERVFVAPGNAGTALEPALEN
FT                   IDIAATDIDALVAFALRHQVGLTIVGPEAPLVLGVVDAFRAAGLPIFGPSQSAARLEGS
FT                   KAFSKDFLARQRIPTAAYRNFTEVEPALAYVREQGAPIVIKADGLAAGKGVIVAMTREE
FT                   AEAAVHDMLAGNAFGDAGHRIVIEEFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGD
FT                   SGPNTGGMGAYSPAPVVSDAVHQRVMEQVIWPTVRGMAQEGAPYTGFLYAGLMISADGA
FT                   PKVIEFNCRFGDPETQPIMMRMQSDLVALCLAGANGTLDQQSSAWDPRPALGVVLAAGG
FT                   YPGDYRQGDVIHGLTQGTAQAKVFHAGTRLNAQGEVETCGGRVLCATALGEDIAEAQRN
FT                   AYRLADALSWEGGFCRRDIGYRALQR"
FT   CDS_pept        complement(181637..183226)
FT                   /codon_start=1
FT                   /gene_family="HOG000230373" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410019"
FT                   /gene_name="purH"
FT                   /locus_tag="ETAF_0159"
FT                   /function="IMP cyclohydrolase activity"
FT                   /function="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase activity"
FT                   /biological_process="IMP biosynthetic process"
FT                   /protein_id="ADM40282.1"
FT                   /db_xref="GO:0003937"
FT                   /db_xref="GO:0004643"
FT                   /db_xref="GO:0006188"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR013982"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI0001BD0042"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T8"
FT                   /transl_table=11
FT                   /translation="MQHSRPVRRALLSVSDKSGIVEFAQALHLRGVELLSTGGTARLLS
FT                   QAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDRDAAVMQQHGIQPIDMVVVN
FT                   LYPFAQTVARPDCTLEEAVENIDIGGPTMVRSAAKNHNDVAIVVNNGDFDNIIAEMDAH
FT                   HGALTQATRFDLAIKAFEHTAAYDSMIANYFGTLVAPYHGDTQSPSGRFPRTLNLNLIK
FT                   KQDMRYGENGHQQAAFYIEEPQVEACIATAQQLQGKALSYNNIADTDAALECVKSFAEP
FT                   ACVIVKHANPCGVALGDDPLDAYERAYQTDPTSAFGGIIAFNRTLDAKTAQAIIARQFV
FT                   EVIIAPHVTEDALDLLSAKQNVRVLACGEWDARIPGLDFKRVNGGLLVQDRDLGMVDVA
FT                   DLRVVTERQPSEQELRDALFCWKVAKFVKSNAIVYARDNMTVGIGAGQMSRVYSAKIAG
FT                   IKAADEGLPVAGSVMASDAFFPFRDGIDAAAAVGIRCVIQPGGSIRDDEVIAAANEHGI
FT                   AMIFTGMRHFRH"
FT   rRNA            183887..185315
FT                   /gene_name="rrsA"
FT                   /locus_tag="ETAF_3227"
FT   tRNA            185414..185489
FT                   /gene_name="tRNA-Glu"
FT   rRNA            185658..188586
FT                   /gene_name="rrlA"
FT                   /locus_tag="ETAF_3229"
FT   rRNA            188675..188794
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="ETAF_3230"
FT   CDS_pept        complement(189073..189636)
FT                   /codon_start=1
FT                   /gene_family="HOG000224166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410020"
FT                   /locus_tag="ETAF_0160"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40283.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI0001BD0043"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5T9"
FT                   /transl_table=11
FT                   /translation="MHNELANPAPLGLMGFGMTTVLLNMHNAGIFALDAMILAMGIFFG
FT                   GLAQIFAGLLEFRKGNTFGLTAFTAYGAFWLTLVTLLLLPKMGLADAVTPPSLAAYLAL
FT                   WGIFTLFMFFGTLRANRALQFVFASLTLLFFMLAYGNLTGNAGLLHIAGVEGIICGASA
FT                   IYLAMAEVINGQLGRCVLPIGEPR"
FT   CDS_pept        complement(189722..191677)
FT                   /codon_start=1
FT                   /gene_family="HOG000229981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410021"
FT                   /gene_name="acs"
FT                   /locus_tag="ETAF_0161"
FT                   /function="AMP binding"
FT                   /function="ATP binding"
FT                   /function="acetate-CoA ligase activity"
FT                   /protein_id="ADM40284.1"
FT                   /db_xref="GO:0003987"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016208"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001BD0044"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U0"
FT                   /transl_table=11
FT                   /translation="MSQIHTYPVPADIARHAFINAEMYREMYLASVEDPEAFWAEQGQI
FT                   ISWITPYSRVKNTSFDPGHINIRWFEDGTLNLAANCLDRHLAERGEQTAIIWEGDDPQE
FT                   SRRVTYRQLHGEVCRFANVLKSLQVEKGDVVAIYMPMVVEAAVAMLACARIGAVHSVIF
FT                   GGFSPEAVAGRIIDSGAKLVITADEGVRAGRTIPLKRNVDEALQHPQVNSVHHVVVFRR
FT                   TGGAGEWDSGRDRWWHELMAQADEHCPAVEMNAEDPLFILYTSGSTGKPKGVLHSTGGY
FT                   LVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLANGAITLMFEGVPNYPGIN
FT                   RLSQIVDKHQVNILYTAPTAIRALMAEGQRAVADTQRTSLRIMGSVGEPINPEAWEWYY
FT                   HTIGNGHCPIMDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNSGEILEG
FT                   ASEGNLVILDSWPGQARTLFGAHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHSIKGQAIYAYITLNVGEEPSPALY
FT                   AEVRDWVRKEIGPIATPDILHWTDALPKTRSGKIMRRILRKIASGDISNLGDTSTLADP
FT                   GVVEKLLEEKQAMQPR"
FT   CDS_pept        192175..193497
FT                   /codon_start=1
FT                   /gene_family="HOG000208778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410022"
FT                   /locus_tag="ETAF_0162"
FT                   /function="sodium:dicarboxylate symporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40285.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017153"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="UniParc:UPI0001BD0046"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U1"
FT                   /transl_table=11
FT                   /translation="MMKRFTLTLAWQIVIALILGIAVGAALHDQTESRQWLVSNVLGPA
FT                   GDIFIRLIKMIVIPIVISTLIVGIAGVGDAKKLGRIGLKTILYFELITTVAIVVGITLA
FT                   NLFQPGLGVDMSHLAAVDISQYERTTEQVQSGAHSLVGTLLALIPANLFSAMAKGEILP
FT                   IIFFSVLFGLGLSSLPADHKEPLLRVFRAVSESMFKVTHMIMRYAPIGVFGLISVTVAN
FT                   FGFASLIPLAKLVLLVYAAILFFALVVLGTVARLCHLRIWTLIVILKDELILAYSTASS
FT                   ETVLPRIMEKMEAYGAPKSITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIQLSLGQ
FT                   EIILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNV
FT                   VGNALAVLVVAKWEHQFDRTKAHAYEARMHTPQGVAQQDLL"
FT   CDS_pept        complement(193572..194999)
FT                   /codon_start=1
FT                   /gene_family="HOG000283506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410023"
FT                   /locus_tag="ETAF_0163"
FT                   /function="transporter activity"
FT                   /biological_process="protein transport"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ADM40286.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniParc:UPI0001BD0047"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U2"
FT                   /transl_table=11
FT                   /translation="MKKLLPLLIGLSLSGFSALSQAENLMQVYQQAKESNPDLRQAAAN
FT                   RDAAFEKINESRSPLLPQLGLGADYTYTNGFRDSSGLNSNNYGASLALTQTIFDMSKWR
FT                   QLSLTEKQAGIQDVSYQSSEQTLMLNTATAYFNVLRAIDQLTYTEANKQAIYNQLDQTT
FT                   QRFNVGLVAITDVQNARAQYDQVLAQEVSARNNLDNSLEALRQITGQYYPQLSALNIDR
FT                   FSTKRPDDVKALLQEAEKRNLQLLSARLSQDLARQQIKYAETGYMPTLNLTASTGVSNT
FT                   DYNSLSNAQKETLRGGNGSSYQGQNTVGLSFNLPLYSGGATNSQVKQAQYNFVGASEAL
FT                   DSAHRSVVQNVRSSFNNISAAISGVSAYKQAVVSAQSSLDATQAGYQVGTRTIVDVLNA
FT                   TTALYNAKQNLANARYDYLISQLNIKYALGTLNQNDLLALNGDLSKPVPTAADSIAPDD
FT                   AAQAAKANGPIPGGGVR"
FT   CDS_pept        195215..195844
FT                   /codon_start=1
FT                   /gene_family="HOG000045857" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410024"
FT                   /locus_tag="ETAF_0164"
FT                   /function="ADP-ribose diphosphatase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ADM40287.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0047631"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI0001BD0048"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U3"
FT                   /transl_table=11
FT                   /translation="MCVDKPSPVTFGKDDVEIIARETCYRGFFSLDRYRFRHRLFNGEM
FT                   SGEVVREVFERGHAAVLLPYDPRRDEVVLIEQLRMPAYTSSRTPWLLEMVAGMIEVGES
FT                   VEQVARREAQEEAGITVGRCQPVLSYLASPGGTSERLSIVVGEVDAATASGVHGLAEEH
FT                   EDIRVHVVSREQAYRWVEQGVIDNAASVIALQWLALNHSRLRAQWA"
FT   CDS_pept        196271..197098
FT                   /codon_start=1
FT                   /gene_family="HOG000238351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410025"
FT                   /locus_tag="ETAF_0165"
FT                   /function="3',5'-cyclic-nucleotide phosphodiesterase
FT                   activity"
FT                   /protein_id="ADM40288.1"
FT                   /db_xref="GO:0004114"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR013622"
FT                   /db_xref="UniParc:UPI0001BD0049"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U4"
FT                   /transl_table=11
FT                   /translation="MESLFHLAVASGAPVRILQITDTHLFAGQQETLLGVNTYRSYQAV
FT                   LAAIRAEAHPFDLIVATGDLAQDHSAAAYQHFAAGVAALHRPCLWLPGNHDFQPAMVDA
FT                   LAQAGVHANKRALLGDRWQIVLLDSQVVGVPHGELSDYQLEWLEQTLASEPQRHTMLLL
FT                   HHHPLPSGCTWLDQHSLRNAHALDEILRRYPQVNTLVCGHIHQELDLDWNGCRLLATPS
FT                   TCVQFKPLCTNFTIDTISPGWRYLTLYPDGRVTTAVHRLASSEFRPDLDADGY"
FT   CDS_pept        197101..197682
FT                   /codon_start=1
FT                   /gene_family="HOG000256044" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410026"
FT                   /locus_tag="ETAF_0166"
FT                   /protein_id="ADM40289.1"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="UniParc:UPI0001BD004A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U5"
FT                   /transl_table=11
FT                   /translation="MPTLLYLHGFNSSPRSAKATALQRWLAEYHPQITMLIPQLPPYPA
FT                   DAAQMLEELVMERAGRPLGLVGSSLGGYYATWLSQCFTLPAVVINPAVKPFELLLDFLG
FT                   QNENPYTGQQYVLESRHVFDLKVMQVDPLESPDLIWLLQQTGDEVLDYRQAVTYYTPCR
FT                   QTIEEGGNHAFVGIERFFPQIIDFLGLSAE"
FT   CDS_pept        complement(197651..197785)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410027"
FT                   /locus_tag="ETAF_0167"
FT                   /protein_id="ADM40290.1"
FT                   /db_xref="UniParc:UPI0001BD004B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U6"
FT                   /transl_table=11
FT                   /translation="MIRKSRCLSIRWEKQGRPLAHPLLYPPVGIGRWRAIPRSAPKSL"
FT   CDS_pept        197789..199684
FT                   /codon_start=1
FT                   /gene_family="HOG000075154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410028"
FT                   /locus_tag="ETAF_0168"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /biological_process="DNA topological change"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ADM40291.1"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001A9328B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U7"
FT                   /transl_table=11
FT                   /translation="MTQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNSV
FT                   DEALAGHATRIEVILHPDQSLEVIDNGRGMPVDIHPEEGVPAIELILCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSRRVEVSVRRDGQIYQMAFENGEKVEDLHVSGTVGRRNTG
FT                   TSVHFWPDAQFFDSARFSVSRLTHLLKAKAVLCPGVEILFRDLVNGSEQRWCYQDGLTD
FT                   YLMESVNGLVTLPEQPFTGTFASDTEAVDWALLWLPEGGELLTESYVNLIPTPQGGTHV
FT                   NGLRQGLLDAMREFCEFRNLLPRGVKLTADDIWERCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQSAELLAELAINSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCSAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSDDLSQLRYGKICILADADSDGLHIATLLCALFVRHFRPLVQA
FT                   GHVYVAMPPLYRIDLGKEVFYALSEEEKAGVLEQLKRKKGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLTIEDEDMERTVAVMDMLLAKKRAEDRRNWLQENGNLAELDV"
FT   CDS_pept        199870..202146
FT                   /codon_start=1
FT                   /gene_family="HOG000076277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410029"
FT                   /locus_tag="ETAF_0169"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ADM40292.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI0001BD004C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U8"
FT                   /transl_table=11
FT                   /translation="MSDLTHDNSERVALHAFTEDAYLQYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLSASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSRYAEILLSELGQGTVDYVANFDGTLQEPKFLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNAREVAAALVALLDNPQSSLDDLLTHIQGPDFPTE
FT                   AEIITPRDEIRKIYRTGRGSVRMRAVWRKEESEIVISALPHQTSGAKVLEQIASQMRAK
FT                   KLPMVDDLRDESDHENPTRLVIVPRSNRVDLDQLMNHLFATTDLEKSYRINMNMIGLDR
FT                   RPAVKDLREILSEWLSYRRETVRRRLNYRLEKVLKRLHILEGLLCAFLNIDEVIHIIRS
FT                   EDEPKPVLVARFGLSDTQAEAILELKLRHLARLEEVKIRGEQDALAQERDRLQTLLASE
FT                   RKLGTLIKKEIMADAETYGDARRSPLQERSEARAMSEHDFVPSEPVTIVLSEGGWVRSA
FT                   KGHDIDPSGLNYKAGDAFRAAARGKSNQPVVFIDSSGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGATIEHVLMAADNQKLLMASDAGYGFVCTFSDLVARNRAGKAMLTLPENAKVL
FT                   TPLEINGDDDMLLAITEAGRMLMFPVHDLPQLSKGKGNKIVSIPAAQAAAGEDTLKWLL
FT                   VLAPQTSLTLHVGKRKLVMKPQDLQKFRAERGRKGTLLPRGLQRIERVDVDAPQSLRLD
FT                   ADGDA"
FT   CDS_pept        202237..202980
FT                   /codon_start=1
FT                   /gene_family="HOG000026378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410030"
FT                   /locus_tag="ETAF_0170"
FT                   /function="1-acylglycerol-3-phosphate O-acyltransferase
FT                   activity"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40293.1"
FT                   /db_xref="GO:0003841"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniParc:UPI0001BD004D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5U9"
FT                   /transl_table=11
FT                   /translation="MLFIFRVILITLLCLVICIVGSLYCLFSPRNPRHVARFGHWFGRL
FT                   SPLFGLKVETRLPPDAATYGNAIYIANHQNNYDMVTASNAVQPNTVTVGKKSLAWIPFF
FT                   GQLYWLTGNLLIDRKNRTKAHNTIAAVVEQFRTRRISFWMFPEGTRSRGRGLMPFKTGA
FT                   FHAALAAGVPIVPICVSSTHDKVKLNRWNNGVVIVEMLPPIDTSRWGKDQVRELAEHCR
FT                   TLMAKKIEQLDAEVAAREAQAGKRA"
FT   CDS_pept        203029..204447
FT                   /codon_start=1
FT                   /gene_family="HOG000096435" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410031"
FT                   /locus_tag="ETAF_0171"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell division"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40294.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001BD004E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V0"
FT                   /transl_table=11
FT                   /translation="MSLSRRRFIQASGLALCAGGLPLQARASGAQAVLPVPPLLESRRG
FT                   QPLFLSLERTHWAFMGGRKVGTWGVNGVYLGPTVRVHSGDDVKLIYSNRLSESVAMEVA
FT                   GLLVPGPLAGGPARQMSPGVDWSPVLPIRQAAATLWYHADTPRHMAPQVYSGLAGLWLV
FT                   EDQYSKNAPLPNHYGVDDFPLILQDKRLDNFGVPEYDPPSSGGFLGDTLLVNGVQDPYV
FT                   EVSRGWVRLRLLNASNARRYLLQLSDGRPFFVIASDQGLLPAPLQADTLPLAPGERREV
FT                   LIDMSKGEEISITAGEAAGIMDRLRGLFEPSSMLVSTRVLTLRPTGLLPLMTDTLPARL
FT                   AADPLPEGDVVNNRSIMLGSASSPGINGALWDPGRIDVQARQGTWERWTVRADTPQSFY
FT                   IQGAQFLVKSVNNAPPLVEDRGWKDSVWVDGEVSLLVYFPQPSSEHFPFLFYSGTLELA
FT                   DRGSVGQMVVQPAQ"
FT   CDS_pept        204731..208414
FT                   /codon_start=1
FT                   /gene_family="HOG000251409" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410032"
FT                   /locus_tag="ETAF_0172"
FT                   /function="cobalamin binding"
FT                   /function="homocysteine S-methyltransferase activity "
FT                   /function="methionine synthase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="pteridine-containing compound
FT                   metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADM40295.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008705"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="GO:0031419"
FT                   /db_xref="GO:0042558"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="UniParc:UPI0001BD004F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V1"
FT                   /transl_table=11
FT                   /translation="MNTTLERLRRRLEKRILVLDGGMGTMIQRYGLSEQDFRAERFADW
FT                   PCDLKGNNDLLALTRPDIISAIHYAYLEAGADILETNTFNATRIAMADYRMEALAPEIN
FT                   YRAACLARACADEWTARTPHQPRFVAGVLGPTNRTASISPEVNDPACRNITFDQLVAAY
FT                   RESARALIEGGVDLLMIETVFDTLNAKAAVYALECEFAALGVTLPVMISGTITDASGRT
FT                   LSGQTTEAFYNALRHARPLSFGLNCALGPEDLRQYVAELSRVAECHVSAHPNAGLPNAF
FT                   GEYDLSPQAMAQQIAEWARAGYLNIVGGCCGTTPEHIAAISRAVQGITPRALPTLPVAC
FT                   RLSGLEPLTIDETSLFVNVGERTNVTGSAKFKRLIKENKYDEALDVARQQVASGAQIID
FT                   INMDEGMLDAEAAMVRFLNLIAGEPDIARVPLMIDSSRWSVIEAGLKCIQGKGIVNSLS
FT                   LKEGEANFLEHARQVRRFGAALVVMAFDEQGQADTRERKVAICRRAYQLLTERIGFPPE
FT                   DIIFDPNIFAVATGIEEHSNYAVDFIASCAEIKAQLPHALISGGVSNVSFSFRGNEAVR
FT                   EAIHAVFLYHAIRHGMDMGIVNAGQLAIYDDLPDDLRTAAEAVILNQSPDATDRLLALA
FT                   ERYRDTQGSAQAEAQQAEWRSWPVAQRLEYALVKGIGEFIAQDTEAARLEADRPIAVIE
FT                   GPLMAGMNRVGDLFGDGKMFLPQVVKSARVMKQAVAYLSPFIEASKQRGSSAGKVLLAT
FT                   VKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPAERILRVAREERVDIIGLSGLITPSLD
FT                   EMVNVASEMERQGFTLPLLIGGATTSKAHTAVKIAPAYGGPTVYVQNASRTVGVVAALL
FT                   SEAQRGPFIDRTRREYEAARAQHGRQTPRTPPVTLAQARANGVVTDWSACPPPVPLRLG
FT                   VQTVQPGIARLRDYIDWTPFFLTWSLAGKYPRILQDEVVGEEARRLLADANGLLDRLEA
FT                   SGSLTPRGVFGLFAANRRGDDVLIYRDESRREVLAVSHHLRQQSDKRVGPNYCLADFVA
FT                   AADEGIADYIGAFAVTGGLEEEALAQAFDAQHDDYHKIMVKALADRLAEAFAEYLHQQV
FT                   RKVHWGYAADEALDNEQLIRENYRGIRPAPGYPACPEHSEKATLWRLLDVERHTGMRLT
FT                   ESYAMWPGASVSGWYFSHPHSKYFAVARVQRDQVADYAARKGMTLAEAERWLAPNLGYE
FT                   VA"
FT   CDS_pept        complement(208462..209811)
FT                   /codon_start=1
FT                   /gene_family="HOG000293094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410033"
FT                   /locus_tag="ETAF_0173"
FT                   /function="amino acid binding"
FT                   /function="aspartate kinase activity"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /protein_id="ADM40296.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniParc:UPI0001BD0050"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V2"
FT                   /transl_table=11
FT                   /translation="MQQTIIAKFGGTSVADADAMLRCADIILSNPAVRVVVLSAAAGVT
FT                   NHLIALAEGQEAAERLRLIGEVRRIHDAILAALPDGVVVRSEIERMLENIAMLAEAAAL
FT                   ATSAALTDELVSHGELMSTLLFSELLRVRGVSVEWFDIRRIMRTDDRFGKAEPDREQLQ
FT                   ALAQQSLAPRLTTHLIITQGFIGSERKGRTTTLGRGGSDYTAALLAEALDAARVDIWTD
FT                   VPGIYTTDPRIVPAARRIDEIAFSEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSRD
FT                   PGAGGTLVCNKSAQPPLFRALALRRSQTLLTLHSLNMLHARGFLAEVFGILARHRISVD
FT                   LITTSEVSIALTLDTTGSCTGGASLLTSALLTELSAQCRVEVEEDLALVALIGNQLSSA
FT                   CGVGRQVFGAMEPFNIRMICYGASSHNLCFLVPGNDADAVVRTLHARLFE"
FT   CDS_pept        209812..210108
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410034"
FT                   /locus_tag="ETAF_0174"
FT                   /protein_id="ADM40297.1"
FT                   /db_xref="UniParc:UPI0001BD0051"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V3"
FT                   /transl_table=11
FT                   /translation="MMPRVRGRCPCCPAGQSISPAPGALNGTGRRMRAPQVLHLTVPST
FT                   EAGGRGDSPRGCPEGRCALARRSGAALLKGDAGGGVPPRFAQTGLYTGCTGHF"
FT   CDS_pept        210635..212284
FT                   /codon_start=1
FT                   /gene_family="HOG000261370" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410035"
FT                   /gene_name="pgi"
FT                   /locus_tag="ETAF_0175"
FT                   /function="glucose-6-phosphate isomerase activity "
FT                   /biological_process="gluconeogenesis"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40298.1"
FT                   /db_xref="GO:0004347"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="UniParc:UPI0001BD0053"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V4"
FT                   /transl_table=11
FT                   /translation="MKNINPTRTAAWQALQQHFEQMKSVQMRDLFAADADRFSKFSATF
FT                   DDQMLVDYSKNRINAETLEKLQALARETDLQGAIAAMFAGEKINRTEDRAVLHIALRNR
FT                   SNTPIYVDGKDVMPEVNAVLAKMKQFCVRVIDGEWRGYTGKTITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLAMHFVSNVDGTHIAETLQRLNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLQAAGDERHVAKHFAALSTNAQAVAAFGIDTANMFEFWDWVGGRYSLWSAIGLSI
FT                   ALSIGYDNFEQLLAGAHAMDRHFASAPLQQNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFPAYFQQGNMESNGKYVDRNGQAVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLI
FT                   PCDFIAPAISHNPLGDHHSKLLSNFFAQTEALAFGKSREAVEEEFAKAGKSAAEVQHIV
FT                   PFKVFEGNRPTNSILLREITPYSLGMLIALYEHKIFTQGAILNIFSFDQWGVELGKQLA
FT                   NRILPELEDAQPVRSHDSSTNALINRFKAWRA"
FT   CDS_pept        complement(212345..213592)
FT                   /codon_start=1
FT                   /gene_family="HOG000285888" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410036"
FT                   /locus_tag="ETAF_0176"
FT                   /function="sodium:dicarboxylate symporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40299.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017153"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniParc:UPI0001BD0054"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V5"
FT                   /transl_table=11
FT                   /translation="MHILRHYTFTLCLLLGIILGGLAGILFGERATLVQPIGELFLNLM
FT                   FVVIVPLVFLSIASSIADMRQMSRLGKIMGTVFSVFIATALFAALIGFVATHLFNPFHN
FT                   VDTQSLIAHLPPAPQEQSKGLGEVIVSTFTVPDFLQLFTKSNLLPLIVFSILFGLATAF
FT                   SGEQGRPVAQFLSAGTTVILRMVKIIMYAAPLGLGCYFAATVGALGPQIIHGYLNAFLL
FT                   YVVLTVIYFFGANTLYAFIAGGRPAVRLFWGNVFTPAITAIATASSAACIPVNLVASKK
FT                   MGVPADIAETVIPLGANTHKDGSVIGGIIKIVFLFTLFGRDMSDPMSIAAIISVAFLVG
FT                   AVMGAIPSGGMTGELMICAVFGFSPELVGTIMIISTIIDIPATLLNSTGNTVCAMLVTR
FT                   FVEGKAWLQRQWETAE"
FT   CDS_pept        213649..213789
FT                   /codon_start=1
FT                   /gene_family="HOG000156607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410037"
FT                   /locus_tag="ETAF_0177"
FT                   /protein_id="ADM40300.1"
FT                   /db_xref="UniParc:UPI0001BD0055"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V6"
FT                   /transl_table=11
FT                   /translation="MILADYANYLPLSPPAPNLCDARRAACDVGGFLAPGDRRQNGNIV
FT                   N"
FT   CDS_pept        213826..214233
FT                   /codon_start=1
FT                   /gene_family="HOG000235923" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410038"
FT                   /gene_name="psiE"
FT                   /locus_tag="ETAF_0178"
FT                   /biological_process="cellular response to phosphate
FT                   starvation"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40301.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016036"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniParc:UPI0001A59A57"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V7"
FT                   /transl_table=11
FT                   /translation="MPGTERANRVATVLQWILNIGLMALAAILVIFLAKETFTLAGVLF
FT                   DANQNASTYMLVEGIVIYFLYFEFIALIVKYFQSGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ESPNDTLIYSFAILVLVIALYLANTDRLKRE"
FT   CDS_pept        complement(214322..215212)
FT                   /codon_start=1
FT                   /gene_family="HOG000220526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410039"
FT                   /gene_name="malG"
FT                   /locus_tag="ETAF_0179"
FT                   /function="transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40302.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniParc:UPI0001BD0056"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V8"
FT                   /transl_table=11
FT                   /translation="MAMVQPQSLRYRLWLTHLLMILFIALIMFPLLMVIAISLRAGNFA
FT                   TGSLIPDQISWEHWKLALGISVTAPDGRVTPPPFPVLLWLWNSIKVAVTTALGILTLST
FT                   TCAYAFARMRFRGKSSLLKGMLIFQMFPAVLSLVALYALFDRIGQYVPFLGLNTLGGVI
FT                   FAYMGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNTYTLAVGMQQYLNPQNYLWGDFAAAAVLSAMPITAVFLLA
FT                   QRWLVGGLTAGGVKG"
FT   CDS_pept        complement(215227..216798)
FT                   /codon_start=1
FT                   /gene_family="HOG000239267" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410040"
FT                   /gene_name="malF"
FT                   /locus_tag="ETAF_0180"
FT                   /function="transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40303.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniParc:UPI0001BD0057"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5V9"
FT                   /transl_table=11
FT                   /translation="MSLSQTEYPASEPRRLCPRTGLKWLAVGLLTLLTGYLTIVMYAQG
FT                   EYLFAMLTLILLGGGLYIFANRRAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSST
FT                   NQLSQERAQSVLLQRMFTSGQTYAFSLYPDGDQWRLQLTDAQNGQRYLSGPFTLSQSDL
FT                   QISMAPADGAPQGSAATLRTVTQHRQTLNSLVALLPDGAALRMSSLRQFAASRPLYTLG
FT                   DDGRTLTDNQSGIAYRPNMQSGFYQAVNADGNWRSERLSPGFTVTTGWKNFLRVLDDEG
FT                   IRQPFISIFIWTLVFSVLTVIFTVAVGMVLACVVQWEALRGRAAYRVLLILPYAVPAFI
FT                   SILIFKGLFNQSFGEINMMLSQLFGIRPAWFSDPLTAKCMILIVNTWLGYPYMMILCMG
FT                   LLKAIPEDLYEASAMDGAGPLQNFFRITLPMLIKPLTPLMIASFAFNFNNFVLIQLLTN
FT                   GGPDMLGTSTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAILNLKA
FT                   SKMNFD"
FT   CDS_pept        complement(216936..218129)
FT                   /codon_start=1
FT                   /gene_family="HOG000055250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410041"
FT                   /gene_name="malE"
FT                   /locus_tag="ETAF_0181"
FT                   /function="maltose transmembrane transporter activity "
FT                   /function="structural molecule activity"
FT                   /cellular_component="viral capsid"
FT                   /protein_id="ADM40304.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005363"
FT                   /db_xref="GO:0019028"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniParc:UPI0001BD0058"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W0"
FT                   /transl_table=11
FT                   /translation="MTKTSAIKTIALSALAALVISAPALAKIEEGKLVIWINGDKGYNG
FT                   LADVGKKFEQETGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAE
FT                   IHPSKAFQEKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKSWEEIPALDS
FT                   KLRAQGKSAIMWNLQEPYFTWPLIAADGGYAFKYANGRYETNNVGVDNAGSRAGLQFLV
FT                   DMVKNKHINADTDYSIAEAAFNKGQTAMTINGPWAWSNIDKSGINYGITLLPTFKGHPS
FT                   KPFVGVLSAGINAASPNKELATEFIENYLLTDSGLAMVNQDKPLGAVALKSYQEILEKD
FT                   PRIAATMQNSQNGEIMPNIPQMSAFWYAERAAIINAINGRQSVTQALESAKERILKK"
FT   CDS_pept        218184..218333
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410042"
FT                   /locus_tag="ETAF_0182"
FT                   /protein_id="ADM40305.1"
FT                   /db_xref="UniParc:UPI0001BD0059"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W1"
FT                   /transl_table=11
FT                   /translation="MAAYRTLRSWGYRRVPAGRRGQERRCCVIVRESRPILILPRSTPC
FT                   GAFL"
FT   CDS_pept        218613..219722
FT                   /codon_start=1
FT                   /gene_id="IGI22410043"
FT                   /gene_name="malK"
FT                   /locus_tag="ETAF_0183"
FT                   /function="ATP binding"
FT                   /function="maltose-transporting ATPase activity "
FT                   /cellular_component="ATP-binding cassette (ABC) transporter
FT                   complex"
FT                   /protein_id="ADM40306.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015423"
FT                   /db_xref="GO:0043190"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001BD005B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W2"
FT                   /transl_table=11
FT                   /translation="MANVSLRNVYKAYGEAVISRDINLDIEDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELQIAGVRMNDVPPAKRGIGMVFQSYALYPHLSVADNMSFGLKLAG
FT                   VNKAEIQRRVNQVAEILQLAHLLDRRPKALSGGQRQRVAIGRTLVAEPDVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLQRTMIYVTHDQVEAMTLADKIVVLDAGRIAQVGKPLALY
FT                   HYPADRFVAGFIGSPKMNFLPVKVSEAQPQRVRVELPNGQHIWLPVAGEGLRPGSNLSL
FT                   GIRPEHLVPSAAADVTLSGEVQVVEQLGNETQIHIQIPALRQNLVYRQNDVVLVDEGAT
FT                   LAIGLPAERCHLFREDGSACQRLYQEPGV"
FT   CDS_pept        219790..221067
FT                   /codon_start=1
FT                   /gene_family="HOG000218083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410044"
FT                   /locus_tag="ETAF_0184"
FT                   /function="porin activity"
FT                   /function="sugar:hydrogen symporter activity"
FT                   /cellular_component="cell outer membrane"
FT                   /cellular_component="plasma membrane"
FT                   /cellular_component="pore complex"
FT                   /protein_id="ADM40307.1"
FT                   /db_xref="GO:0005351"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0009279"
FT                   /db_xref="GO:0015288"
FT                   /db_xref="GO:0046930"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="UniParc:UPI0001BD005C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W3"
FT                   /transl_table=11
FT                   /translation="MMNMRKLPLALAVASVVLSAQAMAVDFHGYARSGIGWSSKGGDQK
FT                   CFQADGAGSKYRLGNECDTYAELKLGQELWKSGDQSFYLDTNVAYGIDQANDWESTSPA
FT                   FREINVQGKNVITWLPGSTLWAGKRYYQRHDVHMIDFYYWDISGPGAGLENIDLGFGKL
FT                   SLAVTRNTESGGSYSYFVNQSNEKYIRNTANDVYDIRLAGLQTNPGGSLELGFDYGRAN
FT                   LDDGYHLAPGATKDGYMFTAEHTQSLWGGFNKFVVQYATDAMSNTNNAGHSSGSSVNND
FT                   GHLIRVLDHGAMDFNDKWGLMYVAMYQDVDHDVQNGSTWYTAGVRPMYKWTPTMSTLFE
FT                   AGYDNVKSQKTGARNELYKLTLAQQWQAGDSVWSRPAIRIFATYANGKNNWNTDKDGIQ
FT                   VNTQPGDIRAEGVPGWSFGAQMEAWW"
FT   CDS_pept        221164..222069
FT                   /codon_start=1
FT                   /gene_family="HOG000126874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410045"
FT                   /gene_name="malM"
FT                   /locus_tag="ETAF_0185"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="periplasmic space"
FT                   /protein_id="ADM40308.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0042597"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniParc:UPI0001BD005D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W4"
FT                   /transl_table=11
FT                   /translation="MMKTALNRLSRGVLLACALCSAPQAFADTLLPTDVAAAPELSHTA
FT                   LQALRWQPLTPPVDTTITLGPDSQTLAQGDIQGAVAALALPANRGSLEITLSSRLHNKR
FT                   LYVPNVLVLDQHLRPAAYYPGSYFTYRQPGVMSGDRLEGTLKLTPVLGQQQIYLLIYTT
FT                   RQDLATTTRMVNPAKAYAAGVGNAVPDIPDPQAAHASQGGLSIQARVERQSGNVMIGGL
FT                   LPGGDTPADVAVGSPASAAAVAAPATPMLDDTAAYFDRSIRSAVRQGDIDKALRLMNEA
FT                   QRLGSTTARETFIRSVKGKG"
FT   CDS_pept        222326..222838
FT                   /codon_start=1
FT                   /gene_family="HOG000137785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410046"
FT                   /gene_name="ubiC"
FT                   /locus_tag="ETAF_0186"
FT                   /function="chorismate lyase activity"
FT                   /biological_process="pyruvate biosynthetic process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40309.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0008813"
FT                   /db_xref="GO:0042866"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="UniParc:UPI0001BD005E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W5"
FT                   /transl_table=11
FT                   /translation="MYGMAEHSAALANIDWQPLADAAAPADYGSWLAEQGSMTRRLEQR
FT                   CDRLQVTVLREGPVDATQLSDDERGQLSPCAQYWLREVILLGDGIPWLFGRTLTPSSTL
FT                   QGEGEALRRLGNTPLGRYLFSGVALERESLRVGCLGPLWARRSRLRVAGQPLLLTELFL
FT                   ADAPIYG"
FT   CDS_pept        222864..223727
FT                   /codon_start=1
FT                   /gene_family="HOG000003696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410047"
FT                   /gene_name="ubiA"
FT                   /locus_tag="ETAF_0187"
FT                   /function="4-hydroxybenzoate octaprenyltransferase activity"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40310.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0008412"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="UniParc:UPI0001BD005F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W6"
FT                   /transl_table=11
FT                   /translation="MEGCVTQSKWLAYCRLMRIDKPIGSLLLLWPTYWALWLAGGAAPG
FT                   GKLLLVFTCGVFFMRAAGCVINDFADRHFDGHVKRTCQRPLPCGALSEREAKTLFVLLV
FT                   ALSFALVLTLNAMTIWLSVAALTLAWLYPFMKRFSHLPQVILGMAFGWSIPMAYAAVGE
FT                   SLPLSCWLLFVANICWTVAYDTQYAMVDRDDDLRIGIKSTAILFGRYDRLMIGLLQFAT
FT                   LLLLLWVGDLNQLQGAYYWGVLLAAALFVYQQRLIARRARTSCFRAFMNNNYVGLILFL
FT                   GILLAL"
FT   CDS_pept        224016..225692
FT                   /codon_start=1
FT                   /gene_family="HOG000058265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410048"
FT                   /locus_tag="ETAF_0188"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ADM40311.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001BD00A7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W7"
FT                   /transl_table=11
FT                   /translation="MSVDNSVPTPRDGERRAADVRPGFFSKARIIARPGFNRWLVPPAA
FT                   LAIHLCIGMAYGFSVFWLPLSQALGDGAARACPAPMSAWQELFTTQCDWRISMLGWTYT
FT                   LFFIFLGCSAALWGSWLEKAGPRKVGVVAACCWCGGLMFSALGVYLHQLWMLWLGSGVI
FT                   GGIGLGLGYISPVSTLIRWFPDRRGMATGLAIMGFGGGAMVGAPLANSLMHFYAAAGGV
FT                   GVWQTFLTLALIYWVFMLSGALAYRIPPIGWRPQGMAAATATPAARGFTHVEVHVSVAC
FT                   RTPQFWLVWAVLCLNVSAGIGIIGMASPLLQEVFAGRLLGGSQTFAELSSAQLAQIAAI
FT                   AAGFTGLLSLFNIGGRFFWASLSDRIGRKRTFFLFFTLGVALYSLLPTLGALGSVTLFV
FT                   LAFCLIVSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWSAAGILGPVLVNYLREYQ
FT                   LSRGVARAQAYSETLYILAGLLLVGLVCNLLIRPVDRRHSMSEAQLAQARSLYKVNPNA
FT                   QLSWAADAGSRPWVALSWLAVGLPLLWGCWITLLQAGQLFG"
FT   CDS_pept        complement(225750..228206)
FT                   /codon_start=1
FT                   /gene_family="HOG000218231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410049"
FT                   /gene_name="plsB"
FT                   /locus_tag="ETAF_0189"
FT                   /function="glycerol-3-phosphate O-acyltransferase activity "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40312.1"
FT                   /db_xref="GO:0004366"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="UniParc:UPI0001BD00A8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W8"
FT                   /transl_table=11
FT                   /translation="MSGWRKIYYKLLNLPLKLLVKSKVIPTDPVAELRLDTTRPVFYVL
FT                   PYNSKADLLTLRDRCLALDLPDPLDDNEIDGVILPRYVFIDDGPRVFRYYAPKQASVKL
FT                   FLDYLDLHRGNPALDIQMIPVSVMFGRAPGREDHKGAPQLRLLNGIQKFFAVLWLGRDS
FT                   FVRFSNTVSLRYMADEHGTDKTIAQKLARVARMHFSRLRLAAVGPRLPDRQALFNKLLG
FT                   SKAIEKAVEDEARSKKISREKAQQNAVALMEEIAADFTYEAVRLSDRVLSWTWNRLYQG
FT                   INVHNAERVRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPA
FT                   GPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFSRGYSVEYFMEGGRSRTGRLLEPKT
FT                   GTLAMTLQAMLRGGKRPITLVPVYIGYEHVMEVATYAKELRGATKEKESLPQMVRGLRK
FT                   LRNLGQGYVNFGEPISLNVWLNQHVPEWREAIDPIEAQRPHWLTPSVNSIAGEVMVNIN
FT                   KAAAANAMNLCATALLASRQRALTREQLLEQLECYLQLLRNVPYAPDATLPQRTPQELL
FT                   DHALQMNKFEVEKDNIGDLIILPREQAVLMTYYRNNIQHMLVLPSLVASMVIHHRQISR
FT                   GELLRQAAVIYPMLKQELFMHYAPETLPQVLSPVIDELCRQQLISLQDDTLSINPPRIR
FT                   ALQLLAAGVRETLQRYAITFSLLSANPSISRGALEKESRILAQRLSVLHGINAPEFFDK
FT                   AVFATLVTTLRAEGYINDVGDAVREQTLEIYNLLADLLTPEIRLTIESVSIAALEDASG
FT                   ASDGAA"
FT   CDS_pept        228299..228694
FT                   /codon_start=1
FT                   /gene_family="HOG000014819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410050"
FT                   /locus_tag="ETAF_0190"
FT                   /function="diacylglycerol kinase activity"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40313.1"
FT                   /db_xref="GO:0004143"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="UniParc:UPI0001BD00A9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5W9"
FT                   /transl_table=11
FT                   /translation="MPANAHRYGLSMNSTTGLTRIIKAAGYSIKGLQAAWRHEAAFRQE
FT                   SLLLAAAVALACWLDVTAVERILLIGSVTLVVILEILNSAIEAVVDRIGSERHELSGRA
FT                   KDMGSAAVFVALWLALFVWVSILWTHW"
FT   CDS_pept        complement(228817..230274)
FT                   /codon_start=1
FT                   /gene_family="HOG000117911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410051"
FT                   /locus_tag="ETAF_0191"
FT                   /function="transporter activity"
FT                   /biological_process="sodium ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40314.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006814"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniParc:UPI0001BD00AA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X0"
FT                   /transl_table=11
FT                   /translation="MSKEKIGKLLAPLVVMGIMFMIPVPDGMPPQAWHYFAVFVAMIVG
FT                   MILEPIPATAISFIAVTIVVIGNQFLLFDAKELADPAFNASKQALKWGLAGFSSTTVWL
FT                   VFGAFIFALGYEVSGLGRRIALLLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTARTGG
FT                   TVFPVIKNLPPLFDSHPNDPSSRRIGSYLMWMMVISTSISSSMFVTGAAPNVLGLEFVS
FT                   KIAGIQISWMQWFLGFLPVGLLLLIVAPWLSYVLYKPTVTHSEQVATWAGSALKEMGAL
FT                   TRREITLICLVLLSLALWVFGDDFINATAVALLAVALMLALHVVPWKDVTKYSGAWNTL
FT                   VNLSTLVVMANGLTRSGFIEWFAKTMSTHLAGFSPTATVIALVLVFYFAHYLFASLTAH
FT                   TATMLPVILAVAQSIPGVPMDQLCLLLVLSIGLMGCLTPYATGPGIIIYGCGYVKSQDY
FT                   WRLGAIFGVIYIAALLGIGWPIMAMWN"
FT   CDS_pept        complement(230304..231215)
FT                   /codon_start=1
FT                   /gene_family="HOG000258582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410052"
FT                   /gene_name="citG"
FT                   /locus_tag="ETAF_0192"
FT                   /function="ATP binding"
FT                   /function="triphosphoribosyl-dephospho-CoA synthase
FT                   activity"
FT                   /biological_process="phosphorylation"
FT                   /protein_id="ADM40315.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016310"
FT                   /db_xref="GO:0046917"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniParc:UPI0001BD00AB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X1"
FT                   /transl_table=11
FT                   /translation="MQHPTTYSPHRLSLSQACRHYATLGWRAMLAEVNLTPKPGLVDRH
FT                   NSGAHRDMAHSDFVRSADAIAPWLARFVEYGADSAALDGGSVLPGLRALGIACEADMFR
FT                   ATAGVNTHKGSIFSLGLLCAAAGRSHQRGHPITPARLCGYAAQFCRGLVARELAPLRPA
FT                   QASTAGQRLFMTLGITGARGEAEAGYPLVLNLALPHYQRTLAAGRDPELALLDTLVQLM
FT                   AHNQDTNVAARGGEGGLRWMQQRAAALLATGGIRTPADLQALHRFDAECIDRHLSPGGS
FT                   ADLLILTWFLAHLCYPILQAEH"
FT   CDS_pept        complement(231193..231744)
FT                   /codon_start=1
FT                   /gene_family="HOG000130710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410053"
FT                   /locus_tag="ETAF_0193"
FT                   /function="holo-citrate lyase synthase activity "
FT                   /function="lyase activity"
FT                   /protein_id="ADM40316.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0050519"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniParc:UPI0001BD00AC"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X2"
FT                   /transl_table=11
FT                   /translation="MMTLLPHLAASHTVTLPELLLSRECRQSRQAAWLTRHTCTLISFT
FT                   VVAPGPVKDSPLTRRIFNAGIAALNQLAQRQEWPLREQRSLELATGPEGLMAIDAPAEQ
FT                   VKRAAIALEQAHPLGRLWDMDVLASDGQILSRSDYQLPARRCLICQRPAVLCARERRHD
FT                   VAQLLAHMEALVHDATPDNV"
FT   CDS_pept        complement(231748..233268)
FT                   /codon_start=1
FT                   /gene_family="HOG000117923" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410054"
FT                   /locus_tag="ETAF_0194"
FT                   /function="citrate (pro-3S)-lyase activity"
FT                   /function="citrate CoA-transferase activity"
FT                   /biological_process="acetyl-CoA metabolic process "
FT                   /cellular_component="citrate lyase complex"
FT                   /protein_id="ADM40317.1"
FT                   /db_xref="GO:0006084"
FT                   /db_xref="GO:0008814"
FT                   /db_xref="GO:0008815"
FT                   /db_xref="GO:0009346"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="UniParc:UPI0001BD00AD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X3"
FT                   /transl_table=11
FT                   /translation="MTQDTQRNARVAAFSQRDGALPAFNDVSKAQYHDGRARDRKLCTS
FT                   LEEAIRRSGLRDGMTISFHHAFRGGDLTLNQVMDAIAAMGFKDLTLASSSLSDCHAPLV
FT                   GHIRNGVVRKIYTSGLRGPLADAVSHGLLDEPVQIHSHGGRVHLIDSGELSIDVAFLGV
FT                   PACDAFGNANGYTGNACCGSLGYARADAEAANSVVLLTEEILPYPHNPASLTQDQVDLI
FT                   VQIDHVGDASKIGADATRMTSNPRELLIARSAAEVIAHSGYFNEGFSLQTGTGGASLAV
FT                   TRFLEDKMRRADIRADFALGGITSTIVDLHEKGYIRKLLDVQSFDRAAAGSLARNPNHI
FT                   EISANQYANWSSKGASVDRLDVVVLSALEVDTHFNVNVLTGSDGVLRGASGGHCDTAIG
FT                   SALSIIVAPLVRGRIPTIVDSVLTCVTPGSSIDILVTDHGIAVNPARPELAQRLRDAGL
FT                   PLVSIEWLRDRALSLTGEPKPIAFTDKVVAVVRYRDGSVIDVVRQVKE"
FT   CDS_pept        complement(233279..234175)
FT                   /codon_start=1
FT                   /gene_family="HOG000242282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410055"
FT                   /locus_tag="ETAF_0195"
FT                   /function="citrate (pro-3S)-lyase activity"
FT                   /function="citryl-CoA lyase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="acetyl-CoA metabolic process "
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /cellular_component="citrate lyase complex"
FT                   /protein_id="ADM40318.1"
FT                   /db_xref="GO:0006084"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008815"
FT                   /db_xref="GO:0008816"
FT                   /db_xref="GO:0009346"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI0001BD00AE"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X4"
FT                   /transl_table=11
FT                   /translation="MTPQQKTRTRRSMLFVPGSNAAMLSNAFIYKADALMFDLEDSVVL
FT                   REKDAARRLVYHALQHPLYHDIETIVRVNALDSAYGVADLEAVVRAGVDVVRLPKTDSA
FT                   DDVIAIENEIARIERACGREVGSTGLLAAIESAQGITQAVAIAHASPRLIGIALGAEDY
FT                   VRNLRTERSAEGIELLFARCSILQAARSAGIQAFDTVYSDANNDEGFLREASHIKQLGF
FT                   DGKSLINPRQIELLHNLYAPTQKEVDHARLVVDAAEASAREGRGVVSLNGKMVDSPVIE
FT                   RARLVLSRAALSGIREE"
FT   CDS_pept        complement(234172..234471)
FT                   /codon_start=1
FT                   /gene_family="HOG000040480" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410056"
FT                   /gene_name="citD"
FT                   /locus_tag="ETAF_0196"
FT                   /function="lyase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40319.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="UniParc:UPI0001BD00AF"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X5"
FT                   /transl_table=11
FT                   /translation="MKINHAAVAGTLESSDVMVRIAPIEDDQALDLQISSSVEKQFGDA
FT                   IRATVLDVLNRYQVRGVQLIVDDKGALDCVLRARLETLLARAADLVSLPWEDRA"
FT   CDS_pept        complement(234468..235544)
FT                   /codon_start=1
FT                   /gene_family="HOG000117934" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410057"
FT                   /locus_tag="ETAF_0197"
FT                   /function="N-acetyltransferase activity"
FT                   /function="[citrate (pro-3S)-lyase] ligase activity "
FT                   /function="lyase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40320.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="GO:0008771"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001BD00B0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X6"
FT                   /transl_table=11
FT                   /translation="MFSNTVFTQIKRSEQKRIADITHFLRENGLNIDTSVEIFICAQRD
FT                   NKIIACGGIAGDIIKCVAISATARGEGLALTLATELVNLAYELGRNNLFIYTKEENEEM
FT                   FHQCGFSTITRVPGIMVLMENSKVRLQRYAETLATLRHPGKKIGAIVMNANPFTNGHRY
FT                   LVRQAASQCDWLHLFLVREDTSRFPYEDRLALVRSGVSDIANITLHPGSEYIISRATFP
FT                   CYFIKEQGVADNCYTEIDIKIFRQYLAPALGITHRFVGTEPFCPVTAKYNQDMRYWLET
FT                   PALPSPPIHLVEVARLTYHNTPISASWVRKLLVRKDLPAITPLVPDATRAYLARLIASM
FT                   PAGAERRPQESVLVTGDK"
FT   CDS_pept        235932..237575
FT                   /codon_start=1
FT                   /gene_family="HOG000241934" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410058"
FT                   /gene_name="dpiB"
FT                   /locus_tag="ETAF_0198"
FT                   /function="ATP binding"
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40321.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR016121"
FT                   /db_xref="UniParc:UPI0001BD00B1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X7"
FT                   /transl_table=11
FT                   /translation="MVRMPNNSAVNFFRRMAFPLRIFLLLLLVSCCLFAALGKYLSASF
FT                   EDYMMRQVRDMAMNQAKIIASMDSIVDGVKDRDTHRLALIADRLGTGTDFDYVVIGDRN
FT                   AIRLYHPNPAKIGHKMQFNKPGAIEKGESYFISGKGSLGQALRAKTPIFDHQGQVIGVV
FT                   SLGYLVSKIDSWRLDFLLPMAGVFVCVLLLLMLLSWLFAAHIRRQMMGMEPRQIARVVR
FT                   QMEALFGAVFEGLIAVDPDGQITAINRNARKMLGLSAPGRQWLGQPISQVVSPSGFFTD
FT                   RINEDRRDAILTFNGLSVIANRATIRSDDGDTLLGAIISFRSKDDINTLNAQLTQIRQY
FT                   VDSLRTVRHEHLNWMSTLSGLLQMKEYDRALEMVRGASQAQQQLIDRLRDAFSDKVVAG
FT                   LLFGKVHRARELGLTLTIVDGSQLHALPAGLDSTEFAAVLGNLLDNAFDASLKNPQGGG
FT                   CVEVYLSDEGSEVIIEVADQGCGVPDTLKDKIFEQGVSTKAEEPGEHGIGLYLIARYVG
FT                   RCGGTITLEDNQPYGTLFSVFIPKVKSEHE"
FT   CDS_pept        237568..238254
FT                   /codon_start=1
FT                   /gene_family="HOG000034816" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410059"
FT                   /gene_name="dpiA"
FT                   /locus_tag="ETAF_0199"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40322.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI0001BD00B2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X8"
FT                   /transl_table=11
FT                   /translation="MNKINILIVEDETPLAEMHAEFIRNHPCCGQLWLAGNLAQARAMI
FT                   KSFHPDLVLLDNYLPDGVGVHLLHELTQQRYPGGVVLTTAASDMDTVSEAVRSGAFDYL
FT                   IKPIAYERLGQTLERYQQRNSMLSGHQNASQRQIDSMYNAYARGDSKEDLPVGIDALTL
FT                   EKVQGLFVDDTVRHTAESVAQSLMLSRTTARRYLEFCAARQQIVAEIVYGKVGRPQRIY
FT                   RAQGKS"
FT   CDS_pept        238375..238983
FT                   /codon_start=1
FT                   /gene_family="HOG000232167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410060"
FT                   /gene_name="lexA"
FT                   /locus_tag="ETAF_0200"
FT                   /function="DNA binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /biological_process="SOS response"
FT                   /biological_process="negative regulation of transcription,
FT                   DNA-dependent"
FT                   /biological_process="proteolysis"
FT                   /biological_process="transcription"
FT                   /protein_id="ADM40323.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0009432"
FT                   /db_xref="GO:0045892"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI0001BD00B3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5X9"
FT                   /transl_table=11
FT                   /translation="MKALTARQQQVYDLIRDHIEQTGMPPTRAEIAQRLGFRSPNAAEE
FT                   HLKALQRKGVIEIVSGASRGIRLLMEDETGLPLIGQVAAGEPLLAQQHIEGFYQVDPSL
FT                   FKPSADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRNGQVVVARIEDEVTVKRLKKQGN
FT                   MVQLLPENSDFQPIVVDLREQNFTIEGLAVGVIRNGDWI"
FT   CDS_pept        239139..240470
FT                   /codon_start=1
FT                   /gene_family="HOG000253154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410061"
FT                   /locus_tag="ETAF_0201"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40324.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI0001BD00B4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y0"
FT                   /transl_table=11
FT                   /translation="MRGFFQEDKALWRLALPMILSNVSVPLLGIVDTAVIGHLDSPVYL
FT                   GGVAVGSMATTFLFMLLLFLRMSTTGLCAQAFGAADRPALARALVQPLIMALLAGVGII
FT                   LLRQPLSALMLQIVGAEAAIQTQAQLFMQIRWLSAPATLANLVILGWLLGVQYARAPVL
FT                   LLIVGNAVNIALDLWLVVGLGWKVAGAAWATVIADYVTLLMGVALLLHVMRLRGLRRAH
FT                   FRRAWRGNLRRLLALNRDIMLRSLLLQLCFASLTVIGARMGADVVAVNAVLMNLLTFTA
FT                   YALDGFAYAVEAYSGQAYGARDASALRRVWRAACRQAGAVALLFALAYGLFGRDIVNLL
FT                   TSLPQVQSLALDYLPWQVVLPLLGVWCYLLDGMFIGATRGADMRNSMAVAALGYGMTLL
FT                   SIPWLGNHGLWLALAVFLTLRGLSLWLIWRRCWRAQRWFPAGAA"
FT   CDS_pept        complement(240487..240960)
FT                   /codon_start=1
FT                   /gene_family="HOG000014146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410062"
FT                   /locus_tag="ETAF_0202"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40325.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001BD00B5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y1"
FT                   /transl_table=11
FT                   /translation="MTTPTLQRLLAQAEQICRQRNVRLTPQRMEVLRLMAAQQGAISAY
FT                   DLLDLLRVSEPQAKPPTIYRALDFLLEQGFIHKVESTNSYVMCHHLDEPCHTSALFICH
FT                   RCGQVHERSADLLQQQLETLAQQAGFTLQHSVIEAHGLCHACAQAPDGETSAR"
FT   CDS_pept        241402..242073
FT                   /codon_start=1
FT                   /gene_family="HOG000156609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410063"
FT                   /locus_tag="ETAF_0203"
FT                   /protein_id="ADM40326.1"
FT                   /db_xref="UniParc:UPI0001BD00B6"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y2"
FT                   /transl_table=11
FT                   /translation="MDLILAIEHWPLRQAIVALYRRQFTIISLPDAVPFSPRILSALQR
FT                   TGSLLVTDRQRNHLLQTVERVRRHSLTPVIIINRRESYLTQLIARFFNNAHALSYDGFY
FT                   RHIQRRTFHPLDLYFLPYSRGAPDACWGAGETVHARLNAFGLMTLYQRGVTLREAAVLL
FT                   SLSYHNSTAMTARLLGIHEQAVVYCKRTLGNKLGLDHNRPDFISHIFLSPGARQGARAT
FT                   E"
FT   CDS_pept        242191..243249
FT                   /codon_start=1
FT                   /gene_family="HOG000259834" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410064"
FT                   /locus_tag="ETAF_0204"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ADM40327.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI0001BD00B7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y3"
FT                   /transl_table=11
FT                   /translation="MGYGEQAMTQAAHIEQATGARGRDQAGVFPSQRFSIAPMLDWTDR
FT                   HCRYFHRLLSRQTLLYTEMVTTGAIIHGKGDYLAYSEEEHPLALQLGGSNPADLARCAH
FT                   LAEARGYDEINLNVGCPSDRVQNGRFGACLMGEAQLVADCVKAMRDVVSIPVTVKTRIG
FT                   IDAQDSYPFLCDFIGTVAGQGECDTFIVHARKAWLSGLSPKENREVPPLDYPRVYRLKQ
FT                   DFPQFTIALNGGVKRLDEALTHLQHVDGVMMGREAYHNPGILAQVDRQLFDADAAVPDS
FT                   VAVVRALYPYIERELAQGTYLGHITRHILGLFQGIPGARQWRRHLSENAHRPGAGIDVV
FT                   EQALRFVDRRAE"
FT   CDS_pept        243413..243625
FT                   /codon_start=1
FT                   /gene_family="HOG000218415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410065"
FT                   /locus_tag="ETAF_0205"
FT                   /protein_id="ADM40328.1"
FT                   /db_xref="InterPro:IPR014318"
FT                   /db_xref="UniParc:UPI0001BD00B8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y4"
FT                   /transl_table=11
FT                   /translation="MLEVMFVLAFFMMLLLTGISLLGVIAALAVAALLLVFGGLFVLVI
FT                   KLLPWLALAIVVVWLYRALRKPASY"
FT   CDS_pept        243960..244097
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410066"
FT                   /locus_tag="ETAF_0206"
FT                   /protein_id="ADM40329.1"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="UniParc:UPI0001E353ED"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y5"
FT                   /transl_table=11
FT                   /translation="MVEIDNDEWRGIQVTPQNRLRLYGTVDKEMAEQSSVDVDRIEILR
FT                   "
FT   CDS_pept        244279..245691
FT                   /codon_start=1
FT                   /gene_family="HOG000113196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410067"
FT                   /locus_tag="ETAF_0207"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA helicase activity"
FT                   /biological_process="DNA replication"
FT                   /protein_id="ADM40330.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003678"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="UniParc:UPI0001BD00BA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y6"
FT                   /transl_table=11
FT                   /translation="MAGNNPGSKSREAPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNER
FT                   WDHVAERVVSNDFYSRPHRLIFGEMQRLLEQGRPIDLITLSESLEQQGHLDSVGGFAYL
FT                   AELSKNTPSAANINAYADIVRERAVVREMIAVANEIADAGYDPQGRSSEDLLDLAESRV
FT                   FQIAENRASKDEGPKSIDRILEDTVSRIEQLYQRPHDGVTGVSTGYQDLDKKTAGLQKS
FT                   DLIIVAARPSMGKTTFAMNLCENAAMTQEKPVLIFSLEMPGEQIMMRMLASLSRVDQTR
FT                   IRTGQLDDEDWARISSTMGLLLEKRNMYIDDSSGLTPTEVRSRARRIFREHDGLSLIMI
FT                   DYLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSD
FT                   LRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIILGKQRNGPIGTVRLTFNGQWSRF
FT                   DNYAGPAYNDED"
FT   CDS_pept        complement(245764..245877)
FT                   /codon_start=1
FT                   /gene_family="HOG000156610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410068"
FT                   /locus_tag="ETAF_0208"
FT                   /protein_id="ADM40331.1"
FT                   /db_xref="UniParc:UPI0001BD00BB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y7"
FT                   /transl_table=11
FT                   /translation="MSQSAAINDGGCRFHVASLVPLMSLVGYRVGRTAPGS"
FT   CDS_pept        245833..246924
FT                   /codon_start=1
FT                   /gene_family="HOG000031446" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410069"
FT                   /gene_name="alr"
FT                   /locus_tag="ETAF_0209"
FT                   /function="alanine racemase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="alanine metabolic process "
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /protein_id="ADM40332.1"
FT                   /db_xref="GO:0006522"
FT                   /db_xref="GO:0008784"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="UniParc:UPI0001BD00BC"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y8"
FT                   /transl_table=11
FT                   /translation="MKAATAIIDRRALRHNFQQIRKFAPHSRLIAVVKANAYGHGLLET
FT                   AKILHQADCYGVARIGEALMLRSGGIVKPILLLEGFFSASDLPVLVANNIETAVHSEEQ
FT                   LQALENARLERPIKVWMKLDTGMHRLGVRPEQAEAFYRRLCTCPNVAQPVNFMSHFSRA
FT                   DEPECGRTEQQLACFDDFVQGKAGEQSIAASGGILLWPQSHRDMVRPGIIMYGVSPQAD
FT                   LSLAADHYGLQPAMTLQSSLIAVREHKAGEPVGYGGAWVAQRDTRLGVVAIGYGDGYPR
FT                   SAPSGTPVLINGREVPIVGRVSMDMISVDLGPQAADRVGDNVIMWGPGLPVEKVAACTG
FT                   ISAYELITKLTSRVAMEYIGEEA"
FT   CDS_pept        complement(246997..248154)
FT                   /codon_start=1
FT                   /gene_family="HOG000243334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410070"
FT                   /locus_tag="ETAF_0210"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40333.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniParc:UPI0001BD00BD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Y9"
FT                   /transl_table=11
FT                   /translation="MENFVLHTPTKILFGRDQIANLRDEIPPQARVLITYGGGSIKRNG
FT                   VLDQVHAALHGRHVFEFGGIEPNPHYETLMQAVEMVHNEKIDYLLAVGGGSVIDGTKFI
FT                   AAAADYVGDPWHIMETVGSDVTRAIPMGVVLTLPATGSEMNMGAVITRSATGDKLHFMS
FT                   PFVMPRFAVLDPQVTYTLPPRQIANGVVDAFVHIVEQYLTYPVDARVQDRFAEGLLQTL
FT                   IEEGPRALQEPENYGVRANIMWCATMALNGLIGAGVPQDWSTHMLGHELTAMHGLDHAQ
FT                   TLAIVLPNVLQLKRDKKHTKLLQYAERVWNIHSGSDEQRIDAAIDATRAFFEQMGVKTR
FT                   LSDYGLDGSTIPALLDKLQEHRMTALGEHGDITLEQSRQIYHAAR"
FT   CDS_pept        248589..249275
FT                   /codon_start=1
FT                   /gene_family="HOG000203204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410071"
FT                   /gene_name="yqhC"
FT                   /locus_tag="ETAF_0211"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADM40334.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniParc:UPI0001E35410"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Z0"
FT                   /transl_table=11
FT                   /translation="MLMTLPLPCECETFASPQEPLIGLALRVDVQMLQDLLMDIGDGMR
FT                   TAVRPHADGVRSVALDDAMLCACERLVEAMEDPLHARVLGPQIVREMLFHALCGAGGDA
FT                   LLALASRHSHFSQIAKALRLIEQNYASSLNVDRLAQSVNMSISSFHHNFKAVTATSPLQ
FT                   YIKSYRLHKARMMILHDGLKASTAASRVGYESPSQFSREYKRFFGNTPSDQASRYRSGG
FT                   LRIAEL"
FT   CDS_pept        249334..250623
FT                   /codon_start=1
FT                   /gene_family="HOG000244862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410072"
FT                   /locus_tag="ETAF_0212"
FT                   /function="aminopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40335.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="UniParc:UPI0001BD00C1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Z1"
FT                   /transl_table=11
FT                   /translation="MIERAFLVPGMAVREFRTEVPLNWRDPSDGRRLTLFARELCAPGR
FT                   EADEMPCLLFLQGGPGGKCPRPTSHSGWLAEALRDYRVILMDQRGTGNSSRIEASVLRD
FT                   MTPEQAADYLSHFRADAIVRDAEHLRLRHFGGRRWTTLGQSYGGFITLTYLSQAPQGLH
FT                   ACYITGGLPAIAPDATRLYEATYRLVAQRNQHFFTRYPQAREQLDRIVALLREQAVYLP
FT                   DGDLLSVERLLTLGLDMGMSEGYERLLWLLDEAFNQEGELSDTFLNQVMQRSGFADNPL
FT                   YAVLHESIYADADSGATRWVAQRVRDDLPAFSPERSSPLLTGEMIYPWMFDQMQSLRPF
FT                   RAAVELLARRETWPVLYDAARLRDNDIPVMAAVYYHDMYVDVGLSLESAAQIGNLQTWI
FT                   TSEYDHNGLRVAPVFRRLRDMMAERGVATE"
FT   CDS_pept        complement(250670..251302)
FT                   /codon_start=1
FT                   /gene_family="HOG000124503" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410073"
FT                   /locus_tag="ETAF_0213"
FT                   /cellular_component="cell outer membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40336.1"
FT                   /db_xref="GO:0009279"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000498"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniParc:UPI0001BD00C2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T5Z2"
FT                   /transl_table=11
FT                   /translation="MKAFTKLALFVGLVSGATLANAAGINNTGYYAGAKMGISAEHLFD
FT                   QKDVNGNGMSNDNKGVGNAGLVFGYNFENQFSLPVRAELDYTFRANATSSHTNDAAETN
FT                   DSRLGLQTLMVNGYYDIKTGTPFTPYVGAGIGYANVSLKNDMNGDNVQSNSNNFAWSVG
FT                   TGVIYNVNERLDLDLGYKYLDAGKASAGNSQAKVTTHDVTLGVNYYF"
FT   CDS_pept        complement(251414..251533)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410074"
FT                   /locus_tag="ETAF_0214"
FT                   /protein_id="ADM40337.1"
FT                   /db_xref="UniParc:UPI0001BD00C3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6E3"
FT                   /transl_table=11
FT                   /translation="MSARKPFLSRSLPRFSCYFQRMENIRYNFIFPFDFIHIK"
FT   CDS_pept        252237..252764
FT                   /codon_start=1
FT                   /gene_family="HOG000263449" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410075"
FT                   /locus_tag="ETAF_0215"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="ADM40338.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="UniParc:UPI0001BD00C4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6E4"
FT                   /transl_table=11
FT                   /translation="MKKMKILVLATALMSGAAYSASESITLYEAGPQGAGPAIGEVTVS
FT                   ETPYGLLFTPSLHGLPQGIHGFHVHENASCLPGVKEGKPVPALMAGGHWDPEKRGKHMG
FT                   PYSDAGHLGDLPGLVVNADGTANYAVLAPRLKSLSQLKGHALMVHVGGDNYDDHPHALG
FT                   GGGARMACGVIQ"
FT   CDS_pept        complement(252824..253504)
FT                   /codon_start=1
FT                   /gene_family="HOG000237376" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410076"
FT                   /locus_tag="ETAF_0216"
FT                   /function="nitrate reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="nitrate reductase complex "
FT                   /protein_id="ADM40339.1"
FT                   /db_xref="GO:0008940"
FT                   /db_xref="GO:0009325"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="UniParc:UPI0001BD00C5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6E5"
FT                   /transl_table=11
FT                   /translation="MSALSYFLFNIYPYIAITVLLLGCLYRFDYGQYTWKSGSSLLMAN
FT                   GRYSRYALNLFHVGMLGVFFGHVAGLLTPRSWYDAYISSQTHQILELIAGSFFGTLLLI
FT                   GALMLLARRLFCARVAATSSFSDKLILILLTIQICLGMLTIPVDLLHPSGATLQNLISW
FT                   SQGIVTFRPDPAQYLQEVNWLFKVHMVLGLTIFLIFPFTRLVHICSLPLGYLLRRRQVV
FT                   KTLR"
FT   CDS_pept        complement(253515..254171)
FT                   /codon_start=1
FT                   /gene_family="HOG000237365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410077"
FT                   /locus_tag="ETAF_0217"
FT                   /function="nitrate reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="nitrate reductase complex "
FT                   /protein_id="ADM40340.1"
FT                   /db_xref="GO:0008940"
FT                   /db_xref="GO:0009325"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="UniParc:UPI0001BD00C6"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6E6"
FT                   /transl_table=11
FT                   /translation="MLSLLMLARLLDYPDEALWQARGELEAALPQCREMTAAQQKRLQA
FT                   FIAHYWEAPLASRQSDYIAQFDHTRRCALYLCEHQLAESKNRGQAMVNILSHYRQAALE
FT                   PAPRELPDYLPMVLEFAYLRSQQQPEEGRRILTQIAEVAEILYRRTHDGMYGVLFQLLL
FT                   QLAGRETDGLVPEADGTPTAAIDAEWDRAHAPARVELPDIPQGRPAPVHYLDLER"
FT   CDS_pept        complement(254175..255695)
FT                   /codon_start=1
FT                   /gene_family="HOG000237353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410078"
FT                   /locus_tag="ETAF_0218"
FT                   /function="nitrate reductase activity"
FT                   /biological_process="nitrate metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="nitrate reductase complex "
FT                   /protein_id="ADM40341.1"
FT                   /db_xref="GO:0008940"
FT                   /db_xref="GO:0009325"
FT                   /db_xref="GO:0042126"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniParc:UPI0001BD00C7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6E7"
FT                   /transl_table=11
FT                   /translation="MKIRAQVSMVLNLDKCIGCHTCSVVCKNVWTSREGIEYGWFNNVE
FT                   TKPGRGFPRDWEDQDKWHGGWQRVNGQLTPRMGGKLSLLAKIFANPHMPAVGDYYEPYS
FT                   FDYAHLHNAPAGARHQPTARPYSLLTGKTLEKIEGSANWEDDLGGEARVRQGDRNLDGL
FT                   DKQLYAQFEQTFMMYLPRLCEHCLNPACVASCPSGAIYKRAEDGVVLINQDQCRGWRMC
FT                   VSACPYKKIYYNWKSGKSEKCIFCYPRIEAGLPTLCSESCVGRIRYIGVMLYDAEAIPA
FT                   AAAEEDPQALYDAQMKIFLDPNDPDILAQARRDGISDEILAHAQRSPVYRLIKEWRLAL
FT                   PLHPEFRTLPMVWYVPPLSPIRFDDASLAEPHDIRLAELAQMRIPIDYLANLLCAGNRK
FT                   PVEAALTRLIALRHYRRSLLSPQAPQWLQQADLSAPQAEAMYRLLALAPYHERFVIPTG
FT                   MHRPGSDREYIEHGSCGFSFNTPHDTDGTNLTGYRPDDRLVINTHSKE"
FT   CDS_pept        complement(255722..259393)
FT                   /codon_start=1
FT                   /gene_family="HOG000237341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410079"
FT                   /locus_tag="ETAF_0219"
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="molybdenum ion binding"
FT                   /function="nitrate reductase activity"
FT                   /biological_process="nitrate metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="nitrate reductase complex "
FT                   /protein_id="ADM40342.1"
FT                   /db_xref="GO:0008940"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0009325"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0042126"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI0001BD00C8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6E8"
FT                   /transl_table=11
FT                   /translation="MSTFLKKIRYFTAGKPMAANAHELYLQDSSDWEQSYRSRWQYDKV
FT                   VRSTHGVNCTGSCSWKIYVKSGLITWETQYTDYPETPIDLPNHEPRGCPRGASYSWYIY
FT                   SANRIKYPLMRRALLDLWREQRAQHPDAVDAWQAILDNPELSQRYKRERGMGGLVRVSW
FT                   QEANELIAASNVATVKRFGPDRVAGFSPIPAHAMLSFASGSRYLSLIGGTCLSFYDWYC
FT                   DLPPSSPQTWGEQTDVPESADWYNAQYLVMWGSNVPQTRTPDAHFMTEARYNGTKVVAV
FT                   SADYAENCKFADEWLAPRAGTDAALALALGQVILQQFYLQQPCDYFIRYAKRFTDFPML
FT                   VMLTPCAGQENTYQSGRYLRAADLATWQDQPLAQWKTLAFDQDSQQIVIPRGSAGFRWD
FT                   QGGQWNTVQQDALSGAAIDPLLSLQTLGEDEVCVVQPDFSHDNANDRYTLGQVPVHWIT
FT                   TTRGERVAVATVFDLMLAHYGLRPRAGEIPAEDAPCSPAWAEAITGVPRQQIIRLAQEF
FT                   ATNARITHGRSLIIVGAGINHWFHSDMTYRSIINVLMMCGTIGVNGGGWAHYVGQEKLR
FT                   PLAGWAPVALAGDWQSPARLMNGTSFFYNHTSQWRYENVDAHTLLSPLAERDQFPHSLI
FT                   DFNVIAERLGWLPSSPQLDRNPLTLAAEAADGDVKAEVAQALKQGTLRIASEDPDAPGN
FT                   YPRVLFVWRANLLGSSSKGHEYFLKHLLGTRHGVMEQDLQQKGLPLPQQVAWRDSVEGK
FT                   LDLLVTLDFRMSTTCLYSDVILPSATWYEKEDLSSTDMHPYVHPFTRAIDPMWEARSDW
FT                   EIFKGIARQFSALCAGHLGKERDVMLTPLLHDSPAELGQACGVSDWKNDPQTFVAGKTA
FT                   PAIAVVERDYPQTYFKYTHLGPALAAHGNGGKGVHWDTRPEIDSLCARHGSETLDGVGP
FT                   CANMQDATQALETILTLAPETNGQVADRAWRDLAAKTGQQEIADLAADKKGVHYRFADI
FT                   QRQPGRVIASPLWSGIDSDRHAYTAGSLNITHAVPWRTLTGRQQAYQDHAWMQAFGEGF
FT                   ACYKPPLDTQSCRSVREHTANGQPELVLNFGTAHQKWGIHSTYTDNQIMQTLSRGGPLI
FT                   WISEHDAQRGAIADNDWVELFNGNGAMVARAVVSQRIPAGLALMYHAQERTLNMPLSEV
FT                   TGERGGIHNSITRICPNPIHMIGGYAHLSWGYNYYGTIGSNRDETVIIRRLNRVEWD"
FT   CDS_pept        complement(259412..260794)
FT                   /codon_start=1
FT                   /gene_family="HOG000241722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410080"
FT                   /locus_tag="ETAF_0220"
FT                   /function="inorganic anion transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40343.1"
FT                   /db_xref="GO:0015103"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001E35411"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6E9"
FT                   /transl_table=11
FT                   /translation="MSNQPLESQNARVLKNWDPEDETFWNATGNSIAKRNLWVSVFCLV
FT                   LAFCIWMVFSSVVIKLNHIGFDFTTNQLFWLAALPSISGALLRIPFSFVVPIFGGRRWT
FT                   TISTALLLIPSIWLGFAIQDPQTSFYSFACIAILCGIGGGNFASSMANISFFFPKRLQG
FT                   YGLGINGGLGDGGIGVVQLCVPLVIGIGLFGSLGGAPQHVDYNTMIWLQNAAFLWVPFI
FT                   IIACLLSWFMMNDIAGMQSSLSSQFVILGKKDTWITSLIYLATFGSFVGFSAGFALLTK
FT                   TQFPDIDIIDYAFVGPLLGAIARPIGGRLSDKFSGYRITQVAFFFMIIFSLLIVPTLPS
FT                   EHSSGSFILFYIVFMGLFIFTNLGSGSSFQLISQIFHQKSAQEAQQQGMQGKHVDQYAD
FT                   VMSSAALGFTSAIGAFGGFIIPKTFGSAITLTHSVLLPLVCFSVFYLLCMGVTWLSYGR
FT                   HH"
FT   CDS_pept        complement(261139..261300)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410081"
FT                   /locus_tag="ETAF_0221"
FT                   /protein_id="ADM40344.1"
FT                   /db_xref="UniParc:UPI0001BD00CA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6F0"
FT                   /transl_table=11
FT                   /translation="MDIADDATLIYGKKIIILIFINISFIQSHGAVLINLCGKKSCHIA
FT                   PYYIDISH"
FT   CDS_pept        261825..263279
FT                   /codon_start=1
FT                   /gene_family="HOG000117911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410082"
FT                   /locus_tag="ETAF_0222"
FT                   /function="transporter activity"
FT                   /biological_process="sodium ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40345.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006814"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniParc:UPI0001BD0112"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6F1"
FT                   /transl_table=11
FT                   /translation="MKKGYSILIPFIVGGALACLPAPAGLSHHAWLYFSIFIGSIVGLI
FT                   IEPLPGAVIGLIAIVIIAGLGRWVLFSPEQVALPHFHAASAAFKWAVSGFSNSTVWLIF
FT                   SAFMFALGYEKTGLGRRISLLLVKSLGRRSLTLGYAIAIADLVLAPFTPSNTARSAGTI
FT                   YPVISNLPPLYDSKPNDPSARRIGSYLMWVSISITCVTSSMFLSALAPNLLSSALINQM
FT                   TGLQISWGSWFIAFLPCGIVLWLLTPLLGYWLYTPEVKINDEVPKWAKQELENLGGLSR
FT                   REKLLLLFVALALLLWVFGGGLINSAIAALLVIALMLITNVISWDDVIGNKAAWNTLFW
FT                   FGTLVSLASGLSTVGFVHWFGLVISHYLNGMSVAVASVSLLLCFYLLHYFFASTTAHAT
FT                   ALIPVMIAAAMDIHGINMMEFSLAISLSLGIMGIITPYGTGPSPIYFGSGYLPSKDFWR
FT                   LGAIFGLVNLLAYLFICLPWINYLYR"
FT   tRNA            complement(267155..267230)
FT                   /gene_name="tRNA-Phe"
FT   CDS_pept        268159..269178
FT                   /codon_start=1
FT                   /gene_family="HOG000158354" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410083"
FT                   /gene_name="speF2"
FT                   /locus_tag="ETAF_0223"
FT                   /function="carboxy-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ADM40346.1"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001BD0117"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6F2"
FT                   /transl_table=11
FT                   /translation="MNSLKIAVSLNVIAYFNTSRTTVDINDSDLTDVAAVVLSVQDALG
FT                   GALDKVEQSAFGLPVFVAEACDQRLPAEYLPRLTGVFACGDGNQDFYGKQLESAAQKYE
FT                   AELLPPFFGSLQAYVQQGNAAFDCPGHQGGQFFRRHPTGRQFFDYFGEALFRADLCNAD
FT                   VSMGDLLIHEGAPCAAQQHAAKVFNADKTYFVLNGTSSSNKVVLNALLAPGDLVLFDRN
FT                   NHKSNHHGALIQAGATPVYLETARNPFGFIGGIDAHCFEEKYLRDLVRDVAPARAGERR
FT                   PFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMKECSRCCWS"
FT   CDS_pept        269154..270320
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410084"
FT                   /gene_name="speF"
FT                   /locus_tag="ETAF_3339"
FT                   /function="ornithine decarboxylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="ADM40347.1"
FT                   /db_xref="GO:0004586"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001BD0118"
FT                   /db_xref="UniProtKB/TrEMBL:E0T853"
FT                   /transl_table=11
FT                   /translation="MLPLLLELNENDPGILVTQSVHKQQAGFSQTSQIHKKDRHIKGQA
FT                   RYVNHKRLNNAFMMHASTSPFYPLFAALDVNARMHAGDSGKRMWMECVRVGIETRKLLL
FT                   QTCQHIRPFVPETVDGRPWGAFDTEEMANDLRFFNFIPGERWHAFEGYAEHQYFVDPCK
FT                   LMLTTPGIDAKSGEYQSFGVPATILANFLRENGIVPEKCDLNSILFLLTPAEDMAKMQH
FT                   LVAQIARFERLLEQDAPLAEVLPSIYRANEARYRGYTLRQLCQEMHDLYVSHDVKQLQK
FT                   EMFRKAHFPRVVMNPQQANIEFVRGNVELVSLARAEGRIAAEGALPYPPGVLCVVPGEI
FT                   WGGSVQRYFLALEEGINRLPGFAPELQGVYIQQDEDGRKRAYGYVIKQ"
FT   CDS_pept        270433..271728
FT                   /codon_start=1
FT                   /gene_family="HOG000164507" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410085"
FT                   /gene_name="potE"
FT                   /locus_tag="ETAF_0224"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40348.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001BD0119"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6F4"
FT                   /transl_table=11
FT                   /translation="MGVVQLTILTAVNMMGSGIIMLPTKLAEVGTISIVSWLVTAVGSM
FT                   ALAYAFAKCGMYSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANVAIAISAVGYGT
FT                   ELIGASLSPMGICLATIGVLWLCTAANFGGARITGRISSVTVWGVIIPVVGISVIGWFW
FT                   FSPTLYVDSWNPHHLPTFEAIGSSIAMTLWAFLGLESACANTDVVENPERNVPIAVLGG
FT                   TLGAAVIYIVSTNVIAGIVPNMDLANSTAPFGMAFAQMFDPTVGKIIMALMVMSCCGSL
FT                   LGWQFTIAQVFKSSADEGYFPAIFRRVTQSGAPVKGMLAIVAIQSVLSLMTISPSLNAQ
FT                   FNVLVNLAVVTNLIPYILSMAAVLIIQRVAGIDPAKARLPNILAFVGAMYSFYALYSSG
FT                   EQAMMWGAIATFLGWTLYGFVSPRFEMRDRQV"
FT   CDS_pept        271847..272293
FT                   /codon_start=1
FT                   /gene_family="HOG000102781" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410086"
FT                   /gene_name="nikR"
FT                   /locus_tag="ETAF_0225"
FT                   /function="DNA binding"
FT                   /function="nickel ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40349.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016151"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014160"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="UniParc:UPI0001BD011A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6F5"
FT                   /transl_table=11
FT                   /translation="MMQRVTLSLDDDLMAEIDAIMKARNYQNRSEAIRDLARAGLQSMT
FT                   EAPSQSSHCVAALFYVYDHESRELSKRLTRTFHDHHDLSLASLHVHLDHGRCLEVSLLK
FT                   GAGGEVTRFAEQVIAERGVRHGKLVVVPGDDGEAHAHPHLHAHD"
FT   CDS_pept        complement(272309..273388)
FT                   /codon_start=1
FT                   /gene_family="HOG000283572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410087"
FT                   /locus_tag="ETAF_0226"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="ADM40350.1"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="UniParc:UPI0001BD011B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6F6"
FT                   /transl_table=11
FT                   /translation="MKKVLALALIAPLLISCSGKKPDSNGEEYIKDTNGFDILMGQFAH
FT                   NIENIWGINEVLIAGPKDYVKYSDRYLTRSHINFETGQITIETIATLDPAESLRQAIVT
FT                   TLLMGDDPGAIDLYSDANDIKPSREPFLYGQVLDNTGQPIRWSGRANSFASYLLQNKLM
FT                   KRTSGLHVIYSVTIQLVPNHLDKRAHKYLGMVRRASERYGVDESLILAIMQTESSFNPY
FT                   AVSRSDALGLMQVMQHTAGKDVFVSKGKWGTPSRSYLFDPEKNIDTGTAYLAILQNTYL
FT                   GGIQNATSRRYAVITAYNGGAGSVLRVFSSDKGQAVSIINQMSPGDVYEALTQRHPSAE
FT                   SRRYLYKVNSTQKNYRRIR"
FT   CDS_pept        complement(273436..273708)
FT                   /codon_start=1
FT                   /gene_family="HOG000137239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410088"
FT                   /gene_name="yggX"
FT                   /locus_tag="ETAF_0227"
FT                   /function="iron ion binding"
FT                   /protein_id="ADM40351.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="UniParc:UPI0001BD011C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6F7"
FT                   /transl_table=11
FT                   /translation="MSRTVFCTFLNREAEGLDFQSYPGDLGKRIYDHISKEAWGQWMAK
FT                   QTMLINEKKLNMMNPDDRSLLALEMEKFLFEGHDVHIEGYTPPSQ"
FT   CDS_pept        complement(273711..274799)
FT                   /codon_start=1
FT                   /gene_family="HOG000028744" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410089"
FT                   /locus_tag="ETAF_0228"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="DNA N-glycosylase activity"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="base-excision repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADM40352.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="GO:0019104"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI0001BD011D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6F8"
FT                   /transl_table=11
FT                   /translation="MMQAQQFAHAVLAWYARFGRKTLPWQHPKTPYRVWLSEVMLQQTQ
FT                   VATVLPYFQRFTQRFPDVQALAAAPLDEVLHLWTGLGYYARARNLHKAAQLIVSQHHGE
FT                   FPQDFEQVAALPGIGRSTAGAILSLSLGQHHPILDGNVKRVLARCYAIPGWPGRKEVET
FT                   RLWQLSGEVTPADGVSQFNQAMMDLGALVCTRSRPKCELCPLNAGCLAYADGSWADFPG
FT                   KKPKQTLPERQAYLLLLQHGETVWLQQRPASGLWGGLFCFPQYDSEAALRAQLYRLGQD
FT                   PDAAQTLTAFRHTFSHFHLDIIPVWSAYTTASACMDEGDGLWYNLAQPPSVGLAAPTER
FT                   LLQQLRKQPPASATAGDATEKE"
FT   CDS_pept        275089..275805
FT                   /codon_start=1
FT                   /gene_family="HOG000073968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410090"
FT                   /gene_name="trmB"
FT                   /locus_tag="ETAF_0229"
FT                   /function="tRNA (guanine-N7-)-methyltransferase activity "
FT                   /protein_id="ADM40353.1"
FT                   /db_xref="GO:0008176"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniParc:UPI0001BD011E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6F9"
FT                   /transl_table=11
FT                   /translation="MNDVITAEFDENGRAIRRIRSFVRRQGRLTKGQQLALEQHWPLMG
FT                   VEFTPEALDLPALFGRQAPVVLEIGFGMGASLVAMAQQHPERDFLGIEVHSPGVGACLS
FT                   SAHEAGVNNLRVMCHDAVEVLERMIPDGSLDMVQLFFPDPWHKARHHKRRIVQPAFAER
FT                   IRGKLKIGGVFHMATDWENYAEHMLEVMNHAPGYRNLSDDNTYVPRPDSRPVTKFELRG
FT                   QRLGHGNWDLMFERVE"
FT   CDS_pept        275805..276131
FT                   /codon_start=1
FT                   /gene_family="HOG000262794" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410091"
FT                   /locus_tag="ETAF_0230"
FT                   /protein_id="ADM40354.1"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniParc:UPI0001BD011F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G0"
FT                   /transl_table=11
FT                   /translation="MAKNRSRRLRKKLHIDEFQEVGFSASWRFADGTPVETVDTLLDRL
FT                   IDEVIEPNGLAFDGSGYLRWEGLICLQQIGRCTDEQRQLVKGWLESQGMLDVVVSDLFD
FT                   VWWE"
FT   CDS_pept        276369..277256
FT                   /codon_start=1
FT                   /gene_family="HOG000216890" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410092"
FT                   /gene_name="glsA1"
FT                   /locus_tag="ETAF_0231"
FT                   /function="glutaminase activity"
FT                   /biological_process="glutamine metabolic process "
FT                   /protein_id="ADM40355.1"
FT                   /db_xref="GO:0004359"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniParc:UPI0001E35412"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G1"
FT                   /transl_table=11
FT                   /translation="MDQVRPLLGQGRVANYIPALAEVAPDRLGIAVCTVDGRMFSAGDA
FT                   GERFSIQSISKVLSLTLAMHRYSEAEIWQRVGKEPSGQPFNSLVQLELEQGKPRNPFIN
FT                   AGALVVCDMLQSRLSAPRQRMLEVVRALSGSADICYDARVARSEFEHSDRNAAIAYLMK
FT                   SFGNFDNDVITVLHNYFHYCALRMNCMELARTFVYLANRGRALALDEPVIGERQARQIN
FT                   ALMVTSGLYDGAGEFAYRVGMPGKSGVGGGVVAVVPQEMIIAVWSPQLDSCGNSLAGIA
FT                   ALELLAQRIGRSIF"
FT   CDS_pept        277267..277995
FT                   /codon_start=1
FT                   /gene_family="HOG000124469" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410093"
FT                   /locus_tag="ETAF_0232"
FT                   /protein_id="ADM40356.1"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniParc:UPI0001E35413"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G2"
FT                   /transl_table=11
FT                   /translation="MGKWGCSLLLLLTAAQAQAAWQCQVKPQDDIIISAQQVQIVGASG
FT                   NLQISRDGAVTRDGHPLALSADVRRQAETLQRDLRRDVPWIDQGVQTRLDRARGALDNI
FT                   IVEQLGSDSNVRHRLSTLDTQLKAQMNRVLEKRSDGYAFHHQAIAQVEKEGQTLVNQTL
FT                   GGVLQDSINEMGAKGLLKAGQSENPLQAVLGNLGGLQQSIRTEWDKQDNDLRAFGQQAC
FT                   ERVQALDTQRKALLKALPAS"
FT   CDS_pept        278088..279737
FT                   /codon_start=1
FT                   /gene_family="HOG000179191" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410094"
FT                   /locus_tag="ETAF_0233"
FT                   /function="transporter activity"
FT                   /protein_id="ADM40357.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniParc:UPI0001E35414"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G3"
FT                   /transl_table=11
FT                   /translation="MSSTLVMEGNDMKIKYNLFFGFGVFMFSLGAPLAAEVPPGVSLAA
FT                   AQTLTRNNGSEPASLDPHRSESDVEFNILRDFFEGLLTLDGEGHLRPGLAARWQHSEAG
FT                   RVWTFSLRPDLRWSNGEALTAQDLVFSWRRLIDPATASPYATFLVNMGIKNAAAIQEGA
FT                   LPPSALGVAAPDARTLRVTLDQPLSTFLPMMVHPTLVPLNPRVLARYGDKWTQPGHFVG
FT                   NGAYTLKQWVINERLVGERNPHYWDDAHTVIHQVVYLPIVSETAGVNRYRAGELDMTPL
FT                   PSALFASLKQSLGEQVQIFPKLGTYYYHFNTRRAPFDDVRVRQALNLGLDKEIIAQKVL
FT                   GQGQRPAWLFGSDDIGGMALRAPDYARWPRETRLARAKALLAEAGFGPGNPLRFTLLYN
FT                   TSEGHQRIAIAAASMWKKNLGVEATLNNQEWKSMLDTMRSGHFDVVRNAWVADYDDPAA
FT                   MLNTFRSGDSNNTPQYSNPRFDAVLAQASASQDPAARQRLFQQAEALLAEDVPTIPLYH
FT                   YVSVRLVKPYVGGYQPGNMDYLYSKDMYIRAH"
FT   CDS_pept        complement(279783..280913)
FT                   /codon_start=1
FT                   /gene_family="HOG000015379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410478"
FT                   /locus_tag="ETAF_0234"
FT                   /function="coproporphyrinogen dehydrogenase activity "
FT                   /function="coproporphyrinogen oxidase activity "
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40358.1"
FT                   /db_xref="GO:0004109"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0051989"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="UniParc:UPI0001BD0123"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G4"
FT                   /transl_table=11
FT                   /translation="MLKLPPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPQQAYVDHLLA
FT                   DLDQELPRVAGRPLSTLFIGGGTPSLLSGEALQRLLDGVRARLPLAADAEITLEANPGT
FT                   VEAERFSAYQRAGVNRISIGVQSFSADKLQRLGRIHGPQEAIAAARLATALGLRSFNLD
FT                   LMHGLPQQSQEEALDDLRQAIALNPPHLSWYQLTIEPNTLFGSRPPRLPDDDALWEIFE
FT                   QGDRLLRASGYQQYETSAYALPGRQCQHNLNYWRFGDYLGIGCSAHGKLTFADGRIERR
FT                   AKTRHPRGYMQGNYLDQRQQVAMAERPFEFFMNRFRLLEPAPRADFSAYTGVDEATIRP
FT                   QLEAALAQGYISETPSHWQVTPHGKLFLNSLLELFL"
FT   CDS_pept        complement(280906..281499)
FT                   /codon_start=1
FT                   /gene_family="HOG000293319" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410479"
FT                   /gene_name="rdgB"
FT                   /locus_tag="ETAF_0235"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ADM40359.1"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="UniParc:UPI0001BD0124"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G5"
FT                   /transl_table=11
FT                   /translation="MQHVVLATGNAGKVRELASLLTDFGLDIVAQSSLGIEGAEETGLT
FT                   FIENAILKARHAARLSGLPAIADDSGLAVDALGGAPGIYSARYAGEDASDRANLEKLLH
FT                   ALRDVPAGQRQARFHCVLVYLRHADDPTPLVCHGVWEGEIADAPSGDGGFGYDPIFFVP
FT                   ALGCTAAQLSREQKRAISHRGQALQQLLDRMRHA"
FT   CDS_pept        complement(281581..281871)
FT                   /codon_start=1
FT                   /gene_family="HOG000019208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410480"
FT                   /locus_tag="ETAF_0236"
FT                   /protein_id="ADM40360.1"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="UniParc:UPI0001BD0125"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G6"
FT                   /transl_table=11
FT                   /translation="MSAVSREGDDWILRLYIQPKASRDLIIGLHGDELKVAITAPPVDG
FT                   QANAHLLKFIAKQFRVAKSRITLEKGELGRHKQLRISQPQQIPDAVAAALE"
FT   CDS_pept        complement(281868..282422)
FT                   /codon_start=1
FT                   /gene_family="HOG000257384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410481"
FT                   /locus_tag="ETAF_0237"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40361.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniParc:UPI0001BD0126"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G7"
FT                   /transl_table=11
FT                   /translation="MLTLTFLVKTLLDLYVMVLLLRIWMQWARSDFYNPLSQFIVKLTQ
FT                   PVVAPLRRILPPLGPIDSASLLLAFILMTVKYPLLLLIQSGSLSLSPYNLLFGLISVVK
FT                   SAGYLVFWVIIIRSIMSWISQGRSPMDYVLYQLTEPMMAPIRRIIPAMGGLDFSAMVVI
FT                   LVLYLLNYLGIDLFGQLWFLL"
FT   CDS_pept        complement(282528..283238)
FT                   /codon_start=1
FT                   /gene_family="HOG000048983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410482"
FT                   /locus_tag="ETAF_0238"
FT                   /protein_id="ADM40362.1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="UniParc:UPI0001BD0127"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G8"
FT                   /transl_table=11
FT                   /translation="MNTTIKHNLDAVRQHLVRAAEQCGRDPRDITLLAVSKTKPIEDID
FT                   AAIAAGQRAFGENYVQEGVSKIQHYRQQPQGDALEWHFIGPLQSNKSRPVAEHFDWIHT
FT                   VDRVKIAQRLNEQRPAELEPLNVLIQVNISDEQSKSGITLEQIDALADAISQLPRLRLR
FT                   GLMAIPAPEDDPARQLAVCTRMAQALSALQRRYPQLDTLSLGMTHDMEAAITAGSTLVR
FT                   IGTAIFGARDYGTA"
FT   CDS_pept        complement(283409..283831)
FT                   /codon_start=1
FT                   /gene_family="HOG000016954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410483"
FT                   /locus_tag="ETAF_0239"
FT                   /function="nuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40363.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001BD0128"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6G9"
FT                   /transl_table=11
FT                   /translation="MNPRTILAFDFGTRSIGCAIGQELTGSARPLQSFKANDGAPDWQQ
FT                   IEKVLREWQPDLVVVGLPLNMDGSEQPLTQMARKFANRLHGRFGVQIALQDERLSTVEA
FT                   RAHLFAGGGYRALEKGRVDAASAALILESWFEHQTY"
FT   CDS_pept        complement(283831..284394)
FT                   /codon_start=1
FT                   /gene_family="HOG000281193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410484"
FT                   /gene_name="yqgE"
FT                   /locus_tag="ETAF_0240"
FT                   /protein_id="ADM40364.1"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniParc:UPI0001BD0129"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H0"
FT                   /transl_table=11
FT                   /translation="MKLAHHFLIAMPAMQDSRFKRTVIYVCEHNEDGAMGMIINKPLEQ
FT                   LTLSSLLEKLDITPSPRDAAIRLDKPVLAGGPLAEDRGFVLHSPTDTFGSSADIGPGCM
FT                   LTTSRDVLETLGTDRQPQEILVTLGYCSWSKGQLEQELLDNAWLTVEADSQILFHTPLA
FT                   DRWICAAKKLGVDIRNMPCNAGHA"
FT   CDS_pept        complement(284622..285572)
FT                   /codon_start=1
FT                   /gene_family="HOG000265022" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410485"
FT                   /locus_tag="ETAF_0241"
FT                   /function="ATP binding"
FT                   /function="glutathione synthase activity"
FT                   /protein_id="ADM40365.1"
FT                   /db_xref="GO:0004363"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI0001BD012A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H1"
FT                   /transl_table=11
FT                   /translation="MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGYQLHYMEMDSLYL
FT                   QQGEARAQTRLLSVSDDKASWYRFDGEQDIALADLDVILMRKDPPFDTEFIYATYILER
FT                   AEARGTLIVNKPQSLRDCNEKLFTAWFADLTPDTLVTRSAAHLRDFHARHGDVILKPLD
FT                   GMGGASIFRIQQDDPNLSVIIETLTEHGKRFCMAQNYLPAIVDGDKRVLVIDGEPVPYC
FT                   LARIPKSGETRGNLAAGGRGEARPLSESDWAIARKVAPMLKEKGLIFVGLDIIGDRLTE
FT                   INVTSPTCAREIEAAFPVSITGMLMDAIEARLAAR"
FT   CDS_pept        complement(285605..286336)
FT                   /codon_start=1
FT                   /gene_family="HOG000015265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410486"
FT                   /locus_tag="ETAF_0242"
FT                   /function="methyltransferase activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="ADM40366.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI0001BD012B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H2"
FT                   /transl_table=11
FT                   /translation="MRIPRIYHPQPLSIPGEVSLCDDAANHVGRVLRMGPGQALQLFDG
FT                   SNRVFDAEIISADKKSVRVRLNHVQEADRESPLHLHLGQVMSRGEKMEFTIQKSIELGV
FT                   SVITPLISERCGVRLDAERMAKKQQQWQKIAIAACEQCGRNRIPQIRPAMDLEAWCAEE
FT                   DDCLRLNLHPRASASINTLPQPLTRVRLLIGPEGGLSAAEIAMTADYRFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
FT   CDS_pept        complement(286440..287153)
FT                   /codon_start=1
FT                   /gene_family="HOG000281182" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410487"
FT                   /locus_tag="ETAF_0243"
FT                   /function="deoxyribonuclease I activity"
FT                   /protein_id="ADM40367.1"
FT                   /db_xref="GO:0004530"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniParc:UPI0001BD012C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H3"
FT                   /transl_table=11
FT                   /translation="MSPKSFIALSTLLGSLLLTSGAQAETIHNFSQAKAAAVKINRDAP
FT                   GTFYCGCRIDWQGKKGTPDLASCGYQVRKNAHRAERIEWEHVMPAWQFGHQLQCWQEGG
FT                   RKNCAKNPNYVRIETDLHNLQPAIGEVNGDRNNFAFSQWRGGEGQYGQCTMKVDFKNKQ
FT                   AEPPERARGAIARTYFYMRDRYHIRLSPQQTRLFEVWDRQYPVSDWECQREARVAAVQG
FT                   NHNPYVQQACAARKP"
FT   CDS_pept        complement(287268..287795)
FT                   /codon_start=1
FT                   /gene_family="HOG000281171" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410488"
FT                   /gene_name="sprT"
FT                   /locus_tag="ETAF_0244"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40368.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniParc:UPI0001BD012D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H4"
FT                   /transl_table=11
FT                   /translation="MLAAMNTPRLPIALQQAVMHTLRRCLSLAEQRLNQPLPLPQIDYR
FT                   QRGTVAGTAWPQQWQIRLNPVLLQENGQAFIDSVIPHELAHLLVYRRFGRVAPHGREWR
FT                   WMMAEILGVEPQRTHRFSVDSVRGRTFTYRCACQQHQLTLRRHNRVQRGESSYRCRQCG
FT                   AALSFTPDATPA"
FT   CDS_pept        288157..289476
FT                   /codon_start=1
FT                   /gene_family="HOG000164506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410489"
FT                   /gene_name="cadB1"
FT                   /locus_tag="ETAF_0245"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40369.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001BD012F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H5"
FT                   /transl_table=11
FT                   /translation="MASVKKIGLIACTGVVAGNMMGSGIALLPANLASLGSIAVWGWLI
FT                   ALVGAVSLAYVYARLATKNPQEGGPVAYAGEVGAAFGFQTGVLYYHANWIGNLAIGITA
FT                   VSYLSTFFPVLNSPVPAGIACIAIVWIFTFVNMLGGAWVSRLTTLGLVLVLIPVIGTGI
FT                   AGWFWFEPTTYMANWNTSGGTDYHAIIKSILLCLWAFIGVESASVSTGMVKDPQRNVPL
FT                   ATMMGTFLAGIVYIAATQAIAGMYPAHQMAASGAPFAISASTMVGSWAGPVVSAFTAFA
FT                   CLTSLGSWMMLVGQAGARAAHDGNFPKIYGELDKNGLPKKGLFLAALKMTVLMVLITVM
FT                   NASGGKASDLFGELTGIAVLLTMLPYFYSCIDLIRFDGANIKNVLSLLASILGCVFCFI
FT                   ALMGANSIELSGTFIVSLIILMFYSRKLGSAQDKGSAPRT"
FT   CDS_pept        289550..291700
FT                   /codon_start=1
FT                   /gene_family="HOG000164394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410490"
FT                   /locus_tag="ETAF_0246"
FT                   /function="lysine decarboxylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40370.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008923"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001BD0130"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H6"
FT                   /transl_table=11
FT                   /translation="MNIIAIMNDMSAYFKEEPLRELQQELEKAGFRIAYPHDRNDLLKL
FT                   IENNARLCGVIFDWDKYNLALCEEISALNKMLPIYAFANTYSTLDVSMSDLRLNVRFFE
FT                   YTLGSAQDIALKIRQSTDQYIDAIMPPLTKALFKYVHEEKYTFCTPGHMGGTAFEKSPV
FT                   GTLFYDFYGENTLRSDISISVAELGSLLDHSGPHREAEEYIARTFNADRSYIVTNGTST
FT                   ANKIVGMYSSPAGASILIDRNCHKSLTHLMMMSSVVPLYLRPTRNAYGILGGIPRQEFT
FT                   REAIEEKVRNTPNATWPVHAVVTNSTYDGLFYNTDYIKQTLDVKSIHFDSAWVPYTNFH
FT                   PIYQGKAGMSGERVPGKVIYETQSTHKLLAAFSQASMIHVKGIINEETFNEAYMMHTST
FT                   SPHYGIVASAEMSAAMMKGNTGKRLIANSIERAIRFRKEIKRLRTESEGWFFDVWQPDN
FT                   IDEVACWPLNSRNDWHGFKNIDDDHMYLDPIKVTLLTPGMKADGTMDSWGIPASIVSKY
FT                   LDEHGIIVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRVYDLNLRVKNVLPSLYQE
FT                   APEFYENMRIQELAQGIHTLTSESRLPDLMYSAFDVLPTLVLTPHDAFQEEVRGNIESC
FT                   PLQQMIGRVSANMILPYPPGVPLIMPGEMITEASKPVLDFLQLLCDIGAHYPGFETDIH
FT                   GVQCNGKGEYEVVVLKNHGAQG"
FT   CDS_pept        complement(291774..292934)
FT                   /codon_start=1
FT                   /gene_family="HOG000249104" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410491"
FT                   /locus_tag="ETAF_0247"
FT                   /function="ATP binding"
FT                   /function="glutathionylspermidine synthase activity "
FT                   /protein_id="ADM40371.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008885"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI0001BD0131"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H7"
FT                   /transl_table=11
FT                   /translation="MKRIAISERPDWRAKASEFGFQFHTMYGEPYWCEDAYYQFSMAQV
FT                   EALEQTTAELHQMCLQVVEKVVDSEALLSRFQIPKHTWDFVRASWRSGQPSLYSRLDLA
FT                   YDGQGPAKLLENNADTPTSLYESAFFQWIWLEDQVRAGKLPAAADQFNSLQEQLIARFA
FT                   ELKANHGFQLLHMACCQDSDEDRGTVQYLQDCAAEAGLATEFLYMDEIGLGEKGQFTDP
FT                   QDQVISNLFKLYPWEFMLREIFSTKLEDAGVRWLEPAWKSILSNKALLPMLWEMFPNHP
FT                   NLLPAYFADGSQPPLDRYVVKPLFSREGANIRIVENGQEIERVDGPYGEEGMIVQQYHP
FT                   LPQFGDSYTLIGSWLVNDSPAGIGLREDRSRITQDLSRYYPHIILD"
FT   CDS_pept        complement(292938..293615)
FT                   /codon_start=1
FT                   /gene_family="HOG000140314" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410492"
FT                   /locus_tag="ETAF_0248"
FT                   /protein_id="ADM40372.1"
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniParc:UPI0001BD0132"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H8"
FT                   /transl_table=11
FT                   /translation="MKRTKHINRSAFRKRWQMAPLALAVSAVFLLAGCEKSDETVSLYQ
FT                   NADDCSKANPSMSAQCKTSYDDALKEAAKTAPKYATREDCIAEFGEGQCTQTPAQAGMA
FT                   PTTGNTNAEAAQSGGSFWMPLMAGYMMGRLMGGGFNQQPLFTPRGAASPANGQFVDASG
FT                   KSYGPATAGGRTMNVPKTAMAPKPATTTTVTRGGFGETVAKQNSLQRSSASGTGTGSRS
FT                   MGG"
FT   CDS_pept        complement(293785..294522)
FT                   /codon_start=1
FT                   /gene_family="HOG000224683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410493"
FT                   /locus_tag="ETAF_0249"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADM40373.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniParc:UPI0001BD0133"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6H9"
FT                   /transl_table=11
FT                   /translation="MKHDRHQAIVQLVAEHGTLSTEALAQRLDVSRETIRRDLNTLQKQ
FT                   GKIVRRHGRATGLGGETQDSGDPFNARLKSHLSGKAEIARQALEWIDSGMTLALDASST
FT                   CYYLAKQLPDVEITVFTNSLRICQALAKRQRIQLISSGGLLQRKYACYVNPAILSQLKA
FT                   LEIDLFIFSCEGIDGRGGLWESNAYNADFKALLLKRAAQSLLLIDKSKFNRAGEIQIGT
FT                   LDDVAQVISDMHDDDASLPDGGV"
FT   CDS_pept        complement(294577..294999)
FT                   /codon_start=1
FT                   /gene_family="HOG000219041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410494"
FT                   /locus_tag="ETAF_0250"
FT                   /biological_process="carbohydrate transport"
FT                   /protein_id="ADM40374.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="UniParc:UPI0001BD0134"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I0"
FT                   /transl_table=11
FT                   /translation="MLKNISPLISPQLLKTLAEMGHGDEIIFADAHFPAHAMGPQVIRA
FT                   DGLSVSDLLAAIIPLFELDSYAPPLVMMAAVEGDTLDPAVEARYLTALFADAPAQPVTR
FT                   IDRFAFYQRAQQAFAIVITGERAKYGNILLKKGVTP"
FT   CDS_pept        complement(294993..296456)
FT                   /codon_start=1
FT                   /gene_family="HOG000124178" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410495"
FT                   /locus_tag="ETAF_0251"
FT                   /function="L-fuculokinase activity"
FT                   /protein_id="ADM40375.1"
FT                   /db_xref="GO:0008737"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013450"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI0001BD0135"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I1"
FT                   /transl_table=11
FT                   /translation="MTHDVVLVLDCGATNVRAIAVDAHGNVVAQAAQANASQAGAEDAR
FT                   WHVWSLEAILQRFADCCRQIAPQLANARIHALTVTTFGVDGALVDRHGELLYPVISWKC
FT                   PRTTAEMEGIERYISAETLQTLSGIGQFSFNTLYKLLWFKHHHPELLEKAHAWLFISSL
FT                   INQRLTGEFTTDRTMAGTSQLLDVRNELFSDTILRSTGLRSDLFPRMVAAGEHIGHLLP
FT                   TMAQFLGLPTGIPVIAAGHDTQFALFGSGAGLEQPVLSSGTWEILMVRTPQVNTALLPQ
FT                   HRGSTCELDSCQGLFNPGLQWLASGVLEWIRQLYWPDAARQEAYRSMIAEAAAVAPGCD
FT                   GLRMNSQLLLSDGRAGWQGVTLNSGRGHFYRSALESLGWQLRHNLHTLQTLGGFQAQSL
FT                   LLVGGGSRNALWNQIKADILGIPVRVLANAETTVLGAALFAWSGAGYYASADRAREAVT
FT                   FTYHDYIPGEQRAQYQALQPTAPIRSHTC"
FT   CDS_pept        complement(296505..298286)
FT                   /codon_start=1
FT                   /gene_family="HOG000249674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410496"
FT                   /gene_name="fucI"
FT                   /locus_tag="ETAF_0252"
FT                   /function="L-fucose isomerase activity"
FT                   /function="manganese ion binding"
FT                   /biological_process="fucose catabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40376.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008736"
FT                   /db_xref="GO:0019317"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR005763"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniParc:UPI0001BD0136"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I2"
FT                   /transl_table=11
FT                   /translation="MNKQHSLPKVGIRPAIDGRRMGVRESLEAQTMEMAQATARLISEQ
FT                   LRHPCGAPVECVIADTCIAGMAEAAACEEKFSRSNVGLTITVTPCWCYGSETIDMDPLR
FT                   PKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDSGDDSIPADVQQKLLRF
FT                   TRAGLAVAGIKGKSYLSLGGVSMGIAGSIVDHDFFESWLGMKVQAVDMTELRRRIDNQI
FT                   YDQDELALALEWADAHFRYGPDLNAEQYRRSPEENRRVLRESLLMAICIRDMMQGNPKL
FT                   AERGWEEEALGYNAVAAGFQGQRHWTDQYPNGDTAEALLNSAFDWHGVRRPLVVATEND
FT                   SLNGVAMLFGHMLTGTAQIFADVRTYWSPQAVERVTGQRLEGLAEHGIIHLINSGSAAL
FT                   DGTCRQQDAEGHPTIKPHWQISQQEADACLAATEWCPAIHEYFRGGGFSSRFLTRGGVP
FT                   FTMSRVNLIKGVGPVLQIAEGWSVELPEEMHDILDNRTNATWPTTWFVPRLTGNGPFKD
FT                   VYSVMANWGANHGVLTIGHVGADLITLASMLRIPVCMHNVTDDAIYRPSAWAAHGMDSE
FT                   GQDYRACQNYGPLYKRA"
FT   CDS_pept        complement(298375..299679)
FT                   /codon_start=1
FT                   /gene_family="HOG000267862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410497"
FT                   /locus_tag="ETAF_0253"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ADM40377.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001BD0137"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I3"
FT                   /transl_table=11
FT                   /translation="MSDITSKSTSAGNIASAAQRIAVVPKNILIPFVLLTSCFALWGLA
FT                   NNMTDVLIAQFRKVFTLTDMQSGLVQTAFYGAYFCLALPAALFIKRFSYKAGVLLGLGL
FT                   FCSGALLFYPASQIMAYGPFLLALFILAGGLSILETSANPYIIAMGPQETATRRLNLAQ
FT                   SFNPIGSITGVLIGKFYILAQLNPATDAERTVMDPDALASIQSAELSAVMGPYVVVALV
FT                   IIMVWLAIAFTRMPVAHDSSSAESTLKQSFSRLLSKGYFVRGVVGQFFYVGAQIGCWSY
FT                   TIRYVMAEMGGNEAEASTYLLLSIVLFSAFRFVCTALMKFVSPAILLGLLASLASASLL
FT                   LVMFVGGIAGVYGLVAVSACMSLMFPTIFGLSVHGLGKDTQFGGSCLIMAILGGAVLTA
FT                   LMGQISDMAGIRMAFLIPLLGFVYLIHFGFKGHRA"
FT   CDS_pept        300698..301345
FT                   /codon_start=1
FT                   /gene_family="HOG000218184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410498"
FT                   /locus_tag="ETAF_0254"
FT                   /function="L-fuculose-phosphate aldolase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="fucose metabolic process"
FT                   /protein_id="ADM40378.1"
FT                   /db_xref="GO:0006004"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008738"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004782"
FT                   /db_xref="UniParc:UPI0001BD0139"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I4"
FT                   /transl_table=11
FT                   /translation="MERETLARAIIDTCLEMTRLGLNQGTAGNVSVRYRDGMLITPTGI
FT                   PYEQLRCDQIVYVDGEGQHEEGKLPSSEWRFHLAAYQARPDANAVVHNHAIHCTAVSIL
FT                   NRPIPAIHYMIAAAGGNTIPCAPYATFGTRTLSDYVTEALKYRRATLLQHHGLIACGEN
FT                   LQKALWLAHEVEVLAQLYLATLAIVDPVPVLSDEEIAVVLEKFKTYGLRIEE"
FT   CDS_pept        301358..302506
FT                   /codon_start=1
FT                   /gene_family="HOG000243333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410499"
FT                   /locus_tag="ETAF_0255"
FT                   /function="lactaldehyde reductase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40379.1"
FT                   /db_xref="GO:0008912"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniParc:UPI0001BD017D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I5"
FT                   /transl_table=11
FT                   /translation="MAHRMILNETAWFGRGAIAELPAEIQRRGYRKALIVTDATLVACG
FT                   AVARVTKHLDSAGLAYALFDGVVPNPTIRVVQQGLAVFRDSGADYLIAIGGGSPQDTCK
FT                   AIGIISNNPAFEDVRSLEGLSPTTRPSVPILAVPTTAGTAAEVTINYVITDEEQRRKFV
FT                   CVDPHDIPQAAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTDALHLKAIE
FT                   MIGGALRASVNGDAEAGATMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANA
FT                   ILLPHVMRYNAGACGEKFRDIARALGVACDDLSLDQAAAAAIAAVEALNRDVGIPPSLR
FT                   EVGVCEEDIVRLAEAALADVCTGGNPRSATLRDIEQLYRQAY"
FT   CDS_pept        complement(302569..303138)
FT                   /codon_start=1
FT                   /gene_family="HOG000125837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410500"
FT                   /locus_tag="ETAF_0256"
FT                   /protein_id="ADM40380.1"
FT                   /db_xref="UniParc:UPI0001BD017E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I6"
FT                   /transl_table=11
FT                   /translation="MIYFDRNRLLQLDPRFLKQQRVSLLILSLLLLLGGLFCLFRPLAS
FT                   GNALSAVVGILLLLSGVGLIIGMIANRANNLWPMIGGILMGAAYLVMGFIFIRSPEVGL
FT                   FTVAVLVATLFALGGIARLMAGVKLKGAHGGWLQVIIGLLDLLIAWMLISAGPQGSILL
FT                   VTMIVGIEMLFSSFSLFQVAQLLKQR"
FT   CDS_pept        303636..304457
FT                   /codon_start=1
FT                   /gene_family="HOG000200177" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410501"
FT                   /locus_tag="ETAF_0257"
FT                   /protein_id="ADM40381.1"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniParc:UPI0001BD017F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I7"
FT                   /transl_table=11
FT                   /translation="MVSCLAVMCYLWHEDFNVNLTLGPFSLLGVAIAIFLGFRNNASYA
FT                   RFIEARVLWGSLLITTRSLMRQAISLMPHPGGEHRRFAMLLTAFSYALKHHLRHEPMAM
FT                   ELTRLLPSQDKAAVLGSCSPCNRLLQLMGQWLGEQRRRGYLSDIDFQTIDTNLNQLSVI
FT                   LGGCERISNTPIPFAYSLIVHRTVYVFCALLPFALVSDLHYMTPLVSVFISYTFIALDA
FT                   LAEELEDPFGIEANDLPLNAMAHTIEANLRDMINDHTHLARICPDSHCRLD"
FT   CDS_pept        complement(304526..305209)
FT                   /codon_start=1
FT                   /gene_family="HOG000281891" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410502"
FT                   /gene_name="torD"
FT                   /locus_tag="ETAF_0258"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40382.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR023069"
FT                   /db_xref="UniParc:UPI0001BD0180"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I8"
FT                   /transl_table=11
FT                   /translation="MSTAGPLTAQHYACLYAWLAGLFAHEADEAQLARLRSPDTQAWLD
FT                   LLCQQAPLRPALQHLQAALAALETRPDARLELAADFAGLFLLSQKRAALPYASCYQGET
FT                   PRFRQAICVEMQSLLRQAGMQLNADFHEPEDHLSIFLELLSHLSFASAEQPEHQESERM
FT                   QLRRTTLNLLLGWLPAFSARCVRYDPFGFYGALSQLLLALVQQDADLNAVERVSPAATP
FT                   GPIAG"
FT   CDS_pept        complement(305206..307755)
FT                   /codon_start=1
FT                   /gene_family="HOG000284391" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410503"
FT                   /locus_tag="ETAF_0259"
FT                   /function="electron carrier activity"
FT                   /function="molybdenum ion binding"
FT                   /function="trimethylamine-N-oxide reductase (cytochrome c)
FT                   activity"
FT                   /function="trimethylamine-N-oxide reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="periplasmic space"
FT                   /protein_id="ADM40383.1"
FT                   /db_xref="GO:0009033"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0042597"
FT                   /db_xref="GO:0050626"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006658"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011887"
FT                   /db_xref="UniParc:UPI0001BD0181"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6I9"
FT                   /transl_table=11
FT                   /translation="MNHNESVRISRRRFLSQLGGLTALGMFGPSLLVSRDAQAQAGTAA
FT                   AGGVQEGILTGSHWGAIRATVVDGRFVAAKPFEKDSYPSKMVAGLPDHVHNTARIRYPM
FT                   VRIDWMRKRHLSDTRQRGDNRFVRVSWDEALDLFYQELERIQTTYGPSALLSGSGWQST
FT                   GMFHNAAGMMGRALALHGNSVGTGGDYSTGAAQVILPRVVGSMEVYEQQTSWPLVLKNS
FT                   KTIILWGSDLLKNQQANWWCPDHDVYQYYAQLKEKVANGEIRVVSIDTVVSSTHDYLGR
FT                   DKVQHIAVNPQTDVPLQLALAHTLYSEKLYDAHFLDNYTVGFDQFLPYLLGTQDGQPKD
FT                   AEWAAKLTGIDAETIRALARQMAAGRTQIIAGWCVQRMQHGEQWSWMIVVLAAMLGQIG
FT                   LPGGGFGFGWHYNGAGTPSRKGIILSGFSGATTIPPLHNSSDYRGASSTIPIARFIDAM
FT                   LEPGKKIDWNGKQVTLPALKMCVFAGTNPFHRHQQINRMIAGWQTLETVVAIDNQWTST
FT                   CRFADIVLPATTQFERNDLDQYGNHSNRGILAMKQLVPPQFEARSDFDIFRELCRRFNR
FT                   EQAFTEGLDEMGWIKRIYQEGAQQGKGRGIHLPTFDAFWNGSGYIEFDDPQLFVRHQAF
FT                   RDDPDLEPLGTPSGLIEIYSKSIADMHYGDCQGHPMWFEKAERSHGGPGSARFPLHLQS
FT                   VHPDFRLHSQLCESPTLRAHYSVGGREPVFISPQDADARGIRNGDIVRVFNDRGQVLAG
FT                   AVVSDRYVPGVIRIHEGAWYDPDRGGVAGALCKYGNPNVLTLDIGSSRLAQATSAHTAI
FT                   VEVEKYRGPLDPVTAFNGPQEMVAQCQYVPLQTEETP"
FT   CDS_pept        complement(307770..308927)
FT                   /codon_start=1
FT                   /gene_family="HOG000284378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410504"
FT                   /gene_name="torC"
FT                   /locus_tag="ETAF_0260"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40384.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR009154"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniParc:UPI0001BD0182"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J0"
FT                   /transl_table=11
FT                   /translation="MKNLWNRLNRPSARWSVLALLALGIVIGLALIVLPHVGIKLTSST
FT                   EFCVSCHSMQPVYQEYKQSVHFKNASGVRAECHDCHIPPDVPGMVKRKLEASNDIYQTF
FT                   IAHSIDTPEKFEAKRAELAEREWKRMKENNSATCRSCHNYDAMDHAKQHPEAAKQMAIA
FT                   AKDNQSCIDCHKGIAHQLPDMSSGFRKQFAELRQTASDDGNTLYTLDMKPIYAAKGDKE
FT                   PAGSLLPASEVTVLKRDGDWLQVQIEGWTETNGRQRVLSLLPGKRIFVSSIRDQVQQNA
FT                   KTLEKTTVAATGVEWSKLQTTAWVQKGDLVNNIKPIWAYADALYNGTCNQCHGAPEKAH
FT                   FDANGWIGTLNGMIGFTSLDKREERTLLKYLQMNASDTGGADQKH"
FT   CDS_pept        309059..309754
FT                   /codon_start=1
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410505"
FT                   /gene_name="torR"
FT                   /locus_tag="ETAF_0261"
FT                   /function="DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40385.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001BD0183"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J1"
FT                   /transl_table=11
FT                   /translation="MAMTHHIVIVEDEPVTQARLRDYFVQEGYQVSVTASGAGLRELML
FT                   LQPVDVILLDINLPDENGLMLTRALRERSTVGIILVTGRCDRIDRIVGLEMGADDYVTK
FT                   PLELRELVVRVKNLLWRIDLARQAQPAADNCYLFAGYCLNVSRHTLTLDDEPIRLTRAE
FT                   YEMLLAFVTNPGAILSRERLLRMLSSHRVDSPDVRTVDVLIRRLRAKLRPDLFVTQHGE
FT                   GYFLAAEVA"
FT   CDS_pept        complement(309762..310796)
FT                   /codon_start=1
FT                   /gene_family="HOG000288658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410506"
FT                   /locus_tag="ETAF_0262"
FT                   /protein_id="ADM40386.1"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR014301"
FT                   /db_xref="UniParc:UPI0001BD0184"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J2"
FT                   /transl_table=11
FT                   /translation="MYRRHTLFLCLLWLSTATAHADAPLLRWPSDRQSVQLRQPPLHAV
FT                   KRWKLCALYPSLKDAYWLSINDGMIRAADRLGVTLKVFEAGGYRQQATQREQMALCRDW
FT                   GADAILIGSSTARFPALATLAAGIPLIEVVNALHDPAIRTRIGVPWFQMGYQPGRYLAQ
FT                   RLGQRPLKVLLMPGPRDAGGSREMSDGFKAALSGSRLQIVDVAYGDNDIEVQRNLLQDM
FT                   LERHPDIDVVAGTAIAAEVAMGEGRNRATPLTIVSFYLSHQVYRGLKRGRILAAASDQM
FT                   VWQGELAVEQALRTLQGERVPDNVSPPILVLTQRNVSSALVRRSLSPLGFRPVYLYQPA
FT                   PKAE"
FT   CDS_pept        310876..313668
FT                   /codon_start=1
FT                   /gene_family="HOG000118852" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410507"
FT                   /gene_name="torS"
FT                   /locus_tag="ETAF_0263"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40387.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014302"
FT                   /db_xref="UniParc:UPI0001BD0185"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J3"
FT                   /transl_table=11
FT                   /translation="MGTPSLTRRLWLAFALMAALTLGSVLVGWFSLHYVGRVEQANTQA
FT                   LLPTMNMARQLSEAGAYELFSAQSLSNADSEREWLAQGQMLTAQSLKISRLLDELRRQG
FT                   FDIDTIAQQETEITRSLGEQGALVGQRLQLRMRARALSAQVAAAAEQIAELAKGQASNA
FT                   ATAAGATQAGIYDLIEQRRAAAAEQALDRLIDIDLEYLNQMSELRLSALRVQQMIMALE
FT                   SDSGRLALSEQEERLAQALRILQRRQQRVEDPRIRAQIAQALGQVAQYRTLVDLYRQDN
FT                   DIYARLQALSQNNLDLFTRFSAEISRQVSDIELRNAAALEHLQQARRLGLTWLTLLGGA
FT                   GLLALCLILWRVVYRSLSQPLAHQTAALQRLLDGDFDSPFPDRAGVRELDTIGRLMEAF
FT                   RTSVRALRHQRQHLADLVQMRTAELQALVVEHRQARAEAENADRAKSAFLAAMSHEIRT
FT                   PLHGILGTAQLLAEQPISPQSRGYVQAINDSGESLLAVLNDVLDYSAIEAGSSSVVLND
FT                   EPFSPRQLLDSLLRLAEGRLRERPLRLAHDYADALPAWLQGDPRRIRQIVMNLLNNALR
FT                   FTERGVICVSCGCDETHWWIAVQDSGCGIDPAQQAAIFQPFVQLSARRGGTGLGLAICR
FT                   GLAQAMAGSLELSSTPGKGSRFCLRLPLRRAALPPPEAPAQAWSLVGRRLLLIEDNPLS
FT                   QRISAEMLQSAGVQVHIAGSAAEAQALLARDTAFDAALVDFDLPDSDGPTLARQMAEAY
FT                   PQLKRIGFSAHVLDEAQHRRIRPLFCGMIQKPVPRAELCRLIAHALADGEHSTVRPTRI
FT                   VRQIAAPLDDEQLAEDVATFGQPCLTEWLALFRQHSLPLLAEIAAARAAGDADQVKGLA
FT                   HRLKSSCASLGMRGVADACLALERAPLTAAALDEPIREGLAALEAWLAKVSESDDGKIT
FT                   "
FT   CDS_pept        313768..313908
FT                   /codon_start=1
FT                   /gene_family="HOG000156611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410508"
FT                   /locus_tag="ETAF_0264"
FT                   /protein_id="ADM40388.1"
FT                   /db_xref="UniParc:UPI0001BD0186"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J4"
FT                   /transl_table=11
FT                   /translation="MWQLKRQAPALHKKTRRINLGWAIALLLLGGSMALAAVIYLIISA
FT                   L"
FT   tRNA            complement(314256..314331)
FT                   /gene_name="tRNA-Phe"
FT   CDS_pept        314930..315532
FT                   /codon_start=1
FT                   /gene_family="HOG000122901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410509"
FT                   /locus_tag="ETAF_0265"
FT                   /protein_id="ADM40389.1"
FT                   /db_xref="InterPro:IPR021236"
FT                   /db_xref="UniParc:UPI0001E35425"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J5"
FT                   /transl_table=11
FT                   /translation="MFSTFTWAADAAPTAPASAAAAAAGLSAQQVQDVAKVAQQGFTAM
FT                   RDMQYARVALFRGYPDVATKLTDQSAGLLADDSTDWKSFIKSDKKAPLAGDNYVIINAS
FT                   IALSEDFVATPEKQKAIAKANEKLSKGDRKGALEELRLAGVGITETQYLMPLKQTRQAV
FT                   AHAQSLLKAGKYYEANLALKGAEEGIITDSVTLVDGK"
FT   CDS_pept        complement(315640..316215)
FT                   /codon_start=1
FT                   /gene_family="HOG000127273" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410510"
FT                   /locus_tag="ETAF_0266"
FT                   /function="specific transcriptional repressor activity "
FT                   /protein_id="ADM40390.1"
FT                   /db_xref="GO:0016566"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniParc:UPI0001BD018A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J6"
FT                   /transl_table=11
FT                   /translation="MQREHILTQALRRLEQHGLADATLPALIDSETLPLDQARRYWPDS
FT                   EALLYDCLRFHGQQIDTWRRQLLLNDTLSHDDKILARYPVLAEHVEQGRFPGCLFISAC
FT                   IQYPAADHPIHQLASRQKQASFDFTLHLLQESEIGDASLVAHQMELVQEGCLNRLLVSR
FT                   RREDVDIALHLAQDILHIAHCRRHDALS"
FT   CDS_pept        complement(316248..317966)
FT                   /codon_start=1
FT                   /gene_family="HOG000254981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410511"
FT                   /gene_name="dsbD"
FT                   /locus_tag="ETAF_0267"
FT                   /function="electron carrier activity"
FT                   /function="protein-disulfide reductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="cytochrome complex assembly "
FT                   /biological_process="electron transport chain"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40391.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017004"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0047134"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="UniParc:UPI0001BD018B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J7"
FT                   /transl_table=11
FT                   /translation="MAQRIFALIALFITTLLPAQASLFGEQPRFVPVNQAFAFDFQQRG
FT                   EHLTLRWQIQPGYYLYRQQIRITPHQAQLGPWQLPPGIPHHDEFQGETAIFRDGLSLTL
FT                   PLLSAAAGGEISVTYQGCAAAGFCYPPETRRIPLEAITATAGALPSPGAATANTEHAPT
FT                   LPFPALWALLIGIGIAFTPCVLPMYPLISALILGQKQRHGWGHTALLALVYVQGMAITY
FT                   TVLGMVVAAAGLRFQAAFQHPYVLIGLSLLFILLALSMFGAFTLQLPASLQTRLTLWSN
FT                   RQRSGSLLGVFVMGALAGLICSPCTTAPLSAILLYIAQSGNLWVGGGTLYLYALGMGIP
FT                   LIAVTLFGNRLLPRSGPWMQHVKEGFGFVILALPVFLLERILGEAWGMRLWSLLGIAFF
FT                   LWGFSLSLHARRRGTRLWQILLLGAALICARPLQDWVFDGAPRASTGVNETLAFQPIDS
FT                   PQQLAQALAQAKARRQPVMLDFYADWCTACKEFEKYTFSNDAVRSQLAGTLLLQANVTA
FT                   NTEQHAQLLQQLNVLGLPSILFFTPDGQPLDNARVTGFMDAERFLAHLRQLPQAQ"
FT   CDS_pept        complement(317942..318310)
FT                   /codon_start=1
FT                   /gene_family="HOG000222826" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410512"
FT                   /gene_name="cutA"
FT                   /locus_tag="ETAF_0268"
FT                   /biological_process="response to metal ion"
FT                   /protein_id="ADM40392.1"
FT                   /db_xref="GO:0010038"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="UniParc:UPI0001BD018C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J8"
FT                   /transl_table=11
FT                   /translation="MSQTVTPFTAAAAVPVDHSDAVVVLCTAPDEACAQELAAALLGEK
FT                   LAACVTLIPGATSLYYWEGKLEQEYEVQMIIKSERRHQQALLAYLKHQHPYQTPELLVI
FT                   PVQAGDQDYLSWLNASLR"
FT   CDS_pept        complement(318447..319748)
FT                   /codon_start=1
FT                   /gene_family="HOG000272417" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410513"
FT                   /gene_name="dcuA"
FT                   /locus_tag="ETAF_0269"
FT                   /function="C4-dicarboxylate transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40393.1"
FT                   /db_xref="GO:0015556"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniParc:UPI0001BD018D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6J9"
FT                   /transl_table=11
FT                   /translation="MLVLELVIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVAPGKI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVHQTEKVLRKNPKYITILAPIVTYLLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGIS
FT                   YLHLLMVVLPSTFLAVLVMSLIVSWCFDSKLSNDPVYRKRLEEGLITLRGDKQIEIKKG
FT                   AQTSVWLFLLGVVAVVAYAIINSPSLGLVAKPLMNTTNAILIIMLSVATLTTIICRVDT
FT                   DNVLNSSTFKAGMSACICILGVAWLGDTFVSANIDWIKETAGTVIQNHPWLLAVIFFFA
FT                   SALLYSQAATAKALMPMALALNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGKLVFNHPFFIPGTLGVALSVCFGFLLGSVML"
FT   CDS_pept        complement(319864..321300)
FT                   /codon_start=1
FT                   /gene_family="HOG000061737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410514"
FT                   /locus_tag="ETAF_0270"
FT                   /function="aspartate ammonia-lyase activity"
FT                   /biological_process="aspartate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="ADM40394.1"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006531"
FT                   /db_xref="GO:0008797"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR003031"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI0001BD018E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K0"
FT                   /transl_table=11
FT                   /translation="MSNNIRIEEDLLGTREVPADAYYGVHTLRAMENFYISNDKISDIP
FT                   EFVRGMVMVKKAAALANRELQTIPRKIADTIILACDEVLNNGKCMDQFPVDVFQGGAGT
FT                   SVNMNTNEVLANIGLELLGHKKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASIMKL
FT                   IDAIKNLREGVDRKADEFKNILKMGRTQLQDAVPMTLGQEFHAFSVLLNEEVKNLQRTA
FT                   ELLLEVNLGATAIGTGLNTPEGYQKLAVQKLAEVSGLPCVPAEDLIEATSDCGSYVMVH
FT                   GALKRTAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQLC
FT                   FKVIGNDTCVTMAAEAGQLQLNVMEPVIGQAMFESISLLTNGCYNLREKCIDGITANKE
FT                   TCEKFVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAQLDDIFS
FT                   VENLMHPAYKAKRYTDESEK"
FT   CDS_pept        321665..322141
FT                   /codon_start=1
FT                   /gene_family="HOG000272432" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410515"
FT                   /gene_name="fxsA"
FT                   /locus_tag="ETAF_0271"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40395.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniParc:UPI0001BD018F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K1"
FT                   /transl_table=11
FT                   /translation="MRWLPFILIFFYVYIEISIFIKVAAVLGVALTLLLVILTSCLGAS
FT                   LVRNQGMKTLMQMQQKLAMGESPAAEMIKSVSLVMAGLLLLLPGFFTDFLGLLLMLPPV
FT                   QKRLALKLLPYFRIYRSGGPGDGGGPGGGPGGGGHTFDGEFERKDDDRQRLDNK"
FT   CDS_pept        322358..322651
FT                   /codon_start=1
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410516"
FT                   /gene_name="groS"
FT                   /gene_synonym="groES"
FT                   /locus_tag="ETAF_0272"
FT                   /function="ATP binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40396.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniParc:UPI0001BD0190"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K2"
FT                   /transl_table=11
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVIAVGH
FT                   GRILENGDVKPLDVKVGDTVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
FT   CDS_pept        322711..324354
FT                   /codon_start=1
FT                   /gene_family="HOG000076290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410517"
FT                   /gene_name="groL"
FT                   /gene_synonym="groEL"
FT                   /locus_tag="ETAF_0273"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein refolding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40397.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0042026"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="UniParc:UPI0001BD0191"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K3"
FT                   /transl_table=11
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   SPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANADDTVGQLIA
FT                   EAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTAGTVISEEIGMELEKATLEDLGQAKRVVINKDTTIIIDGVGEES
FT                   AIQGRVTQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALVRVAAKLVDLKGINEEQNVGIKVALRAMEAPLRQIVANA
FT                   GEEPSVVTNNVKAGEGNYGYNAATEEYGDMIDMGILDPTKVTRSALQYASSVAGLMITT
FT                   ECMVTDLPKEEKADLGAAGMGGMGGMGGMM"
FT   CDS_pept        complement(324651..332738)
FT                   /codon_start=1
FT                   /gene_family="HOG000028265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410518"
FT                   /locus_tag="ETAF_0274"
FT                   /protein_id="ADM40398.1"
FT                   /db_xref="UniParc:UPI0001BD0192"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K4"
FT                   /transl_table=11
FT                   /translation="MTTDSKSATLNNNPTANNHIDNVKAFTVSGFDLVITFADGRVSTV
FT                   KDGLTDLVLGNIKLSDTTGSEITQSQVISSINTIQLGLDTVYLADKIEDKDKSTESETP
FT                   AQFSELPGVDEPAIEKIQQENLQKKISEYDELLKKQEDALREIVKEKDKVEQQKEIIDK
FT                   KVKSTLSTNLKPHEMDVQEAPPKPPIPPAPLSSSSSSASENASGKQNDVEAKPALSDLP
FT                   LFISGALDEKSDSGKIGDGLTNLTTPTFIGNATPGATATLTINGTPYPLTVDSEGKWAL
FT                   QIQPGLPDGAYDVTLNIVDGNGKTATTTIKITIDSQIDELTAMLDPDSDSGVANDAITN
FT                   NSKPILLGTAEPGAIIKVVIGSLTLTTITDAEGNWSVSPSSNLPDGSYDYIVTATDEAG
FT                   NSTTTQNTLTIDTTAPGIVFSLSAATDSGIAGDFTTNITQPVLTGSTEPGATIIVRLWG
FT                   NAYEIIADPQGNWELTINPALGDGNHEFTVQITDIAGNVSSQSGNLTIDTQAPTITASL
FT                   SSDSDSGSSQTDNITNNAHPVLTGYTKPLAVITITFAGEHYSVKADENGHWSWAIPENL
FT                   SLADGTHPYQLTVSDTAGNKLSTPYQGEFTLDTSPPEPPEPPTATLSDESNSGSLDDMI
FT                   TNVATPTLVGQSEPLAIIHVTIDGKTYQTQANETGEWHLLLDTLSDGTHTITVSAEDQA
FT                   GNISKPSGEMTLVIDTRTPEVTVTLAEGDDSGSSQSDGITAVNQPTFHGSATPNTTLLF
FT                   TINNHAYRIEVGADGQWRLPIDEPLADDSYHYTITVENAAGSTTTIDGTLVIDTTPPPA
FT                   DAGLDEASDSGRDPQDGITNVVKPTLTGHSEPGARVEITFNDTLYSQTSDADGMWSISL
FT                   KDSLSDGTYTYTVKTTDSAGNTSTAEHHFTIDTLSHVDARLDFTSAIPGDNDSTTDQIR
FT                   PKLSGKAEPGSLVTVEFNGHSYSASVDELGNWQLTLPSDAVPGTNSYTVTAEDLAGNIS
FT                   TVTGQFTYIPSGNQPPKVSAQLDPDSDSGIQGDSITNVKKPTIVGQATPGVTILLTIAG
FT                   NSYTTIAAADGSWSIDISQPLNEGHNGYTVVATDPNSGLSSTINNNIFIDSLAPGATVV
FT                   LTDASDSYIKGDMITSDRRPQFTGKTEPGATVSLIIDGVTFTTTADQNGNWLLGPSHTL
FT                   PNGTLGYTVIMTDIAGNQNTTQGNITIDSSTPRMNNAALNEIDDTGVQDRYWTNLLTPT
FT                   IKGWAEPGVKLTISINGNIYDITDISSDGTWRFQLPHGIALDNGLEQEIKYWVTATDSA
FT                   GNSAGTVDAIFIAKRKLTITDGLSEETDSDTKGDKLTSVTNPTLQGTISGGAASDNLHG
FT                   TITIGGKTYPLTITDGGTHWSFSLPADAALSFGVHEYTLTLVDKFGTETTHTATITRTM
FT                   LSGNLDFNDDSGIAGDNITNNTAPALSGKATIGSTLRIEFAGREYDIPVNANGIWTFPL
FT                   PGAPLAEGEYTYKLTESAGQNTTTFNGTFTVDLTPPEVSGGLSTQDQAPNDPSASTNPN
FT                   PTLQGHVEPHREVTVLIDGKRFTTTADANGFWSITLDSNLQPGQSYEYTITSTDSAGNT
FT                   GQYTGTISNGHVQPPLVSFGTHEDYLGGESDKVNEVFYNTSSPPLIGHGTPGDTITLSA
FT                   LTEHGQAYTATVNADGTWKIDLPPELFPSGIPALGATHWSLTVTDSYGIQNTYVINMIP
FT                   DVTPPSLTGELDPLSDSGIAGDGITNVDRPTLKGTTEPGLKVTITLAGQSYTVNADDSG
FT                   QWQFTVPRALADGTYDYQITTVDKAGNSATISGSVTIDSASLVLNGGLDSQADPNVVDG
FT                   WTNNHHQTLKGITEPGAVIAIVLNGISYTPVVSATGEWTLDLPDLPNGHYAYTITATNT
FT                   AGTTAAINGQFTIDDLPPTTTVRLSAASDSGVSGDAITNVDKPTFIGQTKPGATVTLHI
FT                   DGHDYTTVADHAGNWQITVTTPLGEGEHDYRVSVTDRSENSSTPVEGALTIKTEALIGQ
FT                   VTGGLDRDSDSGTLEDSITNNATPNFSGSAPAGVTVIVTIDGKTYRTVADQSGHWKLAV
FT                   TTPLSEGDHPYQIVIKDVAGNQSAPLTGSLTLDRACHLQVQGLASESDSGTVGDGITNT
FT                   TTPTLIGLSDAHATITLTIAGNLYTTTADASGQWRIPLTHPLGEGNHDYHVVATDSAGN
FT                   TSSSTAQVTIDTQAPSAPGGGLASESDSGTVGDGITNNTTPTLIGLSSAHATITLTIAG
FT                   NLYTTTADASGQWRIPLTRPLDEGSHDYHVVATDNAGNTSSSTAQVTIDTQAPSAPGGG
FT                   LSSTSDSGTVGDNITTVTTPMFNGTTEPNATIALTLNNQTYRFSAADDGTWRFTLPESA
FT                   ALSDGTYHYTLQASDKAGNVSAQTQGSITIDTQAPAAPDGGALVDPDGDNIIAVATPVF
FT                   NGTTEPNAMIMLTLNQKTYLIPSDNRGAWYFTLPESASLSDGTYHYTLQASDVAGNTSA
FT                   LTTHTLTIDTRPPEPLQGALVPDADGGALSEGITQQNTPTFSGSAEAHAEISLSIDHKE
FT                   YVTTADDAGKWQLTVDHPLTDATYDYTITAKDAAGNASQLHHQLTVDTFPPTQPNAHAE
FT                   ANTLDDSVTLKGTVDAQESVQITVTLNGHDYQASIDGENWQVALPSQEVKPGENPYTIT
FT                   ATDAAGNTATASGTFTQASTSDTPPHTDYQAQDMAALSAIVTDHINVEAEHYEL"
FT   CDS_pept        333405..334505
FT                   /codon_start=1
FT                   /gene_family="HOG000028262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410519"
FT                   /locus_tag="ETAF_0275"
FT                   /protein_id="ADM40399.1"
FT                   /db_xref="UniParc:UPI0001BD0194"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K5"
FT                   /transl_table=11
FT                   /translation="MYWLGLLFYILSGLSYVAFPAVKNMVNQALLLAPQISYACAVLFI
FT                   YPLAIFLCHLIFRIKSKKYYLLLATQTKLAASIAVSLGLIGTFIGLTDMILAISSSLGG
FT                   DGNLATKMNAMISSISTALGAMSYAFLTSIVGVSISVLLLISLSFWAFYYKSEKEDDSK
FT                   PERERSLELQELLKRISVIESVNVNIANKLIAIPENTQLTEMLAKNSADMVMHLGKIEE
FT                   GLQTIGHSIKKVGEENIEKSSHMLEILSGIEGNGISTGNKLERCIERLSEFNIQMNVQR
FT                   IMFKEHFENVCDSGISNAKSINEMLAAQATQTNLFKEHFEFVQKMSHANHEQLKNIIDS
FT                   QANYINEQGRFKNKLKDVLKVIANEN"
FT   CDS_pept        334495..335718
FT                   /codon_start=1
FT                   /gene_family="HOG000028261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410520"
FT                   /locus_tag="ETAF_0276"
FT                   /protein_id="ADM40400.1"
FT                   /db_xref="UniParc:UPI0001BD0195"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K6"
FT                   /transl_table=11
FT                   /translation="MKIKSLAIILCAIIASPFAQAKQATENYVDFINSVYDQSDMIHIK
FT                   ILELESELLRSKQTNFYYSPKVSAESKYKTDNSRGEIFDSKVMVNSLIYSSSLPERFKE
FT                   KDSRIRSAELGLLKEKENLYKSTMENLVGIKYYSDLDLKAQKLEREAISLYNQIEGRYL
FT                   SGIAKASDVEQAKLLIQRIKTESEGINKEIELLKANIELSTGIQYPAQGVYLPDTILNK
FT                   INSYKADEKKIYNNLDYQLIGEQAESAKFNAQQQDNLMQLSLVAEERYNNRRRVDNDSY
FT                   AGIQVSVNVFDLDRKVAKQTGMKSYEVLKRRMDFKYKESMAKIRTLQLTSNSNQKEIKG
FT                   MEDQLNTTSIIIANQKQEYNISQSSYYEMLNTQYDYFSLERRITDMKISETINKISLLQ
FT                   VTGNLLSL"
FT   CDS_pept        335721..336956
FT                   /codon_start=1
FT                   /gene_family="HOG000028260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410521"
FT                   /gene_name="hlyD"
FT                   /locus_tag="ETAF_0277"
FT                   /protein_id="ADM40401.1"
FT                   /db_xref="UniParc:UPI0001E35438"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K7"
FT                   /transl_table=11
FT                   /translation="MSDSIISRKLMILLGVMLVLVFYICIAKIDIVTPGTGVITGAADK
FT                   LVIVSPDSGFINKFDLKTGSLVKQGDILFSYTNLEVFHQEKTLNELVLFADTRIHNLEE
FT                   DQRLLKMILDGNVSKEKGFSSQNTSIPVQELSAFKLLNEYFSLKNEEDNLKLREQKMLE
FT                   EKDDLNHRVLLLKRKGGLLRSAKAPEIEIINNQSEVSQIISQITSGDISLLSLQNDMKA
FT                   ASNRFRSSVLEQLNNNSDQLQVLRRERLENIGRLELLRSKIIANSVVSPINGVVLSIER
FT                   NFDKGSYVENSQPVMTIKKNNENKVIDAKILSKYRPFIYADASVKIVINSPGYKNNING
FT                   HIAKISADSFSDDEARGGERYYKVEIKPDDKAVVPPELEGVQVNVYALSKKITLLNYMT
FT                   ALVGDNITFNVW"
FT   CDS_pept        337365..339332
FT                   /codon_start=1
FT                   /gene_family="HOG000028259" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410522"
FT                   /locus_tag="ETAF_0278"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ADM40402.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniParc:UPI0001BD0199"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K8"
FT                   /transl_table=11
FT                   /translation="MKNNFFDIMRKYCFIEGERFNTKNKSTEMQDVIININEYIVNYFF
FT                   EFTVTSVSYQNNMSLPKTFVVEWGESNYIILQRESNRLINLTSSITIANDDLINKRVFF
FT                   LSKELKKIDDNDAFSAIKKMTPRASYFSLGLIFFALITPLYSNLFNTRLIYSDSYNSIF
FT                   FVTGVFILFVILELLLKSIVYAKTAQQVKTNNITCNAFYLYLLKLSNCRNAAVKIRTID
FT                   SSATALWESYPLIPVDFSLALLFLVCLFSMMSIYAFPLFIYYIILTFLCVYVRFSAYKK
FT                   TLQTNTSSYEKMSTLISLEEKRKELKFLRGNFCEKLLMDKTTKDEYTKMEMNIDNHHWA
FT                   ELIKSNSFVSMVVMFICSYFAVVNGALTTASIIAIMIINSRLSGALVGGINKMYLSKLH
FT                   AFHIKSSLGELLKDRDQCISHNGIAISHIENFSVSHLTIPFLDSALVNGLSLSAVPGDI
FT                   IGITGASGTGKSSLIKALSNSFNDYSGTIKLNNVDIKNVSADYINNCISYHSTNSRFIK
FT                   GTLRENFMVYGIVNDQDIIDILSLCCKKLTLSRENIDEKYVDELNLSNGERQKVLLCMA
FT                   LFKKPEVIFLDESTSFLSSADAITFLEEIKSCYAHAIVFFATHDIALKNMFTQIVTLPY
FT                   GEVMSHNDSVINIPMLKIKR"
FT   CDS_pept        complement(340544..346549)
FT                   /codon_start=1
FT                   /gene_family="HOG000001675" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410523"
FT                   /locus_tag="ETAF_0279"
FT                   /protein_id="ADM40403.1"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniParc:UPI0001E35439"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6K9"
FT                   /transl_table=11
FT                   /translation="MYEQYFGDAVGLFGKDNLQRNPYAFTVGVNYTPFPLLTLGVDQRL
FT                   GKNSEHDTQFNVQLNYRIGDDWRAQVDPSAVPHSRLISESRYNLVERNNNIVLEYQKQN
FT                   IMHLSLPSDTLSGQPGSEHMISAILQTKYGLQDIVWQDAEFISAGGKLQRQDKTHFNLT
FT                   LPSYRYSATARRSGSHATAQAEIAANTYHLSATAFDTKGNQSNTINLTVTVEPPTVFQG
FT                   KFEVQHDNAVANGSDAISVDYILTDESGGRVANKTILMTTNNGAKPSNAEINTDQHGVA
FT                   RLNVTNTAAGATLITATVNGVSQTQSVNFIADSAHPDANKSILLASPKSIVANGKDATA
FT                   LTLQLKDAYGNPISGQSVTFISSESSGITVSSTTDSGNGNYSATLSGTRAGPLQITVAI
FT                   DGKPLLGRSAPVTLTADSSQPDAAKSTLTATPDHIVANGTDAATLTLTLKDINDNPIDG
FT                   QKVAFISSERDGVAISHTTDHGNGSYSATLNGTRAGTTQVTVTVDGKPLAVSAAAVTLS
FT                   ADGSRPDATRSLLEAKPSQIVANGTEAAALMLTLKDVNGNLISGQRIAFISSENTGITV
FT                   SSATDEGNGRYTATLRGTRAGITQVSVTIDGTPLAVHAARVTLTADSSNPNADKSILEA
FT                   NPSRIVANGVDAATLTLTLKDINDNLISGQSVAFISSEKNGVHISNTTDEGNGRYRATL
FT                   SGTRAGITQVTVAVDGNPLAVSAATVTLTADSSKPDAALSTLEAKPNQIVANGTEAAAL
FT                   ALMLKDVNGNPISGQRIAFISSENTGIVISGATDEGNGRYSATLKGTRAGATQITVTVD
FT                   GKPLAVSAATVTLTADSSKPDATLSTLAVTPNQIVANGADSAALALILKDINGNPISGQ
FT                   SVAFISSEKNGVRISQTTDEDNGRYSATLSGTRAGMTQVTVTVDGKPLAVSAVTVTLHA
FT                   DSSKPDASLSSFAVNPHEIVANGSDAATLTLLLKDINDNPLAAQNLAFISSETNGVSIT
FT                   TTADEGNGRYSATLTGTRAVSTQITVKVNGVTLGVAAETVRLKADSSNPDAGQSALVVD
FT                   PSRIVANGKDNATLTLTLKDVNGNLLAGQTVAFSGDLGIVVGRTVDHGDGTYSAVLTAG
FT                   ITAGSARILTTVNGNELRLNAPSLTLTADSSQPDATKSTLAAKPDQIVANGTEAAALTL
FT                   TLKDINGNPISGQNVKFVSSEKSGISVGNTSDEGNGRYRAALSGTRAGMTQVTVTIDGN
FT                   PLAVNAVTVTLTADSSKPDAALSTLTAKPEQIVANGIEASTLTLALKDIHDNPISGQRV
FT                   AFISSENTGITVSSTTDDGSGNYSATLSGTHAVSTQITVTVNGVALAIDAKTVNLTADS
FT                   SNPDAAKSSLKATPKTIVANGSDASTLTLTLKDVNGNLISGQTVAFISSEHDGITVSGT
FT                   TDNGNGDYSATLQGTRAIGTQITVTVNGQPLAVSAATVTLTADSSHPDSARSTLVAAPT
FT                   QIVTDSTQASTLTLMLMLKDINDNPISGQDVAFISSEKDGIHLTATAEKGNGSYSATLT
FT                   GTRAGTTEITVTVGGKALAVHAATVTLIADSSKPDATLSTLEANPYNLEATTGASGRAT
FT                   LTLTLKDVHGNPIAGQEVVLSTDLGSISDGGRTTGHADGTYTATIYAGTAAGIAHVTTQ
FT                   LNGSAFPLNLEVPINGDSSAPDPSKSSFEATPNLIVANGVETSALKLTLRDAHLNPISS
FT                   QDVKFISSKTNGITISSTTPLNDGTYHATLAGTEAFTTTITVTVNGNPMNASLHTTVTL
FT                   NGNKDHLDSAQSTLALDNATAEANSPIALTLTLKDTHGNPVSGQRVKFISSAPEYSTFG
FT                   AVRDDGNGVYTATVSNIIPGSIDISVEVNGTALATLTEKATFTAMNVVISDTKTQNNQL
FT                   SVNPGTEGSRPTATNLYLLRNSDNKVLAARYGVNSSEWGAFDIGNGLSDSDEYSVLASN
FT                   GAGAYRWAIYKYQLKRNYAEALVGWNTLLDNTARHYDVGTRLWNNTTSVDYPVPTMASL
FT                   DCSIVKTCL"
FT   CDS_pept        348882..349007
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410524"
FT                   /locus_tag="ETAF_0280"
FT                   /protein_id="ADM40404.1"
FT                   /db_xref="UniParc:UPI0001BD01DF"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6L0"
FT                   /transl_table=11
FT                   /translation="MKASLILPGYLNHSLTENHLNICCNLIFLYAFHHIHGQVSL"
FT   CDS_pept        349692..350039
FT                   /codon_start=1
FT                   /gene_family="HOG000286601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410525"
FT                   /gene_name="yjeI"
FT                   /locus_tag="ETAF_0281"
FT                   /protein_id="ADM40405.1"
FT                   /db_xref="UniParc:UPI0001BD01E0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6L1"
FT                   /transl_table=11
FT                   /translation="MRIKGLLGLAAVMLLAGCSTMTQLSSAGQQVKFTDTKPGTECQLL
FT                   GEAVGTQSNWLSGQGGETSSMRAAANDLRNKAAAMGGNVVYGAVSPSESFWSSFAPLDS
FT                   KMSGQVYKCPN"
FT   CDS_pept        complement(350123..350818)
FT                   /codon_start=1
FT                   /gene_family="HOG000086052" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410526"
FT                   /gene_name="ykgG"
FT                   /locus_tag="ETAF_0282"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="ADM40406.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="UniParc:UPI0001BD01E1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6L2"
FT                   /transl_table=11
FT                   /translation="MNNRDEFLATIARQLGREVRHTPQPRPQPINDYAQTRLTELSPQQ
FT                   RCDAFIDVASNVMLAHCERCSEAEAAQAALRLCQRYGQTPTLVSGDQRLAQLGITETLV
FT                   RECPATVWDPALGAENLRMAEQAKVGVVYAEYGLTESGGVVLFSSALRGRALSLLPESS
FT                   VFVLRKSTILPRVAQLASLLHQRAQRGERMPSCINLIGGPSSTADIELIKVVGVHGPVN
FT                   AAYLIVEDC"
FT   CDS_pept        complement(350818..352239)
FT                   /codon_start=1
FT                   /gene_family="HOG000262102" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410527"
FT                   /gene_name="ykgF"
FT                   /locus_tag="ETAF_0283"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40407.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI0001BD01E2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6L3"
FT                   /transl_table=11
FT                   /translation="MSLKTSDVKFKDRIRLQLDDAVMRKAVANAQERIGANRQKMVDEL
FT                   GHWDEWRERAEQIRDHVLDNLDAYLYQLAEKVTENGGKVYFAKTKEDATRYILQVAQAK
FT                   NAKKVVKAKSMVTEEIGMNHALQQAGIQVVETDLGEYILQLDQDPPSHVVVPAIHKDRT
FT                   QIRRVLHETLGYDGPETPEAMTLFIRQKIRQDFLSADIGVTGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPPTHIAVMGMERIAPTFEEVDVLITMLARSAVGARLTGYNTWLTGPREAD
FT                   NLDGPQEFHLVIVDNGRSSILGSPFRAVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYANFKDLPYACSLCTACDSVCPVNIPLSKLILRHRQAMVEAGLPPKAE
FT                   QRATRLFTYANSHPGLWKVGMIAGARAASWFIKGGKAPINAGALAEWTAARDLPQADGE
FT                   SFRSWFKQHKAQGNK"
FT   CDS_pept        complement(352250..352969)
FT                   /codon_start=1
FT                   /gene_family="HOG000262113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410528"
FT                   /locus_tag="ETAF_0284"
FT                   /protein_id="ADM40408.1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniParc:UPI0001BD01E3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T6L4"
FT                   /transl_table=11
FT                   /translation="MNVNFFVTCLGDALKSRMARDSVLLLEQLGCTVHFPEKQGCCGQP
FT                   AINGGYVKDAIPGMKTLIRALEENDDPIISPAGSCTYAVKSYPSYLSDEPEWALRAERV
FT                   ANRMVDLTSFIVNTLGVQDVGARLPGRAVYHPSCSLLRKMKVREEPLTLLSHVRGLELL
FT                   PFPAAETCCGFGGTFSIKMAEISGEMVKEKVSHMMEVQPEYLIGADISCLINIGGRLQR
FT                   EGLPVKVMHIAEVLMSR"
FT   CDS_pept        complement(353019..354572)
FT                   /codon_start=1
FT                   /gene_family="HOG000253321" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410529"
FT                   /locus_tag="ETAF_0285"
FT                   /function="lactate transmembrane transporter activity "
FT                   /protein_id="ADM40409.1"
FT                   /db_xref="GO:0015129"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniParc:UPI0001BD01E4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T701"
FT                   /transl_table=11
FT                   /translation="MPAYLPFFLGILPLAVMIILILKLKTPIHLAVLITLALTLAVTGL
FT                   YWHTPLQTLGSALIYGALKGLWPIVIVILGAIYSYNLMLKTGSMDILRDVLAAVSDDKR
FT                   IQVLLIAWCFGGFLEAAAGYGTAVAIPIGILIALGFNPLKAAIASLVANTVPTAFGAVG
FT                   IPVSILAEQVNLPVTALSGTIISQLALFNILLPFVIVAIIGGGVKALRGVFTLTLLCGI
FT                   STLIPQYLVAIKLGAELPAFAGSLVSLIVVTLMAKARRGETAAEYRIDGAHLKGNVRYS
FT                   APQLLRACAIYLLIFIFILLCSPLFPAIRSTVAQVASVLPFPLANGQVLKLKIDWIATP
FT                   GVLIIIATLIGGVIQGAALRQMLQVFVATVKQLKNSIIAISAIVAMATVMDVSGLIATL
FT                   AQTLVNVTGGGYLFIAPIIGALGTFVTGSDTNSNVLFGKLQTMAAEKLHVDPLWLAAAN
FT                   TSGATGGKMISPQSIAIAVSATRMDGQGSAIMSGTLKYCCAYIVILGLKVGLVYYLFMS
FT                   "
FT   CDS_pept        complement(354811..355839)
FT                   /codon_start=1
FT                   /gene_family="HOG000223517" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410530"
FT                   /locus_tag="ETAF_0286"
FT                   /function="catalytic activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /protein_id="ADM40410.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniParc:UPI0001BD01E5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T702"
FT                   /transl_table=11
FT                   /translation="MAHIVTQKGQPREDWLQQLADVVTDPADLLAQLGLSDHPQWLAGC
FT                   EARRLFPLRVPRAFISRIRRGDPNDPLLRQVMSDAAEFIETPGFSTDPLEEQHSVVPGL
FT                   LHKYQNRALLLVKGGCAVNCRYCFRRHFPYQENQGTRANWQRAVAYLHEHPELDEIIFS
FT                   GGDPLMAKDHELDWLFTQLEQLPHLRRLRIHSRLPVVIPARVTDALCQRMADSRLQMVL
FT                   VTHINHANEIDEALSEAMGRLKQAGVTLLNQSVLLRGVNDSADTLAALSNALFDAGILP
FT                   YYLHVLDKVQGGAHFMVPDDEARRLMHGLLAQVSGYLVPRLTREIGGEPSKTQLDLHLR
FT                   QQ"
FT   CDS_pept        355927..356448
FT                   /codon_start=1
FT                   /gene_family="HOG000010047" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410531"
FT                   /locus_tag="ETAF_0287"
FT                   /function="translation elongation factor activity "
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40411.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniParc:UPI0001E3543A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T703"
FT                   /transl_table=11
FT                   /translation="MMDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGKLIEKTFKSTD
FT                   SAEGADVMDVNLTYLYNDGEFWHFMNNETFEQLAADAKAVGDNAKWLLDQAECVVTLWN
FT                   GQPIAVTPPNFVELEIVETDPGLKGDTAGTGGKPATLTTGAVVKVPLFVQIGEVIKVDT
FT                   RSGEYVSRVK"
FT   CDS_pept        356657..356959
FT                   /codon_start=1
FT                   /gene_family="HOG000268007" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410532"
FT                   /gene_name="sugE"
FT                   /locus_tag="ETAF_0288"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40412.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniParc:UPI0001BD01E7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T704"
FT                   /transl_table=11
FT                   /translation="MLIAGLLEVVWAISLKYSHGFTRLWPSVVTLLAMAASVLLLAHAM
FT                   KTLPAGTAYAVWTGIGAVGAAIMGIILLGESASPLRLLSLGLILCGILGLKFSHT"
FT   CDS_pept        complement(357028..357387)
FT                   /codon_start=1
FT                   /gene_family="HOG000281495" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410533"
FT                   /gene_name="frdD"
FT                   /locus_tag="ETAF_0289"
FT                   /biological_process="fumarate metabolic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40413.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006106"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="UniParc:UPI0001BD01E8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T705"
FT                   /transl_table=11
FT                   /translation="MMNNKVYKRSDEPVFWGLFGAGGMWGAIFAPAVILIVGILLPLGM
FT                   FPDALTFERALSFSQSIIGRIFWLLMIILPLWCGLHRLHHMMHDLKIHVPAASWVFYGL
FT                   AAILSVVALIGIFTL"
FT   CDS_pept        complement(357401..357799)
FT                   /codon_start=1
FT                   /gene_family="HOG000281484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410534"
FT                   /gene_name="frdC"
FT                   /locus_tag="ETAF_0290"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40414.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="UniParc:UPI0001E3543B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T706"
FT                   /transl_table=11
FT                   /translation="MTTSTKRKPYVRGMSSNWWQKLGFYKFYMLRESSALENVWFSIVL
FT                   IYGVFSLKDGAAGWESFVAFLQNPLVLVLNIISLLLAVLHTKTWFELAPKAANIVVNDE
FT                   KMGPAPIIKALWVVTIVATVVVLGLALL"
FT   CDS_pept        complement(357816..358550)
FT                   /codon_start=1
FT                   /gene_family="HOG000160590" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410535"
FT                   /locus_tag="ETAF_0291"
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="succinate dehydrogenase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="ADM40415.1"
FT                   /db_xref="GO:0000104"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI0001BD01EA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T707"
FT                   /transl_table=11
FT                   /translation="MAEMKNLKMEVMRYNPEQDAEPRFVTYEVPYDDTTSLLDALLYVK
FT                   DNLAPDLSFRWSCRMAICGSCGMMVDNVPKLACKTFLRDHPNGMRVEALANFPVERDLV
FT                   VDMTHFIESLEAIKPYVIGNDRKPEDGTNKQTPAEMEKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPVLNTQNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESAKDFMIAMLKPQ"
FT   CDS_pept        complement(358543..360219)
FT                   /codon_start=1
FT                   /gene_family="HOG000160475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410536"
FT                   /locus_tag="ETAF_0292"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="succinate dehydrogenase activity"
FT                   /biological_process="anaerobic respiration"
FT                   /biological_process="electron transport chain"
FT                   /protein_id="ADM40416.1"
FT                   /db_xref="GO:0000104"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0009061"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR004112"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="UniParc:UPI0001BD01EB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T708"
FT                   /transl_table=11
FT                   /translation="MRSHTVAAEGGSAAVTQAHDSFDFHFHDTVAGGDWLCEQDVVDHF
FT                   VHNCPREMTQLELWGCPWSRKPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSL
FT                   KYPQIQRFDEHFVLDILVDDGQARGVVAINMMEGTMVQIRANAVILATGGAGRVYRYNT
FT                   NGGIVTGDGMGMAFKHGIPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRY
FT                   LQDYGLGPETPLGEPKNKYMELGPRDKVSQAFWHEWRAGRTISTPRGDVVYLDLRHLGA
FT                   KKLHERLPFICELAKAYVGVDPVNEPIPVRPTAHYTMGGIETDQSCETRIKGLFAVGEC
FT                   SSVGLHGANRLGSNSLAELVVFGRVAGESALQHLQNVTPANGTALDAQVKDIEGNLKAL
FT                   VNQEGNENWATLRDEMGTSMEEGCGIYRTTDLMQKTVDKLAELKERFKRVKITDTSSVF
FT                   NTELLYAIELEHGLNVAECMAHSAINRRESRGAHQRLDEGCTERDDVNFLKHTLTYFNE
FT                   SGAPRIEYSDVKITKLPPAKRVYGAEAEAQEAKKKEEKANG"
FT   CDS_pept        360811..361788
FT                   /codon_start=1
FT                   /gene_family="HOG000236579" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410537"
FT                   /gene_name="yjeA"
FT                   /locus_tag="ETAF_0293"
FT                   /function="ATP binding"
FT                   /function="lysine-tRNA ligase activity"
FT                   /biological_process="lysyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40417.1"
FT                   /db_xref="GO:0004824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006430"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0001BD01ED"
FT                   /db_xref="UniProtKB/TrEMBL:E0T709"
FT                   /transl_table=11
FT                   /translation="MSDTASWQPSAPVANLLKRASILSTIRRFFSDRGVLEVDTPSMSQ
FT                   ATVTDVHLVPFQTHFVGPGVAQGMTLYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEES
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLECESAETLSYQQAFIRHLDVDPLS
FT                   ADKTQLREAAAKLDLSNVADNEEDRDTLLQLLFAFGVEPHIGKERPAFVYHFPASQASL
FT                   AQISTEDHRVAERFEVYYRGVELANGFHELTDAAEQRLRFEQDNRKRAAAGLPQQPIDE
FT                   HLLAALEHGMPDSSGVALGVDRLIMLALSAERLSEVIAFSVDRA"
FT   CDS_pept        complement(361844..365167)
FT                   /codon_start=1
FT                   /gene_family="HOG000281473" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410538"
FT                   /locus_tag="ETAF_0294"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40418.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniParc:UPI0001BD01EE"
FT                   /db_xref="UniProtKB/TrEMBL:E0T710"
FT                   /transl_table=11
FT                   /translation="MRQILQRILLSGLLLLLLPGLAQATLNERQLALDLKQAEAAKSAP
FT                   AQAETVDALQSALGWIDEAKASAQRTQQYRRAISDFPRLTRELRQQLSDESQPPAPAAL
FT                   PPASDAEQRMLQISSQLLEVARQLQQEQDRARDISDSLSQVAQKQAATRKALSEAERRL
FT                   QALTVTETALSQAQSAQLQAEVAARKAQVDELELEQLSANNRQELIRLQSEVLSRRHER
FT                   LDLQLQGLRNSLNSQRQRDAEEALERTRRLVEQSDNLPRSIVEQLTINQTLSRDLNHQA
FT                   QRLDDIAGRQRTIAGQTQQVRLALNTLREQAQWLSVSPALGETLRDRLARLPEMPKPQQ
FT                   LDSDMARLRVQRLRYEALLDKLAPASDYRQNDGEPLSGAQQRLLAPQLATQRELLNSLL
FT                   SGCDSQILELTKLKVANTQLIEALTEVREATHRYLFWAADIDPVGLGYLLTTLRALDRL
FT                   LSLDTLSQLSQATMMMLTDRTTLLPLCAALLLVGFSVYSRRYYSAFLARAAGRVGKVNQ
FT                   DHISLTLRTLLWSILVALPLPVLWAAVGYGLSNAWPYPVAVAIGEGVSAALPVLWAFMI
FT                   SAAFSRDSGLFIVHFGWGERQVRRAMRYYRMSIWLIVPLLMAVVTFNNLADRSFTATLG
FT                   RACFIMLCLALLLLTTSLRRAGIPLYLNRAGSGENLLNHLLWGGLLCAPAAAILAALLG
FT                   YLGAAQVLLARLETSVAIWFCLLMVYSVIRRWMLIQRRRIAFERAKQRRAERLEKRSRH
FT                   DEDGLHPAGVEGSQEVDESVVDLDAISERSLRLVRSILTMIALVSLIWLWSELHSAFAF
FT                   LENIRLWDVTASGVGGETLQPITLGAVLIAILVILVTIQLVKNLPALLELGLLQHLELS
FT                   PGTGYAITTITKYLLMIVGGLIGFSLLGIEWSKLQWLVAALTVGLGFGLGEIFGNFISG
FT                   LIILFEKPIRIGDTVTIRDLTGTITRINTRATTISDWDRKEIIVPNKAFIMEQFINWSL
FT                   SDPITRVVLTVPAEASANSQRVTELLLQAAGQCSLVLATPAPEVYLVDIQQGIQIFELR
FT                   IYASEMAHRMPLRHELHQLILAAYRQHDLVLPFPPIQIGSDSLRQVRGGQRRGFSAGGV
FT                   "
FT   CDS_pept        complement(365224..366141)
FT                   /codon_start=1
FT                   /gene_family="HOG000282407" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410539"
FT                   /gene_name="psd"
FT                   /locus_tag="ETAF_0295"
FT                   /function="phosphatidylserine decarboxylase activity "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="ADM40419.1"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="UniParc:UPI0001BD01EF"
FT                   /db_xref="UniProtKB/TrEMBL:E0T711"
FT                   /transl_table=11
FT                   /translation="MDKEANVLDSIKIRLQYLLPKQGLTRLAGWAADKQAGWLTQSAIK
FT                   GFARYYGINMQEALYPDPAHYKTFNDFFVRPLRDGVRPLAEFDDGVVLPADGAISQLGP
FT                   IDADRILQAKGHDYTLEALLAGQYPLADTFRGGQFVTTYLSPRDYHRVHMPCDGQLREM
FT                   IYVPGDLFSVNPLTAANVPNLFARNERLICIFDTAFGPLAQILVGATIVGSIETVWGGC
FT                   VNSERAGIIRRWTYPAEGEHAVALKKGQEMGRFKLGSTVINLFAPGRIQFDRALSAGSI
FT                   TRMGRELGHAPAAAQESAADPESA"
FT   CDS_pept        complement(366248..367252)
FT                   /codon_start=1
FT                   /gene_family="HOG000006957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410540"
FT                   /gene_name="engC"
FT                   /gene_synonym="rsgA"
FT                   /locus_tag="ETAF_0296"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ADM40420.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0001BD01F0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T712"
FT                   /transl_table=11
FT                   /translation="MHANHQRRLQQTDNSAEMDDSLFGDAQDGIVVSRFGKHADVEAAD
FT                   GTQQRCNIRRTLPSLVTGDRVVWRAALQAGSKGIVEAVHPRSSVLTRPDYYDGVKPIAA
FT                   NIDQIVIVSAILPELSLNIIDRYLVACETLCVEPLIVLNKVDLLDDEGREFVEQAMAIY
FT                   RHIGYRVVLVSSHSGEGMAQLQALLTQRISIFAGQSGVGKSSLLNALLPALESQIEVGA
FT                   VSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLDAEQITQGFIEFRDYLGSC
FT                   KFRDCKHGNDPGCALREAVARDDIAETRFDNYHRILEGMAQVKLRKNFGNGDS"
FT   CDS_pept        367441..367986
FT                   /codon_start=1
FT                   /gene_family="HOG000246596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410541"
FT                   /gene_name="orn"
FT                   /locus_tag="ETAF_0297"
FT                   /function="exoribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40421.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016896"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="UniParc:UPI0001BD01F1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T713"
FT                   /transl_table=11
FT                   /translation="MSASETRLIWIDLEMTGLDPQRDRIIEIATLVTDADLNVLAEGPV
FT                   IALHQDDAQLALMDEWNVRTHTASGLVARVKASQYDDAAAEQATLDFLRQWVPAGVSPI
FT                   CGNSVGQDRRFLFRYMPELERYFHYRYLDVSTLKELARRWKPEILEGFKKKNTHQALDD
FT                   IRESVAELAYYRTHFIQL"
FT   tRNA            368168..368243
FT                   /gene_name="tRNA-Gly"
FT   tRNA            368291..368366
FT                   /gene_name="tRNA-Gly"
FT   tRNA            368418..368493
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        complement(368784..369923)
FT                   /codon_start=1
FT                   /gene_family="HOG000272643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410542"
FT                   /locus_tag="ETAF_0298"
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40422.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI0001BD01F3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T714"
FT                   /transl_table=11
FT                   /translation="MTHPLDLHQLAQHIKQWGLSLGFQQVGISDTDLRAEEAPLQAWLD
FT                   SGYHGEMEWMARHGMMRARPDELLPGTLRVISVRMNYLPPSAAFASTLKDPTLGYISRY
FT                   ALGRDYHKVLRARLKKLGEMIQAYCGELHFRPFVDSAPLLERPLAAKAGLGWTGKHSLL
FT                   LNPQAGSWFFLGELLIDLPLPVDTPQTAQCGRCVACITTCPTDAIVAPYKVDARRCISY
FT                   LTIELEGPIPEALRPLLGNRIYGCDDCQMICPWNRLAPLSEEADFLPRAALHAPALTTL
FT                   FAWDESTFLRMTEGSPIRRIGYQRWLRNLSVALGNAPYDAHIVTLLQQRLGISALLDEH
FT                   IHWALAQQRQKRAAQAVEVISSQQRRLIRAVDKGLPRDA"
FT   CDS_pept        369925..371418
FT                   /codon_start=1
FT                   /gene_family="HOG000228406" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410543"
FT                   /gene_name="yjeF"
FT                   /locus_tag="ETAF_0299"
FT                   /protein_id="ADM40423.1"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="UniParc:UPI0001E3544A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T715"
FT                   /transl_table=11
FT                   /translation="MGHSCNRNADSLSHYVAPADWVRNAEARAAAAQGITLATLMQRAG
FT                   LAAFNRGRQCYPTSRRWLILCGHGNNGGDGYVIARLARASGLQVTLMAVAGHSPLPPEA
FT                   QQARAQWLQCGGSEIAASLPLPAAEVIVDALLGIGLSAAPRAPYDGLITAINAHPAPVL
FT                   SVDLPSGLNADTGAAAGAVVRADHTQSFICLKPGLLTGLARAVVGQLHCDPLGLTPWLA
FT                   QQDWPLQRLDGHCLPRWLAPRSPLAHKGDNGRLLLIGGDSGMGGAIRLAGQAALRSGAG
FT                   LVRVLTRAEHVAPLLAAAPELMVKALSPDTLKEALSWAEVVVVGPGLGQGEWGQRALAA
FT                   LASVRKPMLWDADALNLLSGAPSVCEWRVMTPHPGEAARLLGCGIADVENDRPAAVRAL
FT                   QRRYGGVALLKGAGTLIADDARCAIADIGNPGMASGGMGDILSGIIGGLLAQKLTLYDA
FT                   ACAGAVLHGVAADAAARRDGERGMLASDLLPEIRRWANP"
FT   CDS_pept        371449..371913
FT                   /codon_start=1
FT                   /gene_family="HOG000052238" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410544"
FT                   /locus_tag="ETAF_0300"
FT                   /protein_id="ADM40424.1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="UniParc:UPI0001BD01F5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T716"
FT                   /transl_table=11
FT                   /translation="MTSIVLQLPDEAATIALGGALARACQRATVIYLYGDLGAGKTTFS
FT                   RGFLQAMGHQGTVKSPTYTLVEPYLLAPRPVYHFDLYRLADPEELEFMGIRDYFAQDAL
FT                   LLVEWPQQGMGFLPEPDITLHLTYTGGGRQAVIEAHSVHGQSVLAALNGQ"
FT   CDS_pept        371936..373585
FT                   /codon_start=1
FT                   /gene_family="HOG000263828" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410545"
FT                   /locus_tag="ETAF_0301"
FT                   /function="N-acetylmuramoyl-L-alanine amidase activity "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /biological_process="peptidoglycan catabolic process "
FT                   /protein_id="ADM40425.1"
FT                   /db_xref="GO:0008745"
FT                   /db_xref="GO:0009253"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI0001E3544B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T717"
FT                   /transl_table=11
FT                   /translation="MQRFLRITLPLALGWCLATMAGAAQLTNIQVSNGDRQAVVTLTFN
FT                   APPELSHRIERNPDRVLVEIADSKRITGGLPMQFSGENMLSRIRDGGEQRAGKVLLVLD
FT                   TTQRPRVSVARSGNRAVLTLRAESRAAVAPASPPASTGKNPFHSRPRQAAAPALAPAAA
FT                   PLPSVPVSAVKKSGRYDGSKIVVAIDAGHGGQDPGAIGQDGLREKEVTLAIARRLRGLM
FT                   DDDPMFQPVLTRSGDYFISVMGRSDVARRQKANLLISIHADAAPNRSANGASVWVLSNR
FT                   RANSEMAGWLEQHEKQSELLGGAGDVLANSNQDKYLSQTVLDLQFGHSQRVGYDVAVQV
FT                   LRQMQSVVRLHKRHPEHASLGVLRSPDIPSLLVETGFISNSEGERQLGNGQHQERIARA
FT                   IYLGVRSYFLAHPLQSGPKVENRPQPASAAGNVAAAAAVAPSASEIHVVKRGETLLGIA
FT                   NRYGSTLSGMMRLNNLKKEGVWVGQRLKVPSAGGSAQPAAASAPRIHLVKRGDTLTRIA
FT                   AHYGVSMDALRQANKMKSDEVQLGQRLRIPSR"
FT   CDS_pept        373603..375522
FT                   /codon_start=1
FT                   /gene_family="HOG000256551" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410546"
FT                   /gene_name="mutL"
FT                   /locus_tag="ETAF_0302"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ADM40426.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014763"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="UniParc:UPI0001BD01F7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T718"
FT                   /transl_table=11
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGSGIGKAELALALARHATSKISTLDDLEAIVSLGFRGEALASISS
FT                   VSRLTMTSRPEGQAEAWQAYAEGREMAVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRT
FT                   EKTEFAHIDEVVRRIALARFDITLTLQHNGKTVRQYRAVREGDARERRLGAICGTAFVQ
FT                   HALALAWRHDDLAIHGWVAAPQAIRQIGELQYCYVNGRMMRDRLITHAIRQAYQDRLSD
FT                   ELPPAYVLYLEIDPRQVDVNVHPAKHEVRFHQARLVHDFIYQAVVDVLQQAQVASAQDD
FT                   PTLATPGAALDEGPRGVENRASAGENRFNRPASSPIASAPRPAHAAAPRMPAGDIFRRR
FT                   EGELYQRLLAASPTPAGETDSAFVAAPSAPLPAAEPPAVAVSTAAERAAPGDSLGRVLT
FT                   LCADGVALTECRRGVALVSLSYARRCLLRAQLQPSDEGLKAQPLLVPLRLTLEAAERQA
FT                   LQAQQPLLQQMGIRLQPERQHAQLHAVPLPLRQQNLPRLIPQMLRYLATAPACDAASLA
FT                   DWLAVHWHSADEAPWTVAQAVQLLADLERLCPQLVQSPPRALLQPLNLQPGVERLRQEE
FT                   QLNE"
FT   CDS_pept        375515..376468
FT                   /codon_start=1
FT                   /gene_family="HOG000039996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410547"
FT                   /gene_name="miaA"
FT                   /locus_tag="ETAF_0303"
FT                   /function="ATP binding"
FT                   /function="tRNA dimethylallyltransferase activity "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ADM40427.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0052381"
FT                   /db_xref="InterPro:IPR002627"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="UniParc:UPI0001BD01F8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T719"
FT                   /transl_table=11
FT                   /translation="MSNDKQMQKLPPAIFIMGPTASGKTALAMALRERFPVEIISVDSA
FT                   LIYRGMDIGTAKPSAEELARAPHRLIDIRSPTQSYSAADFRADALREMAQISAQGRIPL
FT                   LVGGTMLYYKALLEGLSPLPPADAAVRARIEQQAREQGWEALHRELARIDPVAAARIHP
FT                   NDPQRLSRALEVFFVSGNTLTELTRVSGEALPYAVSQFAIAPSSRELLHQRIALRFQQM
FT                   LEAGFEQEARRLFARGDLHPDLPSVRCVGYRQMWSYLAGEIDYDEMVYRGVCATRQLAK
FT                   RQMTWLRGWESVQWLDSDKPAEALDCVAQVVSASLD"
FT   CDS_pept        376631..376939
FT                   /codon_start=1
FT                   /gene_family="HOG000004931" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410548"
FT                   /gene_name="hfq"
FT                   /locus_tag="ETAF_0304"
FT                   /function="RNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /protein_id="ADM40428.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI0001E3544C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T720"
FT                   /transl_table=11
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSGNAGTGSAGSSYHHGGQAASQPTQGSDDAE"
FT   CDS_pept        377038..378318
FT                   /codon_start=1
FT                   /gene_family="HOG000260368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410549"
FT                   /gene_name="hflX"
FT                   /locus_tag="ETAF_0305"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADM40429.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="UniParc:UPI0001BD01F9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T721"
FT                   /transl_table=11
FT                   /translation="MFDRYEAGEQAVLVHIYFSQEKDSEDLSEFESLVSSAGVQALRVI
FT                   TGSRKAPHPKYFVGEGKAQEIAQAVAETQASVVLFDHPLSPAQERNLERLCQCRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRIHLIIGRLEKVEKQREQGRRARVRAEIPTVSLVGYTNAGKSTLFNTLTSATV
FT                   YAADQLFATLDPTLRRVEVNDVGPTVLADTVGFIRHLPHDLVAAFKATLLETRQASLLL
FT                   HVVDASDTRVDENIDAVNTVLADIGADEIPVLLVMNKIDMLQDFVPRIDRDEENRPLRV
FT                   WVSAQQASGMDLLFQALSERLGGEIASYTLRLPPAAGRLRSRFYQLQAIEKEWIEEDGS
FT                   IGLQVRMPVVDWRRLCKQQQELINFIV"
FT   CDS_pept        378377..379621
FT                   /codon_start=1
FT                   /gene_family="HOG000260983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410550"
FT                   /gene_name="hflK"
FT                   /locus_tag="ETAF_0306"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40430.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="UniParc:UPI0001BD01FA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T722"
FT                   /transl_table=11
FT                   /translation="MAWNQPGNNGQNRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDL
FT                   FRKVSKKLGGLGGGKSGGSGSAGTPRSSIGGKKVVGLAVAAVVVIWAASGFYTIKEAER
FT                   GVVTRFGKFSHLVQPGLNWKPTFIDDVIPVNVESVRELAASGVMLTSDENVVRVEMNVQ
FT                   YRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTEGRTVIRNDTQKVLEEI
FT                   IRPYHMGITILDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQ
FT                   AQRILEDAKAYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLYLETMERVLGHTRKV
FT                   LVDDKSNNLMVLPLDQIMRSGDKGASQAGDSKDTSLIRLNPPQASAGSSTDSSVMDQRR
FT                   VNAQRNDTTRLGRDY"
FT   CDS_pept        379621..380625
FT                   /codon_start=1
FT                   /gene_family="HOG000260972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410551"
FT                   /gene_name="hflC"
FT                   /locus_tag="ETAF_0307"
FT                   /function="peptidase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40431.1"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="UniParc:UPI0001BD01FB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T723"
FT                   /transl_table=11
FT                   /translation="MRKSLLVILIVVLVALYASLFVVQEGQRGIVLRFGKVLRDDENKP
FT                   LVYAPGLHLKIPFIESVKTLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDIKDIVTDSRGKLMEDVRNALNTGTVDDA
FT                   AAPTEADDAIASAAARVARETNGKQPAVNPNSMAALGIQVVDVRIKQINLPTEVSDAIY
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAGAEREGRIIRGEGDAEAAKLF
FT                   ANAFSKDPDFFAFIRSLKAYENSFKGGQDVMVLRPDSDFFKYMRSPDGGKSAK"
FT   CDS_pept        complement(381042..381551)
FT                   /codon_start=1
FT                   /gene_family="HOG000235391" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410552"
FT                   /locus_tag="ETAF_0308"
FT                   /function="DNA binding"
FT                   /function="transposase activity"
FT                   /biological_process="transposition, DNA-mediated "
FT                   /protein_id="ADM40432.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004803"
FT                   /db_xref="GO:0006313"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="UniParc:UPI0001E3544D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T724"
FT                   /transl_table=11
FT                   /translation="MRSGNCKRSTRNQKGVPMGDEKSLAHTRWNCKYHIVFAPKYRRQA
FT                   FYGEKRRAIGSILRKLCEWKNVRILEAECCADHIHMLVEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDMKFKYRNREFWCRGYYVDTVGKNTAKIQEYIKHQLVEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   CDS_pept        complement(381457..381639)
FT                   /codon_start=1
FT                   /gene_family="HOG000028532" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410553"
FT                   /locus_tag="ETAF_0309"
FT                   /protein_id="ADM40433.1"
FT                   /db_xref="UniParc:UPI0001E3544E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T725"
FT                   /transl_table=11
FT                   /translation="MENPQLGWGFRKAFSFEPVIKTPFDLLKRLAVWQLQAFNKKSKGG
FT                   PNGGREELSAHPMEL"
FT   CDS_pept        complement(381699..382811)
FT                   /codon_start=1
FT                   /gene_family="HOG000009914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410554"
FT                   /locus_tag="ETAF_0310"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40434.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniParc:UPI0001BD0246"
FT                   /db_xref="UniProtKB/TrEMBL:E0T726"
FT                   /transl_table=11
FT                   /translation="MKPGRNHFFDILRVVSVLFVITSHYSYMFDSSTVLTFPREYLTAG
FT                   IGRLGVSFFFMISGALAYLSLRKYAAPEYYLRRVYSVLIPYNIAYFGMALLLLALGVFF
FT                   TYPGNPLVEVGPNGTRSVLDMLPSVLGFDHYLHGVYEIKTVYFTGEWFIGCIILLYVIS
FT                   PLIYRAIVRYPMWTMLATVAITLMAYDTRVTNPYWSAQVRISDFTFGMLFIHLQAQFTR
FT                   YVRPLALIGALLIVAGVSWAHISHQPVREVLFPLAPVSLLFAVAFFFIVQGAYQLLHPW
FT                   LSRPRVSQILLSLASRAYIIMLLQHVIVIFLSVNMDMSVLNATQAIALYLIVLVTIERL
FT                   SVLFKPLAVKTERLLMNKTLRRSAGHMPAA"
FT   CDS_pept        383021..383203
FT                   /codon_start=1
FT                   /gene_family="HOG000272722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410555"
FT                   /gene_name="yjeT"
FT                   /locus_tag="ETAF_0311"
FT                   /protein_id="ADM40435.1"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniParc:UPI0001A59D28"
FT                   /db_xref="UniProtKB/TrEMBL:E0T727"
FT                   /transl_table=11
FT                   /translation="MALALVLVVEGLGPMLFPQAWRRMIATMAQLPDGLLRRYGGGLVV
FT                   AGLVIYYMLRSRLGG"
FT   CDS_pept        383302..384600
FT                   /codon_start=1
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410556"
FT                   /gene_name="purA"
FT                   /locus_tag="ETAF_0312"
FT                   /function="GTP binding"
FT                   /function="adenylosuccinate synthase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40436.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004019"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="UniParc:UPI0001BD0247"
FT                   /db_xref="UniProtKB/TrEMBL:E0T728"
FT                   /transl_table=11
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVVSIIANGVVLAPDALLREMTELEARGVPVRERLLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKESFAVKLK
FT                   EIMEYHNFQLVNYYHVDAVDYQRVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGVGPRCVDYVLGIVKAYSTRVGAGPFPT
FT                   ELFDSVGEFLCEKGNEFGATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLD
FT                   EVKICVGYRLPDGREVDVTPLAAEGWEGIEPIYEVLPGWKESTFGVKQRDGLPQAALNY
FT                   IKRIEEVTGVPVDIISTGPDREETIVLRHPFDA"
FT   CDS_pept        384954..385328
FT                   /codon_start=1
FT                   /gene_family="HOG000249814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410557"
FT                   /gene_name="nsrR"
FT                   /locus_tag="ETAF_0313"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="DNA binding"
FT                   /function="metal ion binding"
FT                   /protein_id="ADM40437.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001BD0248"
FT                   /db_xref="UniProtKB/TrEMBL:E0T729"
FT                   /transl_table=11
FT                   /translation="MAALPEGQMTSITQVTEVYGVSRNHMVKIINQLSRAGFVTAVRGK
FT                   HGGIRLGRPASEIRIGDVVRELEPLTLVNCSQAFCHITPACRLKQVLHRATDAFLAELD
FT                   QCTLADLIEHNPPLYKLLLV"
FT   CDS_pept        385368..387818
FT                   /codon_start=1
FT                   /gene_family="HOG000071120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410558"
FT                   /locus_tag="ETAF_0314"
FT                   /function="RNA binding"
FT                   /function="exonuclease activity"
FT                   /function="ribonuclease activity"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="ADM40438.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI0001BD0249"
FT                   /db_xref="UniProtKB/TrEMBL:E0T730"
FT                   /transl_table=11
FT                   /translation="MSQDPYLEREAEKYASPIPSREFILMHLAKRKTPASREELAQELA
FT                   LSSEEDLEALRRRLRAMERDGQLIFTRRQCYALPERLDLIKGTVIGHRDGFGFLRSEGQ
FT                   KDDLYLSPEQMKMCMHGDVILAQVTGTDRRGRKEVRVVRVVEPRTGLIVGRYFTDAGTG
FT                   FVVPDDGRLSFDILIPSDAIAGARMGYVVVVELTQRPTRRTKAVGKIVEVLGDNMGTGM
FT                   AVDIALRSHDIPHSWPEQVERQVADLSEDVPEAAKVGRIDLRDLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPNTALDHEARSRGNSVYFPSQVVPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTIAASGRLSSYKFYEAVMSSHARLTYTKVAHILAGDPDLRAQ
FT                   YHALVKPLEELHALYKALDHAREERGGISFETEEAKFIFNAERRIERIEPTVRNDAHKL
FT                   IEECMILANISAARFMEKNHEPALFRIHDKPSEDHVMALRSVLAELGLSLGGGTQPEPK
FT                   DYALLMDKVADRPDHEMLQTMLLRSMKQAVYDPENRGHFGLALQAYAHFTSPIRRYPDL
FT                   SLHRGIKYLLAREHGHAERWTPSGGWHYHTEDMLQLGEHCSMTERRADEATRDVSDWLK
FT                   CDFMQDHVGQTYGGIITSVTGFGFFVRLDDLFIDGLVHVSTLDNDYYRFDQIGQRLIGE
FT                   SSGQVYRLGDKVEVKVDAVHLDERKIDFALISTARGVRGAGKTARNKARQANGGAENKP
FT                   SRSARRGGKMPANFAPDSVQRRGDEAAPAQKGKGKGKGKKPSAQTRKIAASTKAKRARK
FT                   KTTD"
FT   CDS_pept        387909..388652
FT                   /codon_start=1
FT                   /gene_family="HOG000218798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410559"
FT                   /locus_tag="ETAF_0315"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ADM40439.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="UniParc:UPI0001BD024A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T731"
FT                   /transl_table=11
FT                   /translation="MSEIIYGIHAVKALLEQDPQRFLDVFVMKGREDRRLLPLLQQLEE
FT                   CGIRVQVAQRQWLDEKVEGAVHQGIVARVKPGRQYQENDLPDLLAGLDHPPFLLILDGV
FT                   TDPHNLGACLRSADAAGVDAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTMR
FT                   LLQQESIWIVGTAGEADHSLYQSRMTGAMALVMGAEGDGMRRLTREHCDELISIPMAGS
FT                   VSSLNVSVATGICLFEAVRQRSAKA"
FT   CDS_pept        complement(388680..388955)
FT                   /codon_start=1
FT                   /gene_family="HOG000117400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410560"
FT                   /locus_tag="ETAF_0316"
FT                   /protein_id="ADM40440.1"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="UniParc:UPI0001BD024B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T732"
FT                   /transl_table=11
FT                   /translation="MSRSPLLTSLLFSIGLIGTSAQSAEYARADLVTDLSRMGMISLRG
FT                   IVGNPQDVERRIAHQADQRGARYYRILHMWESDGQQGWQATAALYR"
FT   CDS_pept        complement(389132..389443)
FT                   /codon_start=1
FT                   /gene_family="HOG000127364" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410561"
FT                   /locus_tag="ETAF_0317"
FT                   /protein_id="ADM40441.1"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="UniParc:UPI0001BD024C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T733"
FT                   /transl_table=11
FT                   /translation="MKTCKLTLTLLLTLLLGACSVMDGKPMPPPPPIAGHAQELRRNQT
FT                   EGLSKMWNISASVYGSPMNVQEVIQQRADAAGARYYYIVMLQETGVPGQWYSVATLYR"
FT   CDS_pept        389612..390361
FT                   /codon_start=1
FT                   /gene_family="HOG000063642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410562"
FT                   /locus_tag="ETAF_0318"
FT                   /protein_id="ADM40442.1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="UniParc:UPI0001BD024D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T734"
FT                   /transl_table=11
FT                   /translation="MVEMFEQTVGGIPLLHAVPAGQRDSALPTIFFYHGFTSSKEMYSY
FT                   FGYAFAAAGFRVLLPEADMHGSRYDGDERRRLAHFWDILKSNIDELPSLYDHFLRAGLI
FT                   LDGRVGVAGASLGGMTALGAKARYPWLRATASFMGSGFYLSLSQRLFPRQHQPTEDERA
FT                   WVRQRVSALADYDVSGCLAQLADRPLLIWHGLADDLVPAAESQRLAQALASQHLMDNVS
FT                   VVTEPGIAHKITASALDCGTAFFSRCL"
FT   CDS_pept        complement(390400..390669)
FT                   /codon_start=1
FT                   /gene_family="HOG000117400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410563"
FT                   /locus_tag="ETAF_0319"
FT                   /protein_id="ADM40443.1"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="UniParc:UPI0001BD024E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T735"
FT                   /transl_table=11
FT                   /translation="MKPAFAFITLCLLCGSAAAATEISASQGNAMPASEFAVISVNHDV
FT                   INVQDAMSDIRAQADADGAAYYQIIAIHEPLSHGQIHVSAVLYH"
FT   CDS_pept        390971..391366
FT                   /codon_start=1
FT                   /gene_family="HOG000040438" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410564"
FT                   /gene_name="rpsF"
FT                   /locus_tag="ETAF_0320"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40444.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="UniParc:UPI0001BD024F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T736"
FT                   /transl_table=11
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGAITGAEGKIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLMNVEASQEVIDELETNFRYNDAVIRSMVMRTKHAVTEASPMVK
FT                   AKDERRERREDFANETSEETEAGDSEE"
FT   CDS_pept        391375..391692
FT                   /codon_start=1
FT                   /gene_family="HOG000261221" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410565"
FT                   /locus_tag="ETAF_0321"
FT                   /function="single-stranded DNA binding"
FT                   /protein_id="ADM40445.1"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0001E3544F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T737"
FT                   /transl_table=11
FT                   /translation="MTVNRLVLAGTVCKAPIRKVSPSGIPHCQFVLEHRSQQQEAGFSR
FT                   QAWCRMPVIVSGAGLEAMTHRLTVGSALRVHGFVSCHMGRNGLNKLVLHAEQIELIDSG
FT                   D"
FT   CDS_pept        391697..391924
FT                   /codon_start=1
FT                   /gene_family="HOG000218466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410566"
FT                   /gene_name="rpsR"
FT                   /locus_tag="ETAF_0322"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40446.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="UniParc:UPI000005A94A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T738"
FT                   /transl_table=11
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
FT   CDS_pept        391967..392416
FT                   /codon_start=1
FT                   /gene_family="HOG000040337" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410567"
FT                   /gene_name="rplI"
FT                   /locus_tag="ETAF_0323"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40447.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="UniParc:UPI0001BD0250"
FT                   /db_xref="UniProtKB/TrEMBL:E0T739"
FT                   /transl_table=11
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPTGKAVPATKKNVE
FT                   FFEARRADLEAKLAETLSVAEARAVKINELATVTIASKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVAVAKSEVRLPNGVLRTLGDHEVHFQVHSDVFAQLNVVVVAE"
FT   CDS_pept        392632..393000
FT                   /codon_start=1
FT                   /gene_family="HOG000017981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410568"
FT                   /locus_tag="ETAF_0324"
FT                   /protein_id="ADM40448.1"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniParc:UPI0001BD0251"
FT                   /db_xref="UniProtKB/TrEMBL:E0T740"
FT                   /transl_table=11
FT                   /translation="MASIALQRVYDVRAPFSPHTFLTDRLWPRGIAKARLDGVNWLKEV
FT                   APSTALRQAFHHAHLDWPTFVARYRDELAANPQAWQPLVQLLRQGESLTLLYGSRDSQC
FT                   NQAVALRDWLLAQLSAGE"
FT   CDS_pept        complement(392984..393433)
FT                   /codon_start=1
FT                   /gene_family="HOG000127418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410569"
FT                   /locus_tag="ETAF_0325"
FT                   /protein_id="ADM40449.1"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniParc:UPI0001E35450"
FT                   /db_xref="UniProtKB/TrEMBL:E0T741"
FT                   /transl_table=11
FT                   /translation="MAPLPALHRRWLTVACAVLLLALLWPSDDAAPPRPSPALQTTASP
FT                   MQATLQPQREAPTPSDANDWQAYPILPGQTLAQLLREHNLDVTDAFAMARVEGDDRPLS
FT                   NLKAGQHVMIRRGPQGQMLALKLETTDDRQIAFRRESDGSFIRLR"
FT   CDS_pept        393877..394497
FT                   /codon_start=1
FT                   /gene_family="HOG000154888" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410570"
FT                   /gene_name="fklB"
FT                   /locus_tag="ETAF_0326"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ADM40450.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI0001BD0253"
FT                   /db_xref="UniProtKB/TrEMBL:E0T742"
FT                   /transl_table=11
FT                   /translation="MSTPAFDSIEAQASYGIGLQVGQQLNESGLQGLQPEALLAGLRDA
FT                   MEGNAPAVPVETVHRALREIHERADAVRREQQKALAEAGERFLAENAQQDDVTVTESGL
FT                   QFKVLKQGEGAIPSRQDKVRVHYTGRLVDGTVFDSSEQRGEPAEFPVGGVIAGWIEALS
FT                   MMPVGSRWQLYIPHQLAYGERGAGAAIAPYSALVFDVELLDIL"
FT   CDS_pept        complement(394552..395217)
FT                   /codon_start=1
FT                   /gene_family="HOG000286324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410571"
FT                   /gene_name="norA"
FT                   /locus_tag="ETAF_0327"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40451.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR007500"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniParc:UPI0001BD0254"
FT                   /db_xref="UniProtKB/TrEMBL:E0T743"
FT                   /transl_table=11
FT                   /translation="MTYRDRPLGELAISIPRATRLFRHHALDFCCGGKQTLQRAAARQS
FT                   LDLAMLESQLAELDSAPQPHRDWQQAPLAELTAFIVTRYHQRHREQLPELVLMAQKVER
FT                   VHTDKVGCPRGLAKQLDSLRQELDGHMMKEERILFPLIEQGEGARCQGPISVMEHEHRD
FT                   AGERLEVIRFLTDNMTPPAGACTTWRALYAGISELINDLMEHISLENNLLFPRALNDT"
FT   CDS_pept        395460..396200
FT                   /codon_start=1
FT                   /gene_family="HOG000282237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410572"
FT                   /locus_tag="ETAF_0328"
FT                   /function="3'(2'),5'-bisphosphate nucleotidase activity "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /function="magnesium ion binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40452.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="GO:0008441"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniParc:UPI0001BD0255"
FT                   /db_xref="UniProtKB/TrEMBL:E0T744"
FT                   /transl_table=11
FT                   /translation="MLEQICQLARDAGAAIMTVYQGDQPLALAYKGDQSPVTAADLAAH
FT                   EIIKAGLLRITPAIPLLSEEAPPAWPQRRDWQRYWLVDPLDGTKEFLQRNGEFTVNIAL
FT                   IEQGVPTLGVVYVPTSGVLYCACDGKAWKEQDGVRMEIGVRNAIPPLVVISRSHGDAEL
FT                   TDYLQQLGEHQTMMVGSSLKFCLVAEGIAQLYPRFGPTHIWDTAAGHAIAFAAGAQVRD
FT                   WQGKTLSYIPAESLLNPGFRVSLY"
FT   CDS_pept        396514..396720
FT                   /codon_start=1
FT                   /gene_family="HOG000276941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410573"
FT                   /locus_tag="ETAF_0329"
FT                   /protein_id="ADM40453.1"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniParc:UPI0001BD0256"
FT                   /db_xref="UniProtKB/TrEMBL:E0T745"
FT                   /transl_table=11
FT                   /translation="MKIFQRYNPLLVAKYVKTLFRGRLYIQGVGAFEFDMGRILLPKVR
FT                   DKRHLSVMSEINRQVLRLQAEMA"
FT   CDS_pept        complement(396769..398115)
FT                   /codon_start=1
FT                   /gene_family="HOG000062295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410574"
FT                   /locus_tag="ETAF_0330"
FT                   /function="catalytic activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40454.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniParc:UPI0001BD0257"
FT                   /db_xref="UniProtKB/TrEMBL:E0T746"
FT                   /transl_table=11
FT                   /translation="MLNSILLIILLIAISAFFSISEISLAASRKIKLKTMADEGDINAA
FT                   RVMALQDQPGYFFTVVQIGLNAVAILGGIVGDAAFSPAFRLLFDRFMPLEVSQQASFIC
FT                   SFVLVTGCFILFADLTPKRIGMIAPEAVAVRIVNPMRFCLLLFRPLVWFFNGLANLIFH
FT                   LFKIPMVRKDDITPDDIYAVVEAGALAGVLRKQEHEIIENVFELESRTVPSSMTPRESI
FT                   VYFDLGETEDSIKEKVSTHPHSKFLVCDGAIDHVVGYVDSKDLLNRVLGNQSLVLSSGV
FT                   QIRNVLIVPDTLTLSEALESFKNAGEDFAVILNEYALVVGVITLNDVMTTLMGDLVGQG
FT                   QEEQIIARDENSWLVEGVTPIDDVMRVLDIEEFPQSSNYETIGGFMMYMLRKIPKRTDA
FT                   VKYAGYKFEVVDIDSYKIDQLLVTRLAERLPPMSPDADGDAEASQQADK"
FT   CDS_pept        398009..398131
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410575"
FT                   /locus_tag="ETAF_0331"
FT                   /protein_id="ADM40455.1"
FT                   /db_xref="UniParc:UPI0001E35451"
FT                   /db_xref="UniProtKB/TrEMBL:E0T747"
FT                   /transl_table=11
FT                   /translation="MVFSFIFREAARDISEIEKKALIAISKIISNILFNIIYPY"
FT   CDS_pept        complement(398389..399027)
FT                   /codon_start=1
FT                   /gene_family="HOG000263862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410576"
FT                   /gene_name="msrA"
FT                   /locus_tag="ETAF_0332"
FT                   /function="peptide-methionine-(S)-S-oxide reductase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein modification process "
FT                   /protein_id="ADM40456.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniParc:UPI0001E35452"
FT                   /db_xref="UniProtKB/TrEMBL:E0T748"
FT                   /transl_table=11
FT                   /translation="MHHHNDSTPAPLTPAQALPGRTQAMSLSGIHALNGHDMYALPAGM
FT                   EEALFAMGCFWGVERLFWQQPGIYSTAAGYSGGLTPNPTYREVCSGQTGHAETVRVVFD
FT                   PALIRYDDLLRLFWQHHDPAQGMRQGNDIGTQYRSALFPVTPQQMQAAQASQARFAQAM
FT                   RQAGDLRPISTEICAAGPFYYAEEEHQQYLHKHPHGYCGLGGIGVCLPD"
FT   CDS_pept        399308..401044
FT                   /codon_start=1
FT                   /gene_family="HOG000275353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410577"
FT                   /locus_tag="ETAF_0333"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ADM40457.1"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="UniParc:UPI0001BD0259"
FT                   /db_xref="UniProtKB/TrEMBL:E0T749"
FT                   /transl_table=11
FT                   /translation="MPRLRRIGLLCLLLAAPLAHAAQVRLVVEGLSGQLQQNVRATLST
FT                   IDEDEISNDGRFRVRAADAIRQGLRALGYFQPTIEFEYRPGSTFSRPQLIANVTPGEPV
FT                   RIAGLNVRIRGAAKDDPAYQALLAKSLPPIGSVLDQGDYDNLKNALNSLALQRGYFGAT
FT                   MPVHQLGVIEDQHKAFWDIEFDSGPRYRFGDVRFSGSQIQTAYLQNLRPFKSGEYYSAD
FT                   DLAKFSGNLSATNWFNSVVVSPDFKALGADQTLPLQAVVTPRSQNMVDLGGGYATDVGP
FT                   RMKVSWKRPWMNSYGHSLDTSLNLSMPEQTADFSYKIPLLKAPLEQYYLVQGGFQRTDL
FT                   NDTQSDSTTLNLARYWELSSGWQRGINMRWSLDHFTQGNLTETAMLLYPGVSVNRTRSR
FT                   GGLMPTWGDTQRYSVDVSNRYWGSSVDFAVFQAQNVWIRTLAERHRFVVRGNLGWIETN
FT                   DFNKVPPSLRFFAGGDRSIRGYKYKSISPKGSDGKLTGASRLVTGSLEYQYNLSGKWWG
FT                   GVFIDSGEAVNDFTKSDFHTGTGVGVIWVSPVGPIRLNLGVPVGREDKHDVQIYIGLGP
FT                   EL"
FT   CDS_pept        401041..404808
FT                   /codon_start=1
FT                   /gene_family="HOG000127429" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410578"
FT                   /gene_name="ytfN"
FT                   /locus_tag="ETAF_0334"
FT                   /protein_id="ADM40458.1"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniParc:UPI0001BD025A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T750"
FT                   /transl_table=11
FT                   /translation="MRWYNIRRYALMLLLGLFLLLALLLGGMMTQSGLHLALNAAARWV
FT                   PGLEIGRVEGGWRDLTLRDVGYRMPGVDVAVGQFHLSLDISCLKRSELCLNVLSAQRVR
FT                   VNVDTQALPPSEPQATPSAPLGRLSTPYPLVLRLLRLNDVQVTVDGTAITLDALRSGAE
FT                   WRGSQLRLQPSDIQGLRVSLPPSPAASSSAESAVPTVPSTPLGETLTALFSRPLLPAAM
FT                   RLDLPLDLQVSRISARQVQIRAATDLDITSLELRAALDQQRLALHTLKVQAQQGSLSAR
FT                   GSATFSGRWPLDLQLNASVNQAPLKGEKLRLALKGAMYDTLALDANLSGPLRATLKGDT
FT                   RLADAGLPLSLSLDSPSLRWPLGGTPDYQVNNMALRLTGSAHDYRLQLRGAFSGQGLPD
FT                   AALDLAGKGNERQFTLSQLQLATLGGKADMQALVDWSKAISWRSSLTLTGIDTGRQWPA
FT                   WPSSLNGKIETRGSLYGGSWQLQVPQLKLTGRIKQNALDVGGQLRGNQAGQWQIPQLHI
FT                   ALGRNRIEVNGDLAQKQWSLDARIDAPRLDGTLPGLAGTARGTLKLRGDRQAPQLLADL
FT                   QARGLRWQALTIQRVALLGDIRSDQQIQGSLDLRVDSLKQGDIDISQLTLRAAGNERKH
FT                   RLQLVMQGTPLAGRLTLNGSLAQDRARWSGTLTDTDFTTPVGEWRLTRPIALDYGVDKQ
FT                   QMAIGPHCWENPNARLCVPQTIEVGESGNVSVVLERFDLAMLQPFLGPDTQLHGRFSGR
FT                   AQARWQAGEGLPQARITLSGDGVKLAQQVQGNTLPVALSTVTLEASLAQGQARLNWLIG
FT                   IEGNGQLRGDVRVANLQGARNLSGNVDIQRLSLALLNPALMKGEKAQGMLNASLRLGGT
FT                   TLHPQLYGRLALDGVDIDGQFMPFDVTDANLAINFDGMSSVLQGVIKTSQGQLNLSGNA
FT                   DWRNMNAWRARIAASGTRLRVTVPPMVRLDVSPNIVFDASPSQLALSGRVDIPWARITV
FT                   QDLPESAVGVSSDEVMLNNAHQPIRPVSASIPLHTDLTIAIGNNVRLSAFGLKAALKGE
FT                   LKVSQNQNGLGLNGQIMIPQGRFAAYGQDLLIRQGELVFAGPPGNPLLNIEAIRNPEST
FT                   ANDVTVGVRVTGLAEQPKLEVFSDPAMSQQEALSYLLRGQGLDSSGADSNAMTSMLIGL
FT                   GVAQSGKLVGKIGETFGVSNLTLDSQGVGDSSQVVVSGYVLPGLQVKYGVGIFDSLATL
FT                   TLRYRLMPNLYLEAVSGVNQALDLLYQFEF"
FT   CDS_pept        404865..405155
FT                   /codon_start=1
FT                   /gene_family="HOG000261862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410579"
FT                   /locus_tag="ETAF_0335"
FT                   /protein_id="ADM40459.1"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI0001E35453"
FT                   /db_xref="UniProtKB/TrEMBL:E0T751"
FT                   /transl_table=11
FT                   /translation="MTNATWLGDYVLEGYDLYDLGHYPAVVPGEGRVYCEVYRITSSIL
FT                   AELDELKSNSKDYRRELIKTPYGCAWIYIYLNGVEGLPRIASGDWLKREED"
FT   CDS_pept        complement(405204..405734)
FT                   /codon_start=1
FT                   /gene_family="HOG000236473" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410580"
FT                   /locus_tag="ETAF_0336"
FT                   /function="inorganic diphosphatase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="phosphate metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40460.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004427"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006796"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniParc:UPI0001BD025C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T752"
FT                   /transl_table=11
FT                   /translation="MSLINVPAGKDMPEDIYVVIEIPANADPIKYEIDKDTGALFVDRF
FT                   MSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDA
FT                   KLVAVPHSKLTKEYDHIQDVNDLPELLRAQIAHFFEHYKDLEKGKWVKVEGWADAAAAK
FT                   AEIIASFERAKNK"
FT   CDS_pept        complement(405839..406843)
FT                   /codon_start=1
FT                   /gene_family="HOG000191265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410581"
FT                   /gene_name="fbp"
FT                   /locus_tag="ETAF_0337"
FT                   /function="fructose 1,6-bisphosphate 1-phosphatase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40461.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="GO:0042132"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="UniParc:UPI0001BD025D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T753"
FT                   /transl_table=11
FT                   /translation="MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDIIGASGAENIQGEVQMKLDLYANEKLKAALKARGEVAGIASEEEDDIVIFEGDRANN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPLGTPVTRKDFLQPGNRQVAAGYVVY
FT                   GSSTMLVYTTGNGVHAFTYDPSLGVFCLSHERLRFPHSGNMYSINEGNYIKFPLGVKKY
FT                   IKYCQEQDSATQRPYTSRYIGSLVADFHRNLLKGGIYIYPSTASHPQGKLRLLYECNPM
FT                   SFLAEQAGGKATDGFRRILDIVPDALHQRCPFFVGSCAMVEDAERFMHQFPDA"
FT   CDS_pept        407010..408386
FT                   /codon_start=1
FT                   /gene_family="HOG000256032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410582"
FT                   /locus_tag="ETAF_0338"
FT                   /function="ATP binding"
FT                   /function="ligase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular cell wall organization "
FT                   /protein_id="ADM40462.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001BD025E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T754"
FT                   /transl_table=11
FT                   /translation="MRIHILGVCGTFMGGLALLARQLGHDVTGSDANVYPPMSTLLQQQ
FT                   GITLLEGYDPAHLEPQPDLVIIGNAMARGNPCVEAILERNIPYVSGPQWLHDEVLRHRW
FT                   VIAVAGTHGKTTTAGMVNWILESCGYEPGFVIGGVPGNFSVSARLGKSPFFVIEADEYD
FT                   CAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLRAIQRQFHHLVRLVPGQGRIILPAG
FT                   DANLKQVMAMGCWSEQELCGDEAAWSATRLSTDASRFSVSLDGECVGEVEWALVGEHNM
FT                   HNGLMAIAAARHVGVPPAEACRALGSFINARRRLELRGQAYGVSVYDDFAHHPTAILAT
FT                   LAALRGKVGGTARILAVLEPRSNTMKMGVCKNELAPALGRADEVFLYQPQHIPWQVAEV
FT                   AEACVQPAHWSADLGTLVEMIVKNAQPGDHILVMSNGGFGDIHDRLLQALAQKSAAHQA
FT                   "
FT   CDS_pept        complement(408498..408662)
FT                   /codon_start=1
FT                   /gene_family="HOG000156612" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410583"
FT                   /locus_tag="ETAF_0339"
FT                   /protein_id="ADM40463.1"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="UniParc:UPI0001E35462"
FT                   /db_xref="UniProtKB/TrEMBL:E0T755"
FT                   /transl_table=11
FT                   /translation="MQPMGVITVSGLDGSIADIDQQLATKAQSQGASAFRIIEERIDGN
FT                   YHATALIYR"
FT   CDS_pept        complement(409118..409588)
FT                   /codon_start=1
FT                   /gene_family="HOG000242730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410584"
FT                   /gene_name="argR"
FT                   /locus_tag="ETAF_0340"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="arginine biosynthetic process "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40464.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="UniParc:UPI0001BD0260"
FT                   /db_xref="UniProtKB/TrEMBL:E0T756"
FT                   /transl_table=11
FT                   /translation="MRNTTKQEDLTKAFKALLKEEKFSSQGEIVQALQELGFDNINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDVDHNDAIVVIHTSPGA
FT                   AQLIARLLDSLGKSEGILGTIAGDDTIFTTPAKGFAVEQLYAAILALFEQEL"
FT   CDS_pept        410052..410990
FT                   /codon_start=1
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410585"
FT                   /locus_tag="ETAF_0341"
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40465.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI0001BD0262"
FT                   /db_xref="UniProtKB/TrEMBL:E0T757"
FT                   /transl_table=11
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD
FT                   LSHIPTAVTVRGFGGEDASPALEGADIVLISAGVARKPGMDRSDLFNINAGIIRNLIGQ
FT                   VARTSPNACIGIITNPVNTMVPIAAEVLKKAGVYNPNKLFGVTTLDIIRSNTFVGELKH
FT                   LDPTTLDIPVIGGHSGVTILPLLSQIPGVSLSEQEVADLTKRIQNAGTEVVEAKAGGGS
FT                   ATLAMGQAAARFALSLVRAMQGDENVVECGYVESDGEYARFFAQPLLLGKEGLVQRLNI
FT                   GTLSAFEQHALESMLEVLRKDIALGEDFINK"
FT   CDS_pept        complement(411096..411380)
FT                   /codon_start=1
FT                   /gene_family="HOG000040880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410586"
FT                   /locus_tag="ETAF_0342"
FT                   /function="DNA binding"
FT                   /protein_id="ADM40466.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniParc:UPI0001BD0263"
FT                   /db_xref="UniProtKB/TrEMBL:E0T758"
FT                   /transl_table=11
FT                   /translation="MKKTLPEDWHPAEIIAALHKRRLTLTQVSRNAGLSSSTLANALTR
FT                   PWPKGEWLIAEALSIHPSEIWPSRYYDPVTHELLDRKRLIRDAAAIKKI"
FT   CDS_pept        complement(411577..412548)
FT                   /codon_start=1
FT                   /gene_family="HOG000009102" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410587"
FT                   /locus_tag="ETAF_0343"
FT                   /function="transferase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="ADM40467.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0001BD0264"
FT                   /db_xref="UniProtKB/TrEMBL:E0T759"
FT                   /transl_table=11
FT                   /translation="MNLEQITELTAQDMADVNARILHQLNSDVALINQLGYYIISGGGK
FT                   RIRPMIAVLAARALGYQGDRHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFG
FT                   NAASVLVGDFIYTRAFQMMTSLESLRILALMSEATNVIAEGEVQQLMNVNDPDISEENY
FT                   MQVIYSKTARLFEAAAQCSAILAGADTAQEQALQDYGRYLGTAFQLIDDLLDYDADGKT
FT                   LGKNTGDDLNEGKPTLPLLHAMHHGSAERSAMIRQAIEQGNGRHLLEPVLETMQQAGSL
FT                   DYTRSRAEEEADKAIAALAPLPDSPHKQALIGLANLAVNRSF"
FT   CDS_pept        412808..413119
FT                   /codon_start=1
FT                   /gene_family="HOG000036265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410588"
FT                   /gene_name="rplU"
FT                   /locus_tag="ETAF_0344"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40468.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="UniParc:UPI0001BD0265"
FT                   /db_xref="UniProtKB/TrEMBL:E0T760"
FT                   /transl_table=11
FT                   /translation="MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFDQILMVANGE
FT                   DIKIGVPFVAGGKVKAEVVAHGRGEKVKIVKFRRRKHHRKQQGHRQWFTDVKITGISA"
FT   CDS_pept        413138..413395
FT                   /codon_start=1
FT                   /gene_family="HOG000111610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410589"
FT                   /gene_name="rpmA"
FT                   /locus_tag="ETAF_0345"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40469.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniParc:UPI0001A59DB2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T761"
FT                   /transl_table=11
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGCGRDHTLFALADGKVKFEVKGPKNRKFISIVAE"
FT   CDS_pept        413483..414418
FT                   /codon_start=1
FT                   /gene_family="HOG000000467" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410590"
FT                   /locus_tag="ETAF_0346"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40470.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI0001BD0266"
FT                   /db_xref="UniProtKB/TrEMBL:E0T762"
FT                   /transl_table=11
FT                   /translation="MESKQSAALGISLALTTAIFWGALPIAMKQVLPDMAPETIVWYRF
FT                   SMAALGLGSVLCLRGQLPPLRVFRQRRWLLLLSVATAGLLGNFILFSTSLQYLSPTTSQ
FT                   VIGQLSPVGLMFASVLVLKERMRPAQVIGAALLIGGLLLFFNTSLAEIFTRLTDYTLGV
FT                   LLGMAAAGVWVCYGIAQKVLLRRLASQQILCLLYALCAICLWPLAQPGQIYQLSGWQLL
FT                   CLLFCGVNTLVGYGALAEAMVRWQVAKVGAIVTLTPLFTLMFSDVLALAWPETFMTPSL
FT                   NTVGYIGAFVVVAGAMFSAIGHRWWPRQRA"
FT   CDS_pept        414467..415645
FT                   /codon_start=1
FT                   /gene_family="HOG000019084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410591"
FT                   /gene_name="obg"
FT                   /locus_tag="ETAF_0347"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40471.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="UniParc:UPI0001BD0267"
FT                   /db_xref="UniProtKB/TrEMBL:E0T763"
FT                   /transl_table=11
FT                   /translation="MKFVDEAVIHIEAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGQDVTIKVPVGTRITDVDTGEV
FT                   LGDMTRHQQKLMVGKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKRDLSLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDSEKSFVVADIPGLIEGAS
FT                   EGAGLGIRFLRHLERCRVLLHLIDLAPIDESDPVENARVIIGELEKYSEKLAQKPRWLV
FT                   FNKTDLLAPEEAKARAQAIADALGWEGEHYLISAANREGVNALCWDVMNFLEAHPREAE
FT                   VEEEKEKAKKAEFMWDDYHREQLEQAEAEWEEEEDDDWDEDDDEGVEIIYQR"
FT   CDS_pept        complement(415691..416764)
FT                   /codon_start=1
FT                   /gene_family="HOG000127051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410592"
FT                   /locus_tag="ETAF_0348"
FT                   /function="ATP binding"
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40472.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniParc:UPI0001BD0268"
FT                   /db_xref="UniProtKB/TrEMBL:E0T764"
FT                   /transl_table=11
FT                   /translation="MISLRRTLLIMLALILLVTQLVSALWLWHESREQISFLVNETLSA
FT                   KVRTEQVDKEIREAIAALLIPSLVMMAVTLLLSWLAVSWIVRPLNQLQARLEKRSPSNL
FT                   TPIDIDSSMTEITSITRTLNHLFSRLQHTLRQERLFTADAAHELRTPLAGVRLHLELME
FT                   QSGVPEATTLVQRIDQLMHTVEQLLMLSRVGQNFASGHYLQLELISEVVLAQRSELCEM
FT                   LALRGQHLRLETPSQLAMHGDAMLLRLMLRNLVENAHRYSPEGSDILLRVTLSADEHGC
FT                   ILQVIDSGPGIDESRASELTEPFHRLDRRFGGSGLGLNIVVRILQLHKGQLTLRNNRPG
FT                   PGLNACCRLPLTPQDFG"
FT   CDS_pept        complement(416761..417423)
FT                   /codon_start=1
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410593"
FT                   /locus_tag="ETAF_0349"
FT                   /function="DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40473.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001BD0269"
FT                   /db_xref="UniProtKB/TrEMBL:E0T765"
FT                   /transl_table=11
FT                   /translation="MKILIVEDDTLIQQGLAQAMARENYACDCAGNAASASALLQSGHY
FT                   SLIILDLGLPGMDGASALRQWRREGIDAPVLILTARDTVSDRVGGLDAGADDYLVKPFA
FT                   LAELLARVRALIRRMQGLCNNALQVDDIHLDLSSQQVSCGGLPLEITPKEFAILTRLMM
FT                   RAGQTISREVLQQDLYSWQDELSSNSLEVHIHNLRRKLGKNRIKTLRGVGYRLEKTP"
FT   CDS_pept        complement(417433..418800)
FT                   /codon_start=1
FT                   /gene_family="HOG000279266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410594"
FT                   /locus_tag="ETAF_0350"
FT                   /function="serine-type D-Ala-D-Ala carboxypeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40474.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0009002"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniParc:UPI0001BD026A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T766"
FT                   /transl_table=11
FT                   /translation="MQDYAQYLPEGTNLALMVQKVGSTTPTIDYHGQQMALPASTQKVI
FT                   TALAALLQLGPDFRFNTTFETRGQISAGALNGDLIVRFDGDPTLRRQNIRNMVAALKKQ
FT                   GVTRISGDILIDTSVFASHDKAPGWPWNDLTQCFSAPPAAAIVDRNCFSISLYSAPKAG
FT                   DRAFIRVASYYPVHMFSEVKTLARGSAEAPYCELDVVPGELNRYTLTGCLTQRADPLPL
FT                   AFAVQDGAAYAGAIVKDELQQANIDIAGHLRRETQVTPQGTILAQTQSAPLHDLLRVML
FT                   KKSDNMIADTVFRTIGHSYFNVPGTWRAGSDAVRQILRKKAGVNLGNSVVVDGSGLSRH
FT                   NLISPATMMEVLQYIAQNDSQLNFISMLPLAGYDGTLQYRGGLHEAGVDGKVSAKTGSL
FT                   QGVYNLAGFITTASGQRMAFVQYLSGYAVPPQDQRTRRQPLVRFESRLYRDIYRNN"
FT   CDS_pept        419115..419591
FT                   /codon_start=1
FT                   /gene_family="HOG000241145" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410595"
FT                   /gene_name="greA"
FT                   /locus_tag="ETAF_0351"
FT                   /function="DNA binding"
FT                   /function="transcription elongation regulator activity "
FT                   /function="translation elongation factor activity "
FT                   /biological_process="transcription"
FT                   /protein_id="ADM40475.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="UniParc:UPI0001BD026B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T767"
FT                   /transl_table=11
FT                   /translation="MNQIPMTLRGAEKLREELDFLKGTRRPQIIAAIAEAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEAKLSNAQVIDVTKMPNNGRVIFGSTVSVENLDTEDQQT
FT                   YRIVGDDEADFKHNLISVNSPIARGLIGKEEGDVVTIKTPGGEVEYEILKVEYL"
FT   CDS_pept        complement(419734..420027)
FT                   /codon_start=1
FT                   /gene_family="HOG000016279" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410596"
FT                   /locus_tag="ETAF_0352"
FT                   /function="RNA binding"
FT                   /protein_id="ADM40476.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="UniParc:UPI0001BD026C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T768"
FT                   /transl_table=11
FT                   /translation="MNLTNKQKQHLKSLAHSLKPVVQLGANGLTEGVLAEIEQALAHHE
FT                   LIKVKIAAEERETKTLIANAIVRETGACNVQLIGNILVIYRPSEERKISLPR"
FT   CDS_pept        420158..420784
FT                   /codon_start=1
FT                   /gene_family="HOG000162367" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410597"
FT                   /gene_name="ftsJ"
FT                   /gene_synonym="rlmE"
FT                   /gene_synonym="rrmJ"
FT                   /locus_tag="ETAF_0353"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (uridine-2'-O-)-methyltransferase activity "
FT                   /biological_process="cell division"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40477.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008650"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI0001BD026D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T769"
FT                   /transl_table=11
FT                   /translation="MGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQGSD
FT                   KIFRPGMTVVDLGAAPGGWSQYVVTQIGDKGRIIACDLLPMDPIVGVDFLQGDFRDELV
FT                   LGALMERVGDAKVQVVMSDMAPNMSGTPSVDIPRSMYLVELALEMAKDVLAPGGSFVVK
FT                   VFQGEGFDEYLGQIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
FT   CDS_pept        420841..422781
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410598"
FT                   /gene_name="ftsH"
FT                   /locus_tag="ETAF_0354"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="cell division"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40478.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="UniParc:UPI0001BD02B9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T770"
FT                   /transl_table=11
FT                   /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNSRRVDYSTFLTEVNQDQ
FT                   VREVSIDGRAINVTKKDGNRYTTYIPINDPKLLDSLLTKNVKVIGEPPEEPSLLTSIFI
FT                   SWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEAKEE
FT                   VGELVEYLRDPSRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV
FT                   EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVE
FT                   MDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPL
FT                   ATDIDASVIARGTPGFSGADLANLVNEAALFAARNNKRVVSMVEFEKAKDKIMMGAERR
FT                   SMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPQGDSISYS
FT                   RQKLESMISVAYGGRLAEELIYGTEHVSTGASQDIKQATTIARNMVTQWGFSEKLGPLL
FT                   YAEEEGEVFLGRSVAKTKHMSDETARIIDQEVKALIERNYQRARQLLADNMDIMHAMKD
FT                   ALMKYETIDAPQVDDLMARREVRPPAGWLDEQANRQAQAQQPAAQPAAAEQAADSDAAR
FT                   SDDDRHNDGEK"
FT   CDS_pept        422873..423706
FT                   /codon_start=1
FT                   /gene_family="HOG000217510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410599"
FT                   /locus_tag="ETAF_0355"
FT                   /function="dihydropteroate synthase activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="ADM40479.1"
FT                   /db_xref="GO:0004156"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniParc:UPI0001BD02BA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T771"
FT                   /transl_table=11
FT                   /translation="MLLRSRELTLNLNYPQVMGILNVTPDSFSDGGRHNALDAALRHAE
FT                   SMIVAGATIIDVGGESTRPGAAEVSEAEELARVVPVVEALTQRFEVWVSVDTSKAAVIR
FT                   ACSAAGADMINDVRSLSEPGALAAAAESGLPVCLMHMQGEPKGMQHSPHYSDVVAEVDA
FT                   YLSAQIARCVAAGIARERLLLDPGFGFGKNLTHNYRLLANLAHFHHHGLPLLVGMSRKS
FT                   MVGQLLNVPPAQRVAGSVACAVIAAMQGAQIIRVHDVRETVDAMRVVEATLSAKE"
FT   CDS_pept        423714..425051
FT                   /codon_start=1
FT                   /gene_family="HOG000268678" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410600"
FT                   /gene_name="glmM"
FT                   /locus_tag="ETAF_0356"
FT                   /function="magnesium ion binding"
FT                   /function="phosphoglucosamine mutase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ADM40480.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008966"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI0001BD02BB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T772"
FT                   /transl_table=11
FT                   /translation="MSERKYFGTDGIRGKVGSSPITPDFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PYYDNGIKFFSIDGTKLPDEVEAAIEAELDKPLTCVESAELGKASRIVDAAGRYIEFCK
FT                   STFPNALSLSGLKIVADCANGATYHIAPNVLRELGAEVITIGTSPDGMNINKECGATDV
FT                   RALQARVVAENADLGMAFDGDGDRLIMVDHRGDKVDGDQILYIVAREALRQGKLHGGVV
FT                   GTLMSNMGLELALKQLGIPFARAKVGDRYVLETMQEKGWRMGAENSGHVIILDQTTTGD
FT                   GIVAGLQVLAAMARNHMSLADLCSGMTLLPQVLINVRFAGQCDPLQDAAVQQACAEVER
FT                   QLAGRGRVLLRKSGTEPLIRVMVEGEDLQQVTDLANVIADAVKAAS"
FT   CDS_pept        425238..425573
FT                   /codon_start=1
FT                   /gene_family="HOG000071344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410601"
FT                   /gene_name="secG"
FT                   /locus_tag="ETAF_0357"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="protein secretion"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40481.1"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniParc:UPI0001BD02BC"
FT                   /db_xref="UniProtKB/TrEMBL:E0T773"
FT                   /transl_table=11
FT                   /translation="MYEALLVIFLLVSVALIALIMLQQGKGADMGASFGAGASATLFGS
FT                   SGTGNFMTRTTGILATLFFVLSLVLGNLSGHQSKQGSEWDNLGQPVKTEQPATPAAPAT
FT                   PSSDIPN"
FT   tRNA            425627..425713
FT                   /gene_name="tRNA-Leu"
FT   tRNA            425770..425846
FT                   /gene_name="tRNA-Met"
FT   CDS_pept        426092..426514
FT                   /codon_start=1
FT                   /gene_family="HOG000242360" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410602"
FT                   /gene_name="rimP"
FT                   /locus_tag="ETAF_0358"
FT                   /biological_process="ribosomal small subunit biogenesis "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40482.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042274"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="UniParc:UPI0001BD02BD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M0"
FT                   /transl_table=11
FT                   /translation="MITAPVEALGFELVGIEFIRGRHSTLRIYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVAYYLEVSSPGMDRPLFTAEHYTHFLNEEVTLVLRMAMQNRRKWQ
FT                   GIIKAVDGEMITVTVDGKDEVFALSNVQKANLVPHF"
FT   CDS_pept        426536..428023
FT                   /codon_start=1
FT                   /gene_family="HOG000006394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410603"
FT                   /gene_name="nusA"
FT                   /locus_tag="ETAF_0359"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription
FT                   termination, DNA-dependent"
FT                   /protein_id="ADM40483.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0031554"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI0001BD02BE"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M1"
FT                   /transl_table=11
FT                   /translation="MNKEILAVVEAVSNEKALPREKIFEALETALATATKKKYEQEIDV
FT                   RVAIDRKSGDFDTFRRWLIVDEVTQPTREITLDAARFEDPALDLGDYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVDAFREHEGEIVTGVVKKVNRDSISLDLGNNAEAVIG
FT                   REDMLPRENFRPGDRIRGVLYAVRPEARGAQLFVTRSRPEMLIELFRIEVPEIGEEVIE
FT                   IKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDKHTMDIAVEASNLAQAIGRNGQNVRLASQLSGWELNVMT
FT                   AEDLQAKHQAEAHAAIDTFTKHLDIDEEFATLLVEEGFSTLEELAYVPERELLSIDGLD
FT                   EETVEALRTRAKNALTTLALAQEESLGDNKPADDLLNLPGMERSVAFKLAARGVCTLED
FT                   LAEQGVDDLTDIEGLNNEQAGELIMAARNICWFGDSE"
FT   CDS_pept        428048..430753
FT                   /codon_start=1
FT                   /gene_family="HOG000076907" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410604"
FT                   /gene_name="infB"
FT                   /locus_tag="ETAF_0360"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40484.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniParc:UPI0001BD02BF"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M2"
FT                   /transl_table=11
FT                   /translation="MAEVTVKSLAAEIQTSVERLVQQLADAGINKSPDDSVSPQEREAL
FT                   LAHLNREHGGSSGKLTLQRKTRSTLSVPGTGGKSKSVQIEVRKKRTYVKSDAAAQQAEA
FT                   EALAKREAEEQAKREAEEQTQREMAEQAKREAAEQAKRQQEEQAKREAAEKAKREAAEK
FT                   EKVTNQHIDEKTKAAQAEKAKREAEAAELKRKAEEEARRKLEEDARKVAEEARRMAEAN
FT                   EGKWTENASEEDNSDYHVTTSHHAREAEDENDRQVEGDRRARGRGGKAAKQKKGSKLSE
FT                   SKADREEARAVNRGGKGGKRKPSSLQQGFTKPAQAVNRDVVIGETITVAELANKMAVKG
FT                   SQVIKSMMKMGAMATINQVIDQETAQMVAEEMGHKVILRRENELEEAVLNDRDTGAAAE
FT                   PRAPVVTIMGHVDHGKTSLLDYIRSTKVAAGEAGGITQHIGAYHVQTDNGMITFLDTPG
FT                   HAAFTAMRARGAQATDIVVLVVAADDGVMPQTIEAIQHAKAAGVPLVVAVNKIDKPEAD
FT                   PDRVKNELSQYGVMPEDWGGEAQFVHVSAKAGTGIDDLLDAILLQAEVLELKAVRNGMA
FT                   SGVVIESFLDKGRGPVATVLVREGTLHKGDIVLCGFEYGRVRAMRDELGREITEAGPSI
FT                   PVEILGMSGVPAAGDEATVVRDEKKAREVALYRQGKFREVKLARQQKAKLENMFSNMVE
FT                   GEVSELNIVLKADVQGSVEAIADSLRKLSTDEVKVKIVGSGVGGITETDATLAAASNAI
FT                   LLGFNVRADASARRVVEAENLDLRYYSVIYDLIDEVKQAMSGMLAPEYKQEIIGLAEVR
FT                   DVFKSPKFGAIAGCMVTEGVVKRHSPIRVLRENVVIYEGELESLRRFKDDVNEVRNGME
FT                   CGIGVKNYNDVRPGDVIEVFETIEVKRSID"
FT   CDS_pept        430850..431248
FT                   /codon_start=1
FT                   /gene_family="HOG000218325" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410605"
FT                   /gene_name="rbfA"
FT                   /locus_tag="ETAF_0361"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40485.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="UniParc:UPI0001BD02C0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M3"
FT                   /transl_table=11
FT                   /translation="MAREFSRTQRVAQEMQKEIAIILQREVKDPRVGMATVSGVEVSRD
FT                   LAYTKVFVTFLNDGEPETVKAGLKALQDASGFIRMLLGKAMRLRVVPELTFAYDASLVE
FT                   GMRMSNLVSNVVKDDEARRTAADRDEEA"
FT   CDS_pept        431248..432210
FT                   /codon_start=1
FT                   /gene_family="HOG000231223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410606"
FT                   /gene_name="truB"
FT                   /locus_tag="ETAF_0362"
FT                   /function="RNA binding"
FT                   /function="lyase activity"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="ADM40486.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001BD02C1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M4"
FT                   /transl_table=11
FT                   /translation="MSRPRRRGRDINGVLLLDKGQGMSSNDVLQKVKRIYNANKAGHTG
FT                   ALDPLATGMLPICLGEATKFSQFLLDADKRYRVIARLGQRTDTSDADGQVVCERPLSFS
FT                   EAELAQALEGFRGPGRQVPSMYSALKYQGRPLYEYARQGIDVPRESREITVFELRFIRW
FT                   EGDELELEIHCSKGTYIRTIIDDLGEVLGCGAHVIYLRRLQVSGYPSERMVTLEQLQAL
FT                   LAQAQQQERDPRLLLDPLLLPMDTAAAHLPEVNLSEIVAGYVQLGQPVQTPDLPQSGMV
FT                   RISVGAAHRFIGVGEVDDQGRLAPRRMVVESRLSEDDPT"
FT   CDS_pept        432359..432628
FT                   /codon_start=1
FT                   /gene_family="HOG000040097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410607"
FT                   /gene_name="rpsO"
FT                   /locus_tag="ETAF_0363"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40487.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniParc:UPI0001A59DC4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M5"
FT                   /transl_table=11
FT                   /translation="MSLSVEAKAKIVAEFGRDANDSGSTEVQVALLTAQINHLQGHFAE
FT                   HKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYSSLIERLGLRR"
FT   CDS_pept        432884..435007
FT                   /codon_start=1
FT                   /gene_family="HOG000218327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410608"
FT                   /gene_name="pnp"
FT                   /locus_tag="ETAF_0364"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /function="polyribonucleotide nucleotidyltransferase
FT                   activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="mRNA catabolic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ADM40488.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004654"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006402"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI0001BD02C2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M6"
FT                   /transl_table=11
FT                   /translation="MLTPTVRKFQYGQHTVTLETGMMARQATAAVMVTMDDTAVFVTVV
FT                   GAKKAREGQDFFPLTVNYQERAYAAGRFPGGFFRREGRPGEGETLTARLIDRPIRPLFP
FT                   EGFLNEVQVVATVVSVNPQVSPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVL
FT                   NPTMDELKQSRLDLVVAGTDNAVLMVESEADLLSEDQMLGAVVFGHDQQQVVIENIKAL
FT                   AAEVGKPRWEWHAPEVNVALQHRVAEMAEARLGEAYHITEKQARYAKVDEIKESVIVDL
FT                   LAEDDALDAGEISDILGALEKAVVRGRVLRGEPRIDGREKDMIRALDVRTGVLPRTHGS
FT                   ALFTRGETQALVTATLGTERDAQNIDELTGERTDRFLLHYNFPPYSVGETGMMGSPKRR
FT                   EIGHGRLAKRGVLAVMPSQDAFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIK
FT                   AAVAGIAMGLVKEQDNFVVLSDILGDEDHLGDMDFKVAGSRDGVTALQMDIKIEGITRE
FT                   IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPEKIKDVIGKGGSVI
FT                   RALTEETGTTIEIEDDGTVKIAATDGDKAKHAIRRIEEITAEIEVGRIYQGKVTRIVDF
FT                   GAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVAVKVLEVDRQGRVRLSIKEANA
FT                   SAAAGQDAPADAE"
FT   CDS_pept        435127..436011
FT                   /codon_start=1
FT                   /gene_family="HOG000276076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410609"
FT                   /locus_tag="ETAF_0365"
FT                   /function="binding"
FT                   /protein_id="ADM40489.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001BD02C3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M7"
FT                   /transl_table=11
FT                   /translation="MKPILRWCYVATAILLAGCSNADWRQNEVLAIPLQPSLQQEVMLA
FT                   RMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYSYARLNRGIALYYGGRYSLAQDDLQAFYQDDPND
FT                   PFRSLWLYLAERELNQEQALTALSQRYNKANRSQWGWNIVEFYLGKISEKTLMERLQAD
FT                   ATDNTSLAEHLSETDFYLGKHYLSLGEKSSASALFKLTVANNVHNFVENRYALLELARL
FT                   GQEQDDIPESDQQ"
FT   CDS_pept        436185..438050
FT                   /codon_start=1
FT                   /gene_family="HOG000268810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410610"
FT                   /locus_tag="ETAF_0366"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ADM40490.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001E35463"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M8"
FT                   /transl_table=11
FT                   /translation="MAEFETTFADLGLAAPIIEALNDLGYEKPSPIQAACIPHLLNGRD
FT                   VLGMAQTGSGKTAAFSLPLLNNIDPSLKAPQVLVLAPTRELAVQVAEAMADFSKHMHGI
FT                   NVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLSLTSLRGLVLDEADEMLR
FT                   MGFIEDVETIMAQIPAEHQTALFSATMPEAIRRITRRFMNEPQEVRIQSSVTTRPDISQ
FT                   SYWTVYGMRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYSSAALNGDMNQ
FT                   ALREQTLERLKDGRLDILIATDVAARGLDVDRISLVVNYDIPMDAESYVHRIGRTGRAG
FT                   RAGRALLFVDNRERRLLRNIERTMKLTIPEVELPNAELLSTRRLAKFAARVQQQLESSD
FT                   LDQYRALLAKLQPEDEQDMETLAAALLKMAQGERPLILPPDPVVERRPRREFRERDERG
FT                   GDRPRRERREVGDMELYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIRLFGSHSTI
FT                   ELPKGMPGDLLTHFTRTRILNKPMNMQLIGDAPAREQRRERSGERGGERRSFGGRDGGR
FT                   DGDRRSFGGQRRFSDDRRGDRGFNRDSRSTRSDDNGHSRRRFNDA"
FT   CDS_pept        438183..438299
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410611"
FT                   /locus_tag="ETAF_0367"
FT                   /protein_id="ADM40491.1"
FT                   /db_xref="UniParc:UPI0001BD02C5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7M9"
FT                   /transl_table=11
FT                   /translation="MRYIYKKLGSPAHFFFPMHFFSFTPSAFASIEKEARYQ"
FT   CDS_pept        438661..439968
FT                   /codon_start=1
FT                   /gene_family="HOG000275613" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410612"
FT                   /locus_tag="ETAF_0368"
FT                   /protein_id="ADM40492.1"
FT                   /db_xref="UniParc:UPI0001E35464"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N0"
FT                   /transl_table=11
FT                   /translation="MALTDHPAVTRDGMSDSEWREATRFDSTDVGWVIMSIGMAIGAGI
FT                   VFLPVQVGLMGLWVFLLSSVVGYPAMYLFQRLFINTLAESPECRDYPSVISGYLGKNWG
FT                   ILLGALYFVMLVIWMFVYSTAITNDSASYLHTFGVTEGLLSENPFYGLALICVLVAISS
FT                   RGELLLFKLSSFMVLTKLLVVAALGIAMVGVWHLYNVGALPPLGLLVKNAVITLPFTLT
FT                   SILFIQTLSPMVISYRAHCKSREVARYKALRAMNIAFGVLFVTVFFYAVSFTLAMGHDE
FT                   AVKAYQQNISALAIAAQFIDGGAGNWVTVVSVILNIFAVMTAFFGVYLGFREATQGIVM
FT                   NLLRRMMPPERIKARWVQNGIMVFAVLLAWGAIILNAPVLSFTSICSPIFGMVGCLIPA
FT                   YLVYRVPALHKYKGVSLLVIIITGLLLCISPLLAFS"
FT   CDS_pept        440013..441329
FT                   /codon_start=1
FT                   /gene_family="HOG000237280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410997"
FT                   /locus_tag="ETAF_0369"
FT                   /protein_id="ADM40493.1"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniParc:UPI0001BD02C7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N1"
FT                   /transl_table=11
FT                   /translation="MNTIQNACDTDALWAEFIRAVRQEVKPAVGCTEPVSLALAAAIAA
FT                   RQLAAPVDRIVCRVSPNLMKNGMGVTVPGTGMVGLPIAAALGALGGDADAGLEVIKNAS
FT                   AASVAAARALLAEGRVSVGMEQPCEQVLLSCARVYAGEAWAEVTIAGDHTRVVRIVHND
FT                   REIFRAADVANAATEAGYCLAQASLAQVYRFACDVPLERISFILDAAELNGALSREGLR
FT                   SRYGLHIGATLAQQRERGLLSHDLLSEIMIRTSAASDARMGGAVLPAMSNSGSGNQGIT
FT                   ATMPVVVVAEHMQASQEQLARALMLSHLTAIYIHSKLPTLSALCAATTAAMGAAAGIAW
FT                   LIDGRYEAVAMAIGSMIGDVSGMICDGASNSCAMKVSTSASAAFKAVLMALDDSAVSGN
FT                   EGIVAHDVDQSIANLCALASGAMRQTDTQIIEIMARKAS"
FT   CDS_pept        complement(441390..442268)
FT                   /codon_start=1
FT                   /gene_family="HOG000276087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410998"
FT                   /locus_tag="ETAF_0370"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40494.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniParc:UPI0001BD02C8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N2"
FT                   /transl_table=11
FT                   /translation="MQFALGAVLYCWPQARLEAFYRAAAASEADIVYLGETVCSKRRVI
FT                   KSSDWLALARTLADSGKQVVLSTLALLQAPSELSELRRYIENGEFLIEANDLAAVNLAA
FT                   ERHLPFVAGPALNCYNAVTLRLLLRQGMVRWCMPVELSRDWLRNIRQQCDELGILGQFE
FT                   TEVFAYGHLPLAYSARCFTARAENLPKDECDTCCIRYPQGRRVLSQEQQQVFVLNGIQT
FT                   LSGYCYNLGNQLREMQGLVDIVRLSPQGEETLEMLSRFRANQQGEAPLTLARQAECNGY
FT                   WNQLAGLTLSS"
FT   CDS_pept        complement(442280..443275)
FT                   /codon_start=1
FT                   /gene_family="HOG000276098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22410999"
FT                   /locus_tag="ETAF_0371"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40495.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI0001BD02C9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N3"
FT                   /transl_table=11
FT                   /translation="MELLCPAGNLPALKAAVENGADAVYIGLKDDTNARHFAGLNFNEK
FT                   KLQEALEYVHQRGRKLHIAINTFAHPDGYSRWQRAVDMAAQLGADALILADLAMLEYAA
FT                   ERYPHIERHVSVQASVTNEEAIRFYQRHFAVARVVLPRVLSLHQVKQLARCSPVPLEVF
FT                   AFGSLCIMSEGRCYLSSYLTGESPNTVGACSPARFVRWQQTPQGMESRLNDVLIDRYAN
FT                   DENAGYPTLCKGRYLVDGVRYHTLEEPTSLNTLALLPALMEANIASVKIEGRQRSPAYV
FT                   SQVTRVWRQAIDRCRRDPEHFTPDAAWMEALDAVSEGAQTTLGAYHRRWQ"
FT   CDS_pept        443579..444100
FT                   /codon_start=1
FT                   /gene_family="HOG000276109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411000"
FT                   /locus_tag="ETAF_0372"
FT                   /function="sterol binding"
FT                   /protein_id="ADM40496.1"
FT                   /db_xref="GO:0032934"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016830"
FT                   /db_xref="UniParc:UPI0001BD02CA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N4"
FT                   /transl_table=11
FT                   /translation="MLEQLRARIVRQGPAFLSLPLKVTPFVLQRHVLEQLLAWQFRQAL
FT                   AEGELAFLDGRWLQVDVRDLGLRWFVTVQQGTLRVGRQQQADVSFSADANDLILIAARK
FT                   EDPDTLFFQRRLRIEGDTELGLQVKNLMDAIDPELMPAPLRLALMQLADFVEAGLREGT
FT                   PIDARAVTSC"
FT   CDS_pept        444094..444597
FT                   /codon_start=1
FT                   /gene_family="HOG000031671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411001"
FT                   /locus_tag="ETAF_0373"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ADM40497.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001BD02CB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N5"
FT                   /transl_table=11
FT                   /translation="MLIRAEIPVDAPGIDRLLRRCFPGADEAELVSCLREDGLLTLGIV
FT                   ATDDEGGVVGYAAFSPVTVDGEECQWVGLAPLAVDEAYRRQGIAERLVYEGLDTLNEFG
FT                   YAGVAVLGDPRYYQRFGFVNAAQNDLHCRWPECDTLFQVYALAPQALEQARGRIEYAEP
FT                   FNRF"
FT   CDS_pept        444978..446411
FT                   /codon_start=1
FT                   /gene_family="HOG000282935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411002"
FT                   /locus_tag="ETAF_0374"
FT                   /function="proline:sodium symporter activity"
FT                   /function="sodium ion binding"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40498.1"
FT                   /db_xref="GO:0005298"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031402"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniParc:UPI0001E35465"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N6"
FT                   /transl_table=11
FT                   /translation="MILIGLLAYRATNNFSDYILGGRRLGSVVTALSAGASDMSGWLLM
FT                   GLPGAIFVAGLSESWIAIGLVLGAYLNWRIVAGRLRVHTELNNNALTLPDYFTQRFEDK
FT                   QRILRLISALIILVFFTVYCASGVVAGARLFESTFGMSYESALWAGAAATIAYTFIGGF
FT                   LAISWTDTVQATLMIFALILTPVMVVVSVGGFDDAMNAIAQRSPAYLDLFRGLDWVAIV
FT                   SLMGWGLGYFGQPHILARFMAADSHHTIRKARRISIVWMIFCLGGAVAVGFFGIAFFST
FT                   HPELALEVHENKERVFISLSKLLFNPWIAGILLSAILAAVMSTLSCQLLVSASAVTEDL
FT                   YKAFLRKHANQRELVIVSRTMVMLIALIAIGLAANPHNYVLDLVSYAWAGFGAAFGPVI
FT                   IISLLWPGMTRNGALAGMLVGAATVVVWKQYAWFHLYEIIPGFILASLAIVLVSLVGKG
FT                   PSPQMRERFAQANTIYLTK"
FT   CDS_pept        446798..447253
FT                   /codon_start=1
FT                   /gene_family="HOG000103682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411003"
FT                   /locus_tag="ETAF_0375"
FT                   /function="FMN binding"
FT                   /protein_id="ADM40499.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0001BD02CD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N7"
FT                   /transl_table=11
FT                   /translation="MSNDDTLAAIRRFLARQHVVTLAVGQGEALWCADCFYALDAPTMT
FT                   LYLLTSPTSHHGRLMSVNPRVAGTVAHQTRSVAKIQGIQFHGRVACLEGEAAAAAYALY
FT                   YRRFPLARARPSPVWGLRLMRVKMTDNTCGFGHKRHWARQGEPVGVY"
FT   CDS_pept        447361..448035
FT                   /codon_start=1
FT                   /gene_family="HOG000258441" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411004"
FT                   /locus_tag="ETAF_0376"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ADM40500.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001BD02CE"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N8"
FT                   /transl_table=11
FT                   /translation="MNVLLLGATGLIGRALLTRLTSEPRVTQIYAPTRTALPASAKLIN
FT                   PVGADICRAMLEWDTPCDVAFCCLGTTRKAAGSDSDFRYVDYSLVVECGAVALQHGCRH
FT                   YVVVSALGANAQSPFLYSRTKGEMEQALELQAWRRLSLLRPSLLQGERAKPRLLEQISE
FT                   PLFRLLPEKWKAIEADSVARAMLHCALYPAEYRLQILESEQVQRLGETATGGADTGADQ
FT                   RR"
FT   CDS_pept        complement(448023..448487)
FT                   /codon_start=1
FT                   /gene_family="HOG000222587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411005"
FT                   /gene_name="nrdG"
FT                   /locus_tag="ETAF_0377"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="[formate-C-acetyltransferase]-activating enzyme
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="oxygen and reactive oxygen species
FT                   metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40501.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006800"
FT                   /db_xref="GO:0043365"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="UniParc:UPI0001BD02CF"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7N9"
FT                   /transl_table=11
FT                   /translation="MNYHQYYPVDVVNGPGTRCTLFVAGCVHQCPGCYNKATWRLDSGV
FT                   PFTTALEDRIIADLNDTRINHQGLSLSGGDPLHPHNVATILHLVQRVRTECRGKDIWLW
FT                   TGYRLEELTAEQQAVVALINVLVDGKFVQDLKDPMLIWRGSSNQIVHYLR"
FT   CDS_pept        complement(448571..450709)
FT                   /codon_start=1
FT                   /gene_family="HOG000222474" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411006"
FT                   /locus_tag="ETAF_0378"
FT                   /function="ribonucleoside-triphosphate reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40502.1"
FT                   /db_xref="GO:0008998"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniParc:UPI0001BD02D0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P0"
FT                   /transl_table=11
FT                   /translation="MKPIVIKRDGCQVPFNEQRIKEAVLRAALAADVDDADYCATVARV
FT                   VAMQMADRERVDINDIQHAVENQLMAGNYKQLARAYIEYRHDRDVAREQRGRLNQDIRG
FT                   LIEQSNAALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHLLPRDVVQAHERGEIHYHD
FT                   LDYSPFFPMFNCMLIDLKGMLTNGFKMGNAEIERPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEVLAPFVSASFAKHRQIAEQWNIPDVEGYAHARTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTSWESRMIQQSILKNRIAGLGKNRKTAVFPKLVFAIRDGLNH
FT                   KFGDPNYDIKQLALECASKRMYPDILNYDQVVNVTGSFKTPMGCRSFLGVYEENGEMIH
FT                   DGRNNLGVISLNLPRIALEAQGDEAAFWKLLDRRLALARKALMTRIARLEGVKARVAPI
FT                   LYMEGACGVRLKADDAIADIFKNGRASVSLGYIGIHETINALFGTQTHVFDDAALRAKA
FT                   IAIVERLRQATDTWKQETGYAFSLYSTPSENLCDRFCRLDTAEFGLVEGVTDKGYYTNS
FT                   FHLDVEKQVNPYDKLDFEAPYPPLANGGFICYGEYPNLQHNLKALEDVWDYSYSRVPYY
FT                   GTNTPIDECYECGYTGEFECTSKGFTCPKCGNHDSTKVSVIRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRIKHLNNGQIG"
FT   CDS_pept        450734..450877
FT                   /codon_start=1
FT                   /gene_family="HOG000156613" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411007"
FT                   /locus_tag="ETAF_0379"
FT                   /protein_id="ADM40503.1"
FT                   /db_xref="UniParc:UPI0001BD02D1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P1"
FT                   /transl_table=11
FT                   /translation="MCIHLPVIHSTKPREIRLYARCVDALWITTIYRCSFTSETLYMGM
FT                   AI"
FT   CDS_pept        complement(451119..451406)
FT                   /codon_start=1
FT                   /gene_family="HOG000125159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411008"
FT                   /gene_name="yqjK"
FT                   /locus_tag="ETAF_0380"
FT                   /protein_id="ADM40504.1"
FT                   /db_xref="UniParc:UPI0001BD02D3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P2"
FT                   /transl_table=11
FT                   /translation="MNRQRQSLAAEKARLLQKIAQQRVDLHTESLRAEQLCINVDRTLT
FT                   TLWRLRRTLSLAAGLAAVYAARHPSRLLSGIKRAVGLWSTLRLARRTFYP"
FT   CDS_pept        complement(451403..451807)
FT                   /codon_start=1
FT                   /gene_family="HOG000256764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411009"
FT                   /gene_name="yqjE"
FT                   /locus_tag="ETAF_0381"
FT                   /protein_id="ADM40505.1"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniParc:UPI0001BD02D4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P3"
FT                   /transl_table=11
FT                   /translation="MAGDTSPTQDSAAGILGTARRIVTLLVGMTETRLRLAVVELEEEK
FT                   ANLIQLLLMAGVTLLFTAFGLMCLLVLLFWAVEPAYRLMALGIATALLLLLACVGAIWT
FT                   LTKARRSTFLLATRKQLEIDRQLLERREKP"
FT   CDS_pept        complement(451807..452112)
FT                   /codon_start=1
FT                   /gene_family="HOG000256775" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411010"
FT                   /gene_name="yqjD"
FT                   /locus_tag="ETAF_0382"
FT                   /protein_id="ADM40506.1"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniParc:UPI0001BD02D5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P4"
FT                   /transl_table=11
FT                   /translation="MTNDSTAEHLRAELKSLADALEDVLNSSTDKPKAELEKLRARAHD
FT                   ALHNSRERLSQAGENVATQTREMAGRADDYVRDNPWTGVGIGAAVGVVLGVLLARR"
FT   CDS_pept        complement(452385..452747)
FT                   /codon_start=1
FT                   /gene_family="HOG000156614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411011"
FT                   /gene_name="yqjB"
FT                   /locus_tag="ETAF_0383"
FT                   /protein_id="ADM40507.1"
FT                   /db_xref="UniParc:UPI0001E3548B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P5"
FT                   /transl_table=11
FT                   /translation="MLGLLLFIVAALTAVILPQLGHKEVSLQIRATHSGLATPDGFFVY
FT                   QKLDENGVSITSITPDREGLVVRLAHPEQQALALQVLQRELPPGYSIADKILHRSLFHK
FT                   SERPAAALSYSAGRNS"
FT   CDS_pept        complement(452800..453480)
FT                   /codon_start=1
FT                   /gene_family="HOG000105367" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411012"
FT                   /gene_name="yqjA"
FT                   /locus_tag="ETAF_0384"
FT                   /protein_id="ADM40508.1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniParc:UPI0001BD02D7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P6"
FT                   /transl_table=11
FT                   /translation="MDIIRELITALWHQDYETLANPSLVWTIYGILFVILFLENGLLPA
FT                   AFLPGDSLLILVGVLIARDTMDFPLTLLVLTSAASLGCWVGYLQGRWLGNTHLVQKWLS
FT                   HLPAHYHQRAHQLFHRHGLAALLIGRFLAFVRTLLPLIAGLSGLNGPRFQFFNWISGLL
FT                   WVLILSSLGYVLGKTPLFLRYEDQLMNLLMLLPLVLLVFGLCGSLLVLWRKKHAHATGK
FT                   SPRK"
FT   CDS_pept        complement(453581..454045)
FT                   /codon_start=1
FT                   /gene_family="HOG000156615" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411013"
FT                   /locus_tag="ETAF_0385"
FT                   /protein_id="ADM40509.1"
FT                   /db_xref="UniParc:UPI0001BD02D8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P7"
FT                   /transl_table=11
FT                   /translation="MKRVTSASLLLLLCCWAATAIGKIGAWHSQAVTTLPLSQFPCNTA
FT                   VFSENYRDPAGSHCLSRIPHNRKITALIRLHICGGSEVVRNGLIPPDVPPPETRQPYRP
FT                   QAPGNDGHYARLSRILLRTLQLPPHQNRLGGWKESNILYRGQVTYHPALA"
FT   CDS_pept        complement(454236..454625)
FT                   /codon_start=1
FT                   /gene_family="HOG000052573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411014"
FT                   /gene_name="crcB"
FT                   /locus_tag="ETAF_0386"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40510.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniParc:UPI0001BD02D9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P8"
FT                   /transl_table=11
FT                   /translation="MNYGLTLLVVACGGALGAISRFQITNWFSAWFGSGFPYATLTVNV
FT                   IGCFIMGALVSMLNSGTLIAPHWRPLIGVGFLGALTTFSTFSFDTFALFSEGFWMKAML
FT                   NVVLNLILCMAAVSAGYYLLLSRSA"
FT   CDS_pept        complement(454910..455677)
FT                   /codon_start=1
FT                   /gene_family="HOG000273991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411015"
FT                   /gene_name="exuR"
FT                   /locus_tag="ETAF_0387"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADM40511.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001BD02DB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7P9"
FT                   /transl_table=11
FT                   /translation="MECTRLYQQLAAELKQRVEGGVYPVGDKLPAERFIAEEMDVSRTV
FT                   VREAIIMLEVEGYVEVRKGSGIHVINNQPKSLIQPDNAIEFASAGPFELLQARQLIESN
FT                   IAEFAATQVTKQDIVALMEIQERARQEDRFRDSEWDLKFHVQVALATQNSAMATIVEKM
FT                   WSQRTHNPYWLKLHEHIDDKSIESWCEDHDKILKALIRKDPYGAKIAMWQHLENTKQML
FT                   FHATTDDFEFNVDRYLFAENPVVHLDAVANGGK"
FT   CDS_pept        complement(455850..457145)
FT                   /codon_start=1
FT                   /gene_family="HOG000113643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411016"
FT                   /locus_tag="ETAF_0388"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40512.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004744"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001BD02DC"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q0"
FT                   /transl_table=11
FT                   /translation="MRKIKGLRWYMIGLVTIGTVLGYLTRNAIAVAAPALEDTLHITTQ
FT                   QYSYIIATYSACYTIMQPVAGYVLDLLGTKVGYAVFAVLWALFCMGTALANSWGGLAIA
FT                   RGAVGMAEAAMIPAGLKASSEWFPAKERSIAVGYFNVGSSIGGMIAPPLVVWAIMVHSW
FT                   EMAFIITGALSLLWAIGWLIFYKQPQDQKRLSDEERQYILSGQEAQHKGDNATRMSAWQ
FT                   ILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKAYGFNLKEIAMFAWMPMLFADLGCV
FT                   IGGYLPPLFQKYFNVNLIVSRKLVVTLGAVLMIGPGMIGLFSSPYIAIALLCIGGFAHQ
FT                   ALSGSLITLSSDVFGRNEVATANGLTGMAAWTASTLFALVVGALADTLGFSPLFAALAV
FT                   FDLLGALIIWTVLQNRTANDPQPIPRPANANA"
FT   CDS_pept        457657..459066
FT                   /codon_start=1
FT                   /gene_family="HOG000224075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411017"
FT                   /gene_name="uxaC"
FT                   /locus_tag="ETAF_0389"
FT                   /function="glucuronate isomerase activity"
FT                   /biological_process="glucuronate catabolic process "
FT                   /protein_id="ADM40513.1"
FT                   /db_xref="GO:0006064"
FT                   /db_xref="GO:0008880"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR023177"
FT                   /db_xref="UniParc:UPI0001BD02DD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q1"
FT                   /transl_table=11
FT                   /translation="MSPFLTEDFLLDTEFARRLYHDYAAEQPIFDYHCHLPPEQIAENY
FT                   RFKNLYDIWLKGDHYKWRAMRTNGVAERFCTGEASDREKFQAWAETVPHTIGNPLYHWT
FT                   HLELRRPFGITDTLLSAATAEDIWTRCNRMLAEDSFTARGIMGQMNVKMVGTTDDPIDD
FT                   LRHHRTIAADSSFTTKVLPSWRPDKAFNIDAALFSDYIAKLGAVADVDITRFADLCQAL
FT                   KVRMDYFAAHGCKVSDHALDVVVYGEADDATLDGILARRLSGGTPSETEVAQFKTAVLL
FT                   FLGREYQQRGWVQQYHIGALRNNNTPMFARLGADIGFDSINDAPVAQPLSRLLDAQSRN
FT                   GGLAKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMQRQMTQLAQ
FT                   LGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVAQGEAPADIALLGSMVKNICF
FT                   DNAKSYFAIEL"
FT   CDS_pept        459173..460651
FT                   /codon_start=1
FT                   /gene_family="HOG000029586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411018"
FT                   /locus_tag="ETAF_0390"
FT                   /function="coenzyme binding"
FT                   /function="tagaturonate reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40514.1"
FT                   /db_xref="GO:0009026"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001BD031E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q2"
FT                   /transl_table=11
FT                   /translation="MQTLNRRDFPGRQHPDKVIQFGEGNFLRAFVDWQLDLLNEHTDLD
FT                   AGIVVVRPIDSDFPPSLNCQDGLYTTIVRGLNERGEAVSTSRVIRSVNRELNVYREFDA
FT                   FLALARDPNIRFVFSNTTEAGISYAPQDRLSDAPPSSFPAKLTRLLYERFCHFDGAADK
FT                   GWVLLPCELIDYNGEALRELVLRYAEQWDLPPAFTVWLTEHTTFCATLVDRIVTGYPRD
FT                   EATSLCDALGYQDSFLDTAEYFYLFVIQGPQWLAQALRLDAYAATQGPLNIRIVEDIRP
FT                   YKERKVAILNGAHTALVPVAYLAGLDTVGQSMDDAQVAAFVEQTIAQEIIPQLDLPIEE
FT                   LNAFSAAVIARFRNPYIQHQLLSIALNGMTKFRTRILPQLLSYRARQNAVPLRLSFALA
FT                   ALIAFYRGERDGLRYPLQDDAHWLAFYAAGWEAVRAGEQTLEQLVSAVLAQSAHWGEDL
FT                   NGVPGLTQQVSRALQAIEQQGMRAALGALLASSY"
FT   CDS_pept        460670..462160
FT                   /codon_start=1
FT                   /gene_family="HOG000219064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411019"
FT                   /locus_tag="ETAF_0391"
FT                   /function="altronate dehydratase activity"
FT                   /function="hydrolase activity"
FT                   /protein_id="ADM40515.1"
FT                   /db_xref="GO:0008789"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniParc:UPI0001BD031F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q3"
FT                   /transl_table=11
FT                   /translation="MQSIIKIHPQDNVAVALRDLAAGETIALDDGALTLRDAVPRGHKV
FT                   ALCHLAPQAMVIKYGLPIGHALTPIAAGDHVHAQNLRTNLSDLDSYQYQPDFAAPTAQP
FT                   ADRAISLYRRASGEVAIRNELWILPTVGCVNGMARQMLQRFLRESDGASAIDGVHLFTH
FT                   PFGCSQLGDDHQNTRTLLQNMVHHPNAGGVLVVGLGCENNQIAAFRETLGDYDPARVRF
FT                   LVCQQQDDEVEAGTEALHELYGAMRGDRREPGRLSELKFGLECGGSDGFSGISANPLLG
FT                   RFSDYVIAHGGTSVLTEVPEMFGAERILMSRCRDGETFEKTVAMVNDFKRYFIDHQQPI
FT                   YENPSPGNKAGGITTLEEKSLGCTQKAGQSQVMDVLRYGERLHTPGLNLLSAPGNDAVA
FT                   TSALAAAGCHMVLFSTGRGTPYGGFVPTVKLATNTPLAAKKPHWIDFDAGQLLQGKPMA
FT                   LLLSEFIDLIVAIADGRQTCNEKNDFRELAIFKSGVTL"
FT   CDS_pept        462222..462743
FT                   /codon_start=1
FT                   /gene_family="HOG000125147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411020"
FT                   /locus_tag="ETAF_0392"
FT                   /protein_id="ADM40516.1"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniParc:UPI0001BD0320"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q4"
FT                   /transl_table=11
FT                   /translation="MSGELLFAQGVGIVAFLVGITTFFNRDERRFRLQLALYSAIIGAH
FT                   FFLMGASAAGMSAELNAIRSVVATRTRNVWIMALFIALTLGLGGWELKHPVEVLPIVGT
FT                   IASTWALFRCRGLTTRCVMWCSTACWVIHNLWLGSLGGSLIEGSFLLINGYNIVRFYRM
FT                   QRRGIDPFRS"
FT   CDS_pept        complement(462853..464073)
FT                   /codon_start=1
FT                   /gene_family="HOG000218252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411021"
FT                   /gene_name="sstT"
FT                   /locus_tag="ETAF_0393"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /function="sodium:dicarboxylate symporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40517.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017153"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="UniParc:UPI0001BD0321"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q5"
FT                   /transl_table=11
FT                   /translation="MRFITRGSLVGQILVGLVLGIALASFSQSGAIAAGLLGTLFVSAL
FT                   KAVAPVLVFILVAASIANHRQGQKTNMRPIVLLYLLGTFAAALVAVVVSFAFPSQLALV
FT                   SHTNDITPPGGIVEVLQSLLMNVVDNPFRALANGNFIGILAWAIGLGVALRHASDTTKR
FT                   VVGDLSYGVTFIVRVVIRFAPLGIFGLVSSTLAETGFDALWGYAHLLMVLIGAMLLVAL
FT                   VLNPLIVFWKIRRNPYPLVFTCLRESGLTAFFTRSSAANIPVNMELCKKLKLNEDTYAV
FT                   SIPLGATINMAGAAITITVLTLAAAHTLGISVDLPTALLLSLVAAVCACGASGVAGGSL
FT                   LLIPLACSLFGISSDIAMQVVAVGFIIGVLQDSCETALNSSTDVLFTAAACVAAEESTG
FT                   DSAAELG"
FT   CDS_pept        complement(464446..465414)
FT                   /codon_start=1
FT                   /gene_family="HOG000230189" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411022"
FT                   /gene_name="terC"
FT                   /locus_tag="ETAF_0394"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40518.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniParc:UPI0001BD0322"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q6"
FT                   /transl_table=11
FT                   /translation="MLNSVGTPWLWGSFALIILIMLAIDLLLQGRRGAQAMTMRQAAVW
FT                   SLVWVSLALLFNAGLWLYLSETLGRAAADQQALAFLTGYLIEKALAVDNVFVWLMLFSY
FT                   FSVPANMQRRVLVYGVLGAIILRTIMIFAGSWLVTQFQWILYLFGAFLLFTGIKMAMAH
FT                   DDDGDLGDRPLVRWLRRHLRMTDCIESEHFFTRRSGTLFATPLLLVLILVELSDVIFAV
FT                   DSIPAIFAVTTDPFLVLTSNLFAILGLRAMYFLLAGVAERFTLLKYGLAAILTFIGIKM
FT                   LIVDFYHIPIAFSLGIVAGILALTLLINAGVNHRRASRAPR"
FT   CDS_pept        465799..466707
FT                   /codon_start=1
FT                   /gene_family="HOG000277404" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411023"
FT                   /locus_tag="ETAF_0395"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40519.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI0001BD0323"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q7"
FT                   /transl_table=11
FT                   /translation="MAVARKTNPLAIAGLIALTLIWSYSWIAMKQVTQYIGAFDFTALR
FT                   CVCGALLLLVVLHLRGRGMRPTPFGYTLAIALLQTCGMVGLAQWALMSGGAGKVAILSY
FT                   TMPFWVVIMAALFLGERMRRLQYVAIAAAALGLLLVLQPWKLDLSSLQSALLAVLSGIS
FT                   WGASAIVAKRMYARYPGIDLLGLTTWQMLYAAVVMSVVAWLVPQRSVDWQPYVFWALAY
FT                   SAILATALAWSLWLFVLKNLPAGIASLSTLAVPVCGVLFSWWLLGENPGPVEGCGIVLI
FT                   ALALAVISIKRQGPQAQSTRR"
FT   CDS_pept        complement(466742..467722)
FT                   /codon_start=1
FT                   /gene_family="HOG000227441" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411024"
FT                   /locus_tag="ETAF_0396"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ADM40520.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001BD0324"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q8"
FT                   /transl_table=11
FT                   /translation="MIRLAIIGTNWITRRFVDAALACGQYRLSAVYSRRLEQAADFAAP
FT                   YGAVHCFDSLDALACSPEVDAVYIASPNALHCAQTLLMLRHGKHVICEKPLASTHAEAQ
FT                   RAFDCARANGVVLFEAFKTAYLPNFDVIRSALPRLGRLRKAFLNYCQYSSRYPRYLNGE
FT                   NPNTFNPAFSNGSIMDIGFYCLASGVALFGEPQRVSAEAVLLDSGVDAHGHVAMRYPGL
FT                   EVLLFHSKVSDSALPSEIQGEEGSLVIEHLSQCQRVTLIPRGGVAQEIGVVQRENTMEY
FT                   EAQAFARLIREGRVAHAGVARALSTARLLDEIRRQTGVVFPADRA"
FT   CDS_pept        complement(467778..468281)
FT                   /codon_start=1
FT                   /gene_family="HOG000276637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411025"
FT                   /locus_tag="ETAF_0397"
FT                   /function="hydrolase activity"
FT                   /protein_id="ADM40521.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniParc:UPI0001BD0325"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7Q9"
FT                   /transl_table=11
FT                   /translation="MTHLSYLAGYPEPLLAQVRTLLAQRRLGDTLRRRYPERHTITTDR
FT                   ALYDYAHSLKNLYMRNTPPLSRVQYDSRIQVIQQALGLHSVVSRVQGNRLKAKAEIRIA
FT                   SLFRQGPEALLRMIVVHELAHLREKNHDKAFYSLCCHMEPDYHQLEFDARLYLTCLDVE
FT                   GSVY"
FT   CDS_pept        468359..469504
FT                   /codon_start=1
FT                   /gene_family="HOG000246323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411026"
FT                   /gene_name="rlmG"
FT                   /locus_tag="ETAF_0398"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (guanine-N2-)-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40522.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008990"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="UniParc:UPI0001BD0326"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R0"
FT                   /transl_table=11
FT                   /translation="MSQLESSAGCPAITGLTLARFPRQSDDPSLQAWEAADEYLLQQID
FT                   LTQAQGRPTIIFNDAFGALACALHELRPYSVSDSYVSQLATRHNLQLNDLDEDAVTLLD
FT                   SLSPLPEAPALVVIKLPKMLALLEQQLHALRAVVAPDTRIIAAAKARDIHTSTLQLFES
FT                   ILGETHTSLAWKKARLIYCQVGERAVTPAPATTVWPLEGTPYTMHNHAGVFSRGSLDIG
FT                   ARFFLQHLPEGIQGEVADLGCGNGVLGLAALSSSPQARVLFADESYMAVASARLNVQHN
FT                   RPQDLARCEFWVGNGLAGREGGTLDAVLCNPPFHQQHSITDQVAWDMFVAARRCLKRNG
FT                   ALYIVGNRHLDYYPKLRRLFGNCATLGMNRKFVVLKAVKTA"
FT   CDS_pept        469687..470844
FT                   /codon_start=1
FT                   /gene_family="HOG000288510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411027"
FT                   /locus_tag="ETAF_0399"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40523.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001BD0327"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R1"
FT                   /transl_table=11
FT                   /translation="MDRRTLLKSSVALLGALSLSGPGSLARAQFVAQRPAAPDADHPLA
FT                   LNFNENALGMSAQAHQAIAAALPGAFRYPDAAREALIAALASEMALTPAHLSLGNGSSE
FT                   CIRAILQAQAIAAQRQGKAVQLVVPDPTFNYAELYLQPLGVEVVKVPLDAQLGFPLAEM
FT                   QRRTRAFNGLSLVYLCNPNNPTATLTPTDALAAWITQAPPDTFFVIDEAYAEFVNDPAF
FT                   RSAVALVQAGHENLLVTRTFSKLYALAGLRVGYGVAAPSVAAQSEALMSLDNTNSAGAA
FT                   AALASLQDRAFVEHSRKTTDLSRQIVCAALDELQLAYLPSQANFIFHQVNGDAARYQAR
FT                   MKQHHILVGRPFPPLNNWNRLTLGTPQEMQLFVAQLHAFRRQGWV"
FT   CDS_pept        complement(470872..472236)
FT                   /codon_start=1
FT                   /gene_family="HOG000223178" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411028"
FT                   /gene_name="qseC"
FT                   /locus_tag="ETAF_0400"
FT                   /function="ATP binding"
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40524.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniParc:UPI0001BD0328"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R2"
FT                   /transl_table=11
FT                   /translation="MRHLSRQLTHSLRARLTGGFLILVLLVWSSASALTWYQTRDALNE
FT                   LFDTQQMLFAKRLLAFDLSQLKHPLQLPQSHDLLRKHRGDQDKDALAFAIFNADGRMLL
FT                   NDGDNGDNLVYRYQGDGFTDGYLDNDDDSWRLLWLTTPDGRYRILVGQEWDYRNDMALS
FT                   IVGAQMVPWLVALPVMVILLLLVVSRGLAPLHRLAAALRRRRPDDATPLPREAIPSEVW
FT                   PVVASLNTLFARTNAQMVRERRFTSDAAHELRTPLAALRVQAEVVQLAQDDLALRQRAL
FT                   GQLEQGIDRATRLVDQLLTLSRLDSLSQLDDVQPRALAELLQTAVIDMDAKAHAAGVAL
FT                   ALSVDDPKVCRRIQPLLFSLLIRNLLDNAIRYSPTGSQVTLRLTSHRLQITDNGAGVSD
FT                   AVLQRLGERFYRPPGQEKTGSGLGLSIVRQIASLHGMQVQFDHAPGGGFQATLRW"
FT   CDS_pept        complement(472236..472895)
FT                   /codon_start=1
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411029"
FT                   /gene_name="qseB"
FT                   /locus_tag="ETAF_0401"
FT                   /function="DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40525.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001BD0329"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R3"
FT                   /transl_table=11
FT                   /translation="MRVLLIEDDRLIGDGIKAGLSKMGFTLDWFTDGQLGMTALESAPY
FT                   DAVILDLSLPGIDGLEILRRWREAGHAEPVLILTARDALEQRVTGLQQGADDYLCKPFA
FT                   LIEVAARLQALIRRNHGQAQTLLSHGAVSLDPLSLTATLDGASLPLKPKEFALLELLLR
FT                   NAGRVLPRSLIEEKLYSWDDDVSSNAVEVHIHHLRRKLGSHFIRTVHGVGYTLGDS"
FT   CDS_pept        473106..473510
FT                   /codon_start=1
FT                   /gene_family="HOG000216776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411030"
FT                   /locus_tag="ETAF_0402"
FT                   /protein_id="ADM40526.1"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="UniParc:UPI0001BD032A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R4"
FT                   /transl_table=11
FT                   /translation="MMKKSAAIFAILALCSAPVLAQTGGFSGPGATQQVQNTQQSGGFV
FT                   GGQQAVTTVAKAKDLNDNSWVVLQGNIEQRVRGDHYTFRDATGTIEVEIDHKYWNGQTI
FT                   TPKDKVEIQGEVDKDWNTTKIDVKRLHKMN"
FT   CDS_pept        complement(473569..476001)
FT                   /codon_start=1
FT                   /gene_family="HOG000274400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411031"
FT                   /locus_tag="ETAF_0403"
FT                   /function="formate C-acetyltransferase activity "
FT                   /function="lyase activity"
FT                   /biological_process="glucose metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40527.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0008861"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniParc:UPI0001BD032B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R5"
FT                   /transl_table=11
FT                   /translation="MTILQLNTLSERIRAHKEALIHIVTPPICTERAVHYTEAYQRHLD
FT                   KPVPVRRALALAEHLARRTIWINHDELIVGNQASRVRAAPIFPEYTVSWIEKEIDDLAD
FT                   RPGAGFSVTEEDKAVLHRVCPWWRGQTVQDRCYGMFTDEQKALLASGIIKAEGNMTSGD
FT                   AHLAVNYPLLLDLGLDGLRERVAARRRRIDLTQLDDLHGEQFLKAVDITLEAVSQHCLR
FT                   FAALARRMVVDEPRAERRSELLTIADGCEHIAHRPPQTFWQALQLCYFIQLLLQIESNG
FT                   HSVSFGRMDQYLYPWYRRDVELEQRLSREQAIELLQSCWLKLLEVNKIRSGTHSKASAG
FT                   SPLYQNVTIGGQNLVDGTPQDAVNPLSYAILESCGRLRSTQPNLSVRYHAGISDDFLEA
FT                   CTQVIRCGFGMPAFNNDEIVIPAFIDLGVAPQDAYQYAAIGCIETAVAGKWGYRCTGMS
FT                   FINVARVMLAALEGGRDATSGDVFLPQPQALSLGNFADFEQVMAAWERQIRYYTRKSIE
FT                   IEYVVDTALEENAHDILCSALVDDCIERAKSIKQGGAKYDWVSGLQVGIANLGNSLAAV
FT                   KKLVFEQGSISQQDLADALAQDFNGPQYELLRQRLLNGAPKYGNDDDSVDALLVRAYDS
FT                   YIDELSHYRNPRHGRGPVGGGYYAGTSSISANVPFGAATLATPDGRKAHTPLAEGASPA
FT                   SGTDRIGPTAVMGSVGKLPTRAILGGVLLNQKLNPATLENERDRQKLMLLLRTFFEVHK
FT                   GWHIQYNIVSRDTLLDAKAHPERYRDLVVRVAGYSAFFTALSPDTQDDIIARTEHVL"
FT   CDS_pept        complement(476006..476905)
FT                   /codon_start=1
FT                   /gene_family="HOG000011459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411032"
FT                   /locus_tag="ETAF_0404"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="[formate-C-acetyltransferase]-activating enzyme
FT                   activity"
FT                   /function="lyase activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="oxygen and reactive oxygen species
FT                   metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40528.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0006800"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0043365"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011352"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniParc:UPI0001BD032C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R6"
FT                   /transl_table=11
FT                   /translation="MIFNIQRYSTHDGPGIRTVIFLKGCSLACRWCQNPESLTRTPQLL
FT                   YDERSCLTGCSLCQQAAPAVAIRTGQGLTLLRQRADADTLERLRDCCPSQALTVCGEAL
FT                   AVEEILRQAERDRPFYQRSGGGITLSGGEPFMQPTLAETLLRRCHQSGIHTAVETCLHV
FT                   PWRYIAPALPYTDLFLADLKHVDEARFREWTGGSARRVMDNLTRLAAAGATLILRVPLI
FT                   PGFNANLDDIRRIVDFAAVALTVREIHFLPYHTLGRNKYRLLGQPYLAPAQPLNDPALL
FT                   DAARDYACQRGLSVILGG"
FT   CDS_pept        477049..477711
FT                   /codon_start=1
FT                   /gene_family="HOG000226075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411033"
FT                   /locus_tag="ETAF_0405"
FT                   /function="transaldolase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40529.1"
FT                   /db_xref="GO:0004801"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniParc:UPI0001BD032D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R7"
FT                   /transl_table=11
FT                   /translation="MELYLDTADCAAVQRLARILPLAGVTTNPSILARSGLSPAQALPR
FT                   LYDALGGHGRLFAQVMANDAQGMVSEARALRAIVDNLVVKVPVTSEGLAAIKLLKQEGI
FT                   PTLGTAVYGAGQGLLAALAGADYIAPYVNRLDAQGGDGIKTVEALQRLLTLHAPQASVL
FT                   AASFKNARQALDCLLAGCGAITLPIEVAEQFISAPAVTAAVAQFEQDWQDAFGRRTL"
FT   tRNA            complement(477941..478016)
FT                   /gene_name="tRNA-Met"
FT   CDS_pept        478152..478664
FT                   /codon_start=1
FT                   /gene_family="HOG000264684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411034"
FT                   /locus_tag="ETAF_0406"
FT                   /function="hydrolase activity, hydrolyzing N-glycosyl
FT                   compounds"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ADM40530.1"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016799"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="UniParc:UPI0001BD032E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R8"
FT                   /transl_table=11
FT                   /translation="MSVDILAPGLRVVFCGINPGLSSAHTGYHFANPRNRFWSVIHLAG
FT                   FTDRQLAPQEERHLLDTGCGITALVQRPTVTAAELTAAELRAGGDALQAKIARYQPRAL
FT                   AVLGKQAFTQAFGIRRPAWGRQALRIGDTMLWVLPNPSGLNRATLAALVESYRALYLAL
FT                   TPQERGA"
FT   CDS_pept        complement(478767..480602)
FT                   /codon_start=1
FT                   /gene_family="HOG000270272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411035"
FT                   /locus_tag="ETAF_0407"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sigma factor activity"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /protein_id="ADM40531.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016987"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniParc:UPI0001BD032F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7R9"
FT                   /transl_table=11
FT                   /translation="MEQNPQSQLKLLVTKGKEQGYLTYAEVNDHLPEDIVDSDQIEDII
FT                   QMINDMGIQVMEEAPDADDLMLAENIADEDAAEAAVQVLSSVESEIGRTTDPVRMYMRE
FT                   MGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEASEARLSDLIT
FT                   GFVDPNAEEDMAPTATHVGSELPEEELDDDEDEDEDEDDDSDDDNSIDPELARQKFVEL
FT                   REQYEKTRLAIKAEGRSSGKAQEEIQNLSEIFKQFRLVPKQFDYLVSNMREMMDRVRGQ
FT                   ERLIMKLCVEQSKMPKKNFITLFTGNETSITWFDAALAMGKPWGEKLKDMREDVERSLQ
FT                   KLHQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQF
FT                   LDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETI
FT                   NKLNRISRQMLQEMGREPTPEELAERMMMPEDKIRKVLKIAKEPISMETPIGDDEDSHL
FT                   GDFIEDTTLELPLDSATSESLRSATRDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGK
FT                   QFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   CDS_pept        complement(480838..482586)
FT                   /codon_start=1
FT                   /gene_family="HOG000014483" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411036"
FT                   /locus_tag="ETAF_0408"
FT                   /function="DNA binding"
FT                   /function="DNA primase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /cellular_component="alpha DNA polymerase:primase complex "
FT                   /protein_id="ADM40532.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0005658"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="UniParc:UPI0001BD0330"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S0"
FT                   /transl_table=11
FT                   /translation="MAGRIPRVFINDLLARTDIVELVDARVKLKKQGKNYHACCPFHSE
FT                   KTPSFTVNADKQFYHCFGCGAHGNAIDFLMNYDRLEFVESIEELATMAGLEVPYESGSG
FT                   PSQMERHQRQNLYQLMDSLCGYYQQSLRQPGATQAQQYLTGRGMSQAIMDRFAIGYAPQ
FT                   GWDNALKRFGRDAGGRTALNDAGMLVNNENGRSYDRFRDRIMIPIRDKRGRVIAFGGRV
FT                   LGNGTPKYLNSPETEIFHKGRQLFGLYEALQHAAQPERLLVVEGYMDVIALAQYGVNYA
FT                   VASLGTSTTAEHIQLLFRHTDSVVCCYDGDNAGREAAWRALETALPYLSDGRQLKFMFL
FT                   PEGEDPDTLIRQEGAEAFERRMNDAHPLSAFLFDSLLPQVDLSTPDGRAKLSALALPLI
FT                   GQVPGETLRLYLRQSLGQKLGILDDSQLEKLLPRRSEAVKNYQPPRLKPTTMRILIALL
FT                   VQNPALAAEVPTLDGLRQHPLPGLPLFIELVETCLAQPGLTTGQLLELYRDNKYASQLE
FT                   TLATWNHMIIEPMVLETFVDTLGSLYDAVLEQRLEQLIARARTDGLTPAEREEVRSLNE
FT                   ALAKKN"
FT   CDS_pept        complement(482774..482989)
FT                   /codon_start=1
FT                   /gene_family="HOG000157460" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411037"
FT                   /gene_name="rpsU"
FT                   /locus_tag="ETAF_0409"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40533.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="UniParc:UPI0001A59EC2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S1"
FT                   /transl_table=11
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGILAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
FT   CDS_pept        483203..484228
FT                   /codon_start=1
FT                   /gene_family="HOG000109568" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411038"
FT                   /gene_name="gcp"
FT                   /locus_tag="ETAF_0410"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40534.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniParc:UPI0001BD0331"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S2"
FT                   /transl_table=11
FT                   /translation="MRILGIETSCDETGIAIYDDEKGILANQLYSQIKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQAALREADLTPADLDGVAYTAGPGLVGALLVGATVGRSLAFAWGV
FT                   PAVPVHHMEGHLLAPMLEENPPAFPFVALLVSGGHTQLISVTGIGEYRLLGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGPVLSKMAQQGVAGRFVFPRPMTDRPGLDLSFSGLKTFAANTI
FT                   HANGDDAQTRADIARAFEDAVVDTLAIKCRRALDQTGFTRLVMAGGVSANRALRARLAQ
FT                   MMQQRGGAVFYARPEFCTDNGAMIAYAGMVRLKSGVDADLSISVRPRWPLAELPPVAAD
FT                   R"
FT   CDS_pept        complement(484250..484912)
FT                   /codon_start=1
FT                   /gene_family="HOG000283806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411039"
FT                   /gene_name="plsY"
FT                   /locus_tag="ETAF_0411"
FT                   /function="acyltransferase activity"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40535.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniParc:UPI0001BD0332"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S3"
FT                   /transl_table=11
FT                   /translation="MSATALGMIIFAYLCGSISSAILVCKAAGLPDPRENGSGNPGATN
FT                   VLRIGGRLAAAAVLIFDVLKGMIPVWLAYKLEVSPFYLGLTAIAACLGHIYPVFFRFRG
FT                   GKGVATAFGAIAPIGWDLTGLMVGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFT
FT                   FPVAMLSCLILVRHHDNIQRLWRGKEGKIWKKKGAKGAQDSERQATPPRDDEPPTPR"
FT   CDS_pept        485091..485456
FT                   /codon_start=1
FT                   /gene_family="HOG000217627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411040"
FT                   /locus_tag="ETAF_0412"
FT                   /function="dihydroneopterin aldolase activity"
FT                   /biological_process="folic acid-containing compound
FT                   metabolic process"
FT                   /protein_id="ADM40536.1"
FT                   /db_xref="GO:0004150"
FT                   /db_xref="GO:0006760"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniParc:UPI0001BD0333"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S4"
FT                   /transl_table=11
FT                   /translation="MDIVFIEGLTVVTTIGVFEWEQTIRQRLVFDVELGWDNRRAAQSD
FT                   DVAHCLSYAEVSEAILQHVEPNRFALVERVAEEVAALLMARFNTPWVRLRVSKPGAVAQ
FT                   AHSVGVVIERGCRTADV"
FT   CDS_pept        485505..486323
FT                   /codon_start=1
FT                   /gene_family="HOG000218356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411041"
FT                   /gene_name="uppP"
FT                   /locus_tag="ETAF_0413"
FT                   /function="undecaprenyl-diphosphatase activity "
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="dephosphorylation"
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /biological_process="regulation of cell shape"
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40537.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0008360"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016311"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="GO:0050380"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniParc:UPI0001BD0334"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S5"
FT                   /transl_table=11
FT                   /translation="MDLHTLLNAFILGVVEGLTEFLPVSSTGHMIIVGHWLGFEGDKAK
FT                   TFEVIIQLGSILAVVVMFWRRLFGLIGIHFGRPVAREGCGQGQLKLGHIVLAMIPAVVL
FT                   GLLFHDFIKSLFTPLTVAYALVVGGLLLLAAEWLKPTQARAVGLDDITYRQAFMIGCFQ
FT                   CLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGASALELYKSLPYLSLGD
FT                   LPMFSVGFVTAFVVALIAIKTFLNVIKRISFVPFAIYRFIVAAAVYLVFC"
FT   CDS_pept        complement(486358..487602)
FT                   /codon_start=1
FT                   /gene_family="HOG000007368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411042"
FT                   /gene_name="cca"
FT                   /locus_tag="ETAF_0414"
FT                   /function="ATP binding"
FT                   /function="cyclic-nucleotide phosphodiesterase activity "
FT                   /function="magnesium ion binding"
FT                   /function="phosphatase activity"
FT                   /function="tRNA adenylyltransferase activity"
FT                   /function="tRNA binding"
FT                   /function="tRNA cytidylyltransferase activity"
FT                   /biological_process="RNA repair"
FT                   /biological_process="tRNA 3'-terminal CCA addition "
FT                   /protein_id="ADM40538.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0001680"
FT                   /db_xref="GO:0004112"
FT                   /db_xref="GO:0004810"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016437"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="GO:0042245"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="UniParc:UPI0001BD0335"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S6"
FT                   /transl_table=11
FT                   /translation="MKTYLVGGAVRDKYLQLPTQDRDWVVVGATPQALLAQGYQQVGKD
FT                   FPVFLHPRSKEEYALARTERKAGQGYTGFSTYFAPDVTLEQDLLRRDLTINAMAEDDEG
FT                   QLIDPYGGLQDLRQRQLRHVSEAFVEDPLRVLRVARFAARFAPLGFQVAAPTLALMQRM
FT                   SQRGELAHLTPERVWLETEKALSGPAPQVYFQVLRDCGALAVLFPEIDRLFGVPAPAQW
FT                   HPEIDTGIHTLLTLAMASHLSDDVAVRFAALTHDVGKGLTNPNFWPHHHGHGPAGVRLV
FT                   REMCQRLRTPNPVRDLALLVAEYHDLIHTVERLRPATLLKLLDTIDVWRRPQRLQHMIL
FT                   CSEADARGRTGLEEQPYPQADYLRAAYHQVAQVAVREVIADGFQGAAIREELQTRRLQV
FT                   LKRWKAAQEAALNAE"
FT   CDS_pept        complement(487724..488341)
FT                   /codon_start=1
FT                   /gene_family="HOG000272218" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411043"
FT                   /locus_tag="ETAF_0415"
FT                   /function="arylsulfatase activity"
FT                   /protein_id="ADM40539.1"
FT                   /db_xref="GO:0004065"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniParc:UPI0001BD0336"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S7"
FT                   /transl_table=11
FT                   /translation="MHLFRRLLLPLLSLCLAFQSHAEEQRFISDALSTYVHSGPGNQYR
FT                   IVGTINAGDPVTLLGINQQSQFAQIRDAKGRSVWLPLDQLSNQPSLRTRVPALEAQLSA
FT                   LTAKLSHIDGEWQQKTAEMQSKVAGSDDAIARLQAENQQLRQQLSSAQKSLGALNSQLD
FT                   DKKRAIILQWFLYGGGVAGAGLLLGLLLPRLLPRRQKARWMN"
FT   CDS_pept        complement(488551..489816)
FT                   /codon_start=1
FT                   /gene_family="HOG000231892" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411044"
FT                   /locus_tag="ETAF_0416"
FT                   /function="inorganic phosphate transmembrane transporter
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40540.1"
FT                   /db_xref="GO:0005315"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniParc:UPI0001BD0337"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S8"
FT                   /transl_table=11
FT                   /translation="MEIIANHGSLLIIVAAFFGLLMAIGIGANDVANAMGTSVGARAVT
FT                   IRQAIVIAMIFEFAGAYLAGGEVTQTIRSGIIDTSAFAGHPQTLVFGMMASLLAAGIWL
FT                   IVASLMGWPVSTTHSIIGAIIGFACVSVGPEAVEWGGVKGIVGSWIITPLISGVVAYGI
FT                   FLSAQRLIFNTENPFANARRFGPVYMFLTALVISLVTIKKGLKHVGLHLTDGETWLVSL
FT                   LVSLLVMLGGYLYLSRKSFTDDADEQDHFRGVERVFSLLMVITACAMAFAHGSNDVANA
FT                   IGPLSAIVAIVRDPSVLAGTSPIVWWILPLGGIGIVVGLALMGRRVMETVGTGITDLTP
FT                   SRGFAAQFATASTVVIASGTGLPISTTQTLVGAVLGVGFARGIAALNLNVVRNIVASWI
FT                   VTLPAGAALSIALFYLLQAVFG"
FT   CDS_pept        complement(489839..490447)
FT                   /codon_start=1
FT                   /gene_family="HOG000283539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411045"
FT                   /locus_tag="ETAF_0417"
FT                   /protein_id="ADM40541.1"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="UniParc:UPI0001E354C3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7S9"
FT                   /transl_table=11
FT                   /translation="MHECCSLLVPFFAATAQQQWDQAQEIREQISNLEKQADTLKREIR
FT                   LKLPRGLFLPVDRGDMLELVTQQDRLANRAKDIAGRVIGRRLQIPAVMQADFVSYLQRC
FT                   LDATALSSKVIHEMDELLETGFRGREADLVEQMVMELDHIEDDTDHQQILLRQTLLSLE
FT                   HQLNPVDIMFLYQIIEWVGGLADKALRVGSRLELMLARS"
FT   CDS_pept        complement(490562..490822)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411046"
FT                   /locus_tag="ETAF_0418"
FT                   /protein_id="ADM40542.1"
FT                   /db_xref="UniParc:UPI0001BD0339"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T0"
FT                   /transl_table=11
FT                   /translation="MATQSLARRLIIDIAQCLGGRMLKRPTGQARGQCVYSGREGDEFQ
FT                   FNFHGHFFCHIKVLPRCSALLGKKCKNGVQCRAHQLPCAPF"
FT   CDS_pept        490811..491974
FT                   /codon_start=1
FT                   /gene_family="HOG000283528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411047"
FT                   /locus_tag="ETAF_0419"
FT                   /function="adenylate cyclase activity"
FT                   /function="polynucleotide 5'-phosphatase activity "
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="mRNA cap methyltransferase complex "
FT                   /protein_id="ADM40543.1"
FT                   /db_xref="GO:0004016"
FT                   /db_xref="GO:0004651"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="GO:0031533"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="InterPro:IPR008172"
FT                   /db_xref="UniParc:UPI0001BD033A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T1"
FT                   /transl_table=11
FT                   /translation="MRRHDMGLRIRGCDGAYEMTLKTAGSDVGGLHQRPEYNVALDAPQ
FT                   LDLRRFPAQAWPEGCDVDALQTALQPLFSTDFQRERWEVTYRESQIEVALDRGDIRAAG
FT                   ESEGLHEIELELLRGERDDLFAFAEQLLTLEGIRMGAMSKAARGYRLAAGNAALRRRAF
FT                   PLLRPAARASVEQGMSAALAQILAHWQYHEEAWLRGDAASRGGIQEALTALRQSLTLFG
FT                   GIVPRKASATLRAGLSALEEQIQQPTCVAQTLCYGRESLTTQWALTRWLAESGWRAYLD
FT                   AAGSAKLSGSFKRFADIMLGRCGAELKALFAQVRHPQEYQDKLPRLQHQILAIRLLGGA
FT                   YGEAAVEDYLAPWQTLAQAIVHPAAVTAEAACAQALHQPAFWRNGAH"
FT   CDS_pept        492054..494891
FT                   /codon_start=1
FT                   /gene_family="HOG000256491" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411048"
FT                   /gene_name="glnE"
FT                   /locus_tag="ETAF_0420"
FT                   /function="ATP binding"
FT                   /function="[glutamate-ammonia-ligase] adenylyltransferase
FT                   activity"
FT                   /function="ligase activity"
FT                   /protein_id="ADM40544.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008882"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniParc:UPI0001BD033B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T2"
FT                   /transl_table=11
FT                   /translation="MSETRALPALLHSQGARQAARLRDATSAALPALALSDFVADSLAA
FT                   YPAWWQQLQQLPPQVQEWQQYAGWLAERLAQVQDESTLMQALRLFRRHMLTRIAWMQAR
FT                   AQADCQQTLLQLSALAETLVIGARDWLYHRACQEWGVPCNAAGEAQPLLILGMGKLGGG
FT                   ELNFSSDIDLIFVYPQSGATRGGRRELDNAQFFTRLGQRLIKALDQPTEDGFVYRVDMR
FT                   LRPFGDSGPLVLSFSALEDYYQEQGRDWERYAMVKARLLGEGQDRYGQELYRLLRPFVF
FT                   RRYIDFSVIQSLRNMKGMIAREVRRRGLKENIKLGAGGIREIEFITQVFQLIRGGRERS
FT                   LQQRALLPALAAIGELGLLTAAQVAALRDAYLFLRRLENLLQAIDDQQTQTLPSDDLNR
FT                   ARLAYGMGLADWAALSRALQEHMAAVRAIFNALIGDDDQDEEERGDDAALRFAPLWQER
FT                   LDESELAALMPQLDPAQRLRLQQTLEAFHRDVDKRTIGPRGREVLATLMPTLLAQVCVR
FT                   DDALVLQQRLMPLLLNIVTRTTYLELLMEFPAALHQLIRLCAASPMLAEQLARYPLLLD
FT                   ELLDPVTLYRPVDQGAYRDELRQYLLRIPDDEEQRLEALRQFKHAQQLRIAASDIAGAL
FT                   PVMKVSDHLTYLAEAVIEAVVQQAWEQMVARYGQPTHLVDHGQRGFAVIGYGKLGGWEL
FT                   GYGSDLDLVFLLDCPAEVMTDGPRCIDGRQFYLRLAQRIMHLFSARTASGILYEVDARL
FT                   RPSGAAGMLVSTLTAFGDYQRSEAWTWEHQALVRARPVYGDVQMHRQFDAIRREILCRE
FT                   RDAATLRCEVAEMREKMRTHQGSRDAAQFDIKADRGGIVDIEFIAQYLVLRYGAEQPDL
FT                   TRWSDNVRIFELMAQYAVMPQAEADALTHAYVTLRNTLHHLALQAQPGVVESTRFADAR
FT                   ARVCESWQRWLGTAR"
FT   CDS_pept        complement(494902..495831)
FT                   /codon_start=1
FT                   /gene_family="HOG000265960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411049"
FT                   /locus_tag="ETAF_0421"
FT                   /function="acyltransferase activity"
FT                   /biological_process="lipopolysaccharide core region
FT                   biosynthetic process"
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40545.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0009244"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniParc:UPI0001BD033C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T3"
FT                   /transl_table=11
FT                   /translation="MSDNHVYPQFQRSMLHPRYWLTWLGIGIFYLVMLLPYPWLYRLGK
FT                   MLGKTAMRFMKKRVEVTRRNLALCFPQMPAAQREAWVRQNFESVGMALVETGMAWFWPD
FT                   WRIRRWCRVEGEENLRQAKQTGKGILLIGMHFLTLELGARIFGMHNPGVGVYRPNDNPV
FT                   LDWLQTWGRLRSNKYMLDRRDVKGMIRALKEGEIVWYAPDHDYGPRSSVFVPLFAVAQA
FT                   ATTTGTYILARMGQPTLLPFIPLRNADGSGYTLRIQPMLQDVPLDDQTTTAAYMNRVVE
FT                   REIMLAPTQYMWLHRRFKTCPPGVASRY"
FT   CDS_pept        495938..497371
FT                   /codon_start=1
FT                   /gene_family="HOG000237584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411050"
FT                   /gene_name="hldE"
FT                   /locus_tag="ETAF_0422"
FT                   /function="ATP binding"
FT                   /function="carbohydrate kinase activity"
FT                   /function="nucleotidyltransferase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ADM40546.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="GO:0019200"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="UniParc:UPI0001BD033D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T4"
FT                   /transl_table=11
FT                   /translation="MKVTLPDFRRAQVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVET
FT                   IEERPGGAANVAMNIASLGANARLVGLTGVDDAARALSARLDEVHVECDFVAIPTQPTI
FT                   TKLRVLSRNQQLIRLDFEEGFGGVDPEPILARIRQALPQLGAMILSDYAKGALASVQAM
FT                   IRLARDAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGRCHSEQEIVDRGLALMDR
FT                   FDLTALLVTRSEQGMTLLQRGIAPLHMPTQAQEVYDVTGAGDTVIGMLATSIAAGTSLE
FT                   EACFLANAAAGVVVGKLGTSTVSPIELENAIRGRADTGFGVMTQEELKTAVLQARQRGE
FT                   KVVMTNGVFDILHAGHVSYLANARRLGDRLIVAVNSDASTRRLKGPERPVNPLTQRMLV
FT                   LAALESVDWVIPFEEDTPQRIIAEILPDLLVKGGDYRPEEIAGGKEVIAAGGDVRVLNF
FT                   EDGCSTTNIINTIRQGQND"
FT   CDS_pept        497433..498650
FT                   /codon_start=1
FT                   /gene_family="HOG000273866" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411051"
FT                   /locus_tag="ETAF_0423"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40547.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001BD033E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T5"
FT                   /transl_table=11
FT                   /translation="MQGVGMLSTSLLGTGVFAVPALAAQVAGDDSLWAWPLLIVLVFPI
FT                   AIGFAALGRHFPSAGGAAHFVGKAFGPHMARVTGWLFLSVIPVGLPASLQIAAGFWQAL
FT                   FGWQGAPLLAVELITLLAVWLLGTRGAGSSANLQTLIALLVVLLIAAVWWRGGISPTQI
FT                   PWPVPSQLSLSPLTGALAVMFWCFVGLEAFAHLASEFRHPQRDFPRALLLGLLLAGAVY
FT                   WACSVAVLHFHAFGDGRAAAASLPGIVVQLFGRHALWIACVIGYLACFASLNVYIQSFA
FT                   RLVWSQAQRRPQSRLAQLSARQAPVNALTSVMLCCLLCSLLIYLSGLSLDALIVYANGV
FT                   FIMIYLLCMLAGCRLLRGHARLMALTGSVLCLLLLAMVGVKSLYALGMLLVLYLLLPRR
FT                   AASHGG"
FT   CDS_pept        complement(498671..498937)
FT                   /codon_start=1
FT                   /gene_family="HOG000265044" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411052"
FT                   /gene_name="yqiC"
FT                   /locus_tag="ETAF_0424"
FT                   /protein_id="ADM40548.1"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniParc:UPI0001BD0386"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T6"
FT                   /transl_table=11
FT                   /translation="MIDPKKIEQIARQVHQSMPKGLREFGDDMEKRVRQILQQQLSRLD
FT                   LVNREDFEIQTQVLLRTREKLALLEQRVAALEARLNDAEDGQA"
FT   CDS_pept        499294..500082
FT                   /codon_start=1
FT                   /gene_family="HOG000115444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411053"
FT                   /locus_tag="ETAF_0425"
FT                   /function="3,4-dihydroxy-2-butanone-4-phosphate synthase
FT                   activity"
FT                   /function="magnesium ion binding"
FT                   /function="manganese ion binding"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="ADM40549.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0008686"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniParc:UPI0001BD0387"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T7"
FT                   /transl_table=11
FT                   /translation="MGESNDICRDSPARVILAAPLRVPLLKFALVLVIHTIIDEVFTMN
FT                   QILLSDFGTPMERVERALSALRDGRGVMVLDDENRENEGDMIFAAEKMTVEQMALTIRH
FT                   GSGIVCLCITEARRQQLDLPMMVSNNTSHYGTAFTVTIEAAEGVTTGVSAQDRLTTVRA
FT                   AIADGAKPSDLHRPGHVFPLRARPGGVLARRGHTEATIDLVSLAGFRPAGVLCELTNDD
FT                   GTMARAPQVMAFARQHGMPVVTIEDLVAYRQAHEPQEQAC"
FT   CDS_pept        complement(500149..500916)
FT                   /codon_start=1
FT                   /gene_family="HOG000232704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411054"
FT                   /gene_name="zupT"
FT                   /locus_tag="ETAF_0426"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40550.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI0001BD0388"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T8"
FT                   /transl_table=11
FT                   /translation="MSIPLLLTLLAGGATAVGALLAIIGQRPSNRVLAFSLGFAAGIML
FT                   LISLMEMLPAALNTPKMPPLLGYAMFILGLVGYFLLDRLLPHQHAHDMVPLGNRTPRSL
FT                   KRTALLLTLGISLHNFPEGIATYVTASADLELGMGIALAVAIHNIPEGLAVAGPVYAAS
FT                   GSRLRALWWASLSGVAEILGGLLAFTLLGPTVSPVGMAAIMALVAGIMVALSVDELMPL
FT                   AREIDPHSNPSRGVLCGMTVMGLSLALLQATPL"
FT   CDS_pept        501134..501919
FT                   /codon_start=1
FT                   /gene_family="HOG000236850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411055"
FT                   /locus_tag="ETAF_0427"
FT                   /function="ferrous iron binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen"
FT                   /function="zinc ion binding"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40551.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008198"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016701"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniParc:UPI0001BD0389"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7T9"
FT                   /transl_table=11
FT                   /translation="MSEATMPALFLAHGSPMNAIEDNPFSALWQRLGRELPRPKAIVVI
FT                   SAHWCTQGLWATAMAQPRTLHDFGGFPPALSALRYPAPGSPALARELQSLLAPQYTLSL
FT                   DEGGWGLDHGAWSLLVHLYPQADIPVIQLSLDPRQPAAYHYQLGQALAPLRQRGVLMLG
FT                   SGNVVHNLRTLRWEAEAEPYPWARRFEDVVRQGLRERGEDAALLRFADNPDATLANPTP
FT                   EHFLPLLPVLGCWDGAEPLRVFEQGIVMGSLSMLSLQVG"
FT   tRNA            complement(502097..502183)
FT                   /gene_name="tRNA-Leu"
FT   tRNA            complement(502217..502303)
FT                   /gene_name="tRNA-Leu"
FT   tRNA            complement(502339..502425)
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        complement(502602..503738)
FT                   /codon_start=1
FT                   /gene_family="HOG000218308" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411056"
FT                   /locus_tag="ETAF_0428"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (guanine-N2-)-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40552.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008990"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="UniParc:UPI0001BD038A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7U0"
FT                   /transl_table=11
FT                   /translation="MQRIATAAMNGAFQNAGESSIITGQPIEEFCAMSAFTPASEVVLR
FT                   HGEEFEPRRVLFAGDLQDTLPAQFNAVEVRAHTTQYHHWQALHPAMGERCLFSLTITAE
FT                   FAAGIDTLIYFWPKSKPEALFQLTQLLSQLPVGCDVFIVGENRAGVRSAEELASDMLTL
FT                   NKIDSARRCGLYHGQLAQPPRFDLNDWWMSYDTGSLRIATLPGVFSRDGLDIGSHLLLS
FT                   SLPHGLKGNVLDVGCGAGVLSAAIARMSPETRLTLSDVNAAALTASRQTLAQNAIDGEV
FT                   LASNVFSDISGRFDLIISNPPFHDGVQTSLLAAQTLIRGAVSHLQLGGELRIVANAFLP
FT                   YPQVLDAVFGRHEVVAQTGKFKVYSAILDRAALEHSRR"
FT   CDS_pept        503838..504248
FT                   /codon_start=1
FT                   /gene_family="HOG000218328" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411057"
FT                   /locus_tag="ETAF_0429"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /protein_id="ADM40553.1"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="UniParc:UPI0001BD038B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7U1"
FT                   /transl_table=11
FT                   /translation="MTSRRDQLLQQLGITQWVLRRPALLRGEVAITLSAQTRLLIVSEA
FT                   PLSPDDLLLCDILRALSLTAEQAVILTPEQYEMLSDRQRYLCWWLGESASSEACLRSPA
FT                   LGALYHNPGAKRALWQQICHEQHHFFPDPGGH"
FT   CDS_pept        504208..504654
FT                   /codon_start=1
FT                   /gene_family="HOG000078523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411058"
FT                   /locus_tag="ETAF_0430"
FT                   /function="N-acetyltransferase activity"
FT                   /biological_process="N-terminal protein amino acid
FT                   acetylation"
FT                   /protein_id="ADM40554.1"
FT                   /db_xref="GO:0006474"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001BD038C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7U2"
FT                   /transl_table=11
FT                   /translation="MSNIISSLTPADTDAAYAVECASHAFPWTHSTFLSNQGERYYNLK
FT                   LESQGQLAAFAITQVVLDEATLFNVAVAPAYQRQGLGRTLLLRLIDDLTERGVVTLWLE
FT                   VRDSNRAAIALYHALGFNEVSLRRNYYPTADGREDARIMALPLG"
FT   CDS_pept        504850..506439
FT                   /codon_start=1
FT                   /gene_family="HOG000236725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411059"
FT                   /gene_name="prfC"
FT                   /locus_tag="ETAF_0431"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /biological_process="regulation of translational
FT                   termination"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40555.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006449"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="UniParc:UPI0001BD038E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T7U3"
FT                   /transl_table=11
FT                   /translation="MSPSEYAREVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQVAGT
FT                   VKGRGSSQHAKSDWMEMEKQRGISITTSVMQFPYHDSLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVESELR
FT                   IACAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRVIKGLDNPQLDAAVGED
FT                   LAVQLREELELVQGASTEFEEEAFLNGQLTPVFFGTALGNFGVDHMLDGLVAWAPAPMP
FT                   RMTDVRKVSADEEKFSGFVFKIQANMDPKHRDRVAFMRVVSGRYDKGMKLRQVRTGKDV
FT                   VIADALTFMAGDRAHVEEAYPGDIIGLHNHGTIQIGDTFTQGEEMKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPVANNDLIVGAVGVLQFDVVVARLKSEYN
FT                   VEAIYESVNVSTARWVECDDAKKFDEFQRKNELHLALDGGDNLAYIAPTMVNLNLTQER
FT                   YPEVRFRKTREH"
FT   CDS_pept        506664..507665
FT                   /codon_start=1
FT                   /gene_family="HOG000279055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411060"
FT                   /locus_tag="ETAF_0432"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ADM40556.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI0001BD038F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T897"
FT                   /transl_table=11
FT                   /translation="MGYRIPITLGNIEPLAYKPYHPGRIALVCEGGGQRGIFTAGVLDE
FT                   FLRARFNPFDLYLGTSAGAQNLSSFVCGQAGYARRVITRYTTRSEFFNPLRFVRGGHLI
FT                   DLDWLVDCTHREMPLAFDRAERMLGQQRQFYMVASRSDDFSAAYFPAQRDSWLQVIKAS
FT                   SAIPGFYRSGVELDGVVYQDGGIADAVPVREAYRLGADTIVVIRTVPSQMFYTPRWVKR
FT                   MESLLSESSLQQMVRMMQRHEKSYRRTQRFIEQPPGRLRIFEIYPPKPLASHALGSTVA
FT                   SLNTDYHLGRRCARYFLAAVGHWLLPRDLPAHAHGPARLTHQAARQPAGETL"
FT   CDS_pept        507662..508453
FT                   /codon_start=1
FT                   /gene_family="HOG000201521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411061"
FT                   /gene_name="yjjV"
FT                   /locus_tag="ETAF_0433"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="ADM40557.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012278"
FT                   /db_xref="InterPro:IPR015992"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniParc:UPI0001BD0390"
FT                   /db_xref="UniProtKB/TrEMBL:E0T898"
FT                   /transl_table=11
FT                   /translation="MIAAALIDTHCHFDFAPFCGDEAASLHRARAAGIGDIIVPSIEAS
FT                   RFASVLALAHRYPMLHAALGLHPLYIEHHRDTDIAALDTLLAQADPAVVALGEIGLDHY
FT                   GDVRQPARQLSLLQDQLALAQRYDLPVILHSRRSHDLLAKILRQRRLMRTGVVHGFSGS
FT                   LAQAQAFVRLGYAIGVGGTITYARANKTRAAVAALPLEALLLETDAPDMPLFGYQGAPN
FT                   RPEQLTRVFAALCALRSETPAQIAQALYDNTHRLFHFPPRS"
FT   CDS_pept        508697..509974
FT                   /codon_start=1
FT                   /gene_family="HOG000267656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411062"
FT                   /locus_tag="ETAF_0434"
FT                   /function="nucleoside binding"
FT                   /function="nucleoside:sodium symporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40558.1"
FT                   /db_xref="GO:0001882"
FT                   /db_xref="GO:0005415"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniParc:UPI0001E354C4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T899"
FT                   /transl_table=11
FT                   /translation="MQLLMGVVGMVTLILLGVLLSNNRRAIRVRTVAGAFAVQVCLGAF
FT                   VLYVPAGRDMLGAMSTGVANVIAYGNQGISFMFGGLVSDKMFELFGGGGFVFALRVLPV
FT                   IVFFSSLIAVLYYLGIMQLVIRVLGGALHKLLGTSRTESLSATANIFVGQTEAPLVVRP
FT                   YIATMTQSELFAVMCGGLASVAGSVLAGYAQMGVPLEYLIAASFMAAPGGLLFAKLIVP
FT                   ETEQTHDREDATALVAAEDRPANVIDAAASGAASGLQLALNVGAMLLAFIALIALLNGM
FT                   LGGIGGWFNYPQLSMELILGWVFSPLAFLIGVPWNEAQIAGSFIGQKLIVNEFVAYMNF
FT                   GEYLKADAEVAAAGLQVLSGHTKAIISFALCGFANLSSVAILLGGLGSMAPKRRHEIAR
FT                   FGLRAVAAGTLSNLMSATIAGFFLAL"
FT   CDS_pept        complement(510035..510898)
FT                   /codon_start=1
FT                   /gene_family="HOG000011457" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411063"
FT                   /locus_tag="ETAF_0435"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="electron carrier activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="oxygen and reactive oxygen species
FT                   metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40559.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0006800"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI0001BD0392"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A0"
FT                   /transl_table=11
FT                   /translation="MNNRRALVSKLLPFSCVDGPGSRLVLFLQGCNLRCRSCHNPYTIG
FT                   RCDECAQCVATCPHQALSLQAGKVLWDALACQQCDTCLQGCPRQASPMALSLSVDDVLM
FT                   QLRRQAAFIKGITVSGGEATLQLPFLLALFQAIRRDPGLQALDCLVDSNGELSEPGWTR
FT                   LIPWCDGVMVDLKAWDDERHRWLTGRGNRRILHSIRWLAQRRRLAELRLLVIPQHSDYL
FT                   THIDALAEFILSLGDVPVRLNAFHHHGVYGPASAWQPAAKDDVERLAQALETRGVGAVI
FT                   RPALYL"
FT   CDS_pept        complement(510870..512420)
FT                   /codon_start=1
FT                   /gene_family="HOG000271695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411064"
FT                   /locus_tag="ETAF_0436"
FT                   /protein_id="ADM40560.1"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniParc:UPI0001BD0393"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A1"
FT                   /transl_table=11
FT                   /translation="MPETSANALHSRCMAIACDPHLSALQKRHFLALEAENDLPYPALP
FT                   EAARQALDEGVICDMFEGHAPYKPRYVLPDYARFLANGSEWLELEPAQDFDDALSMLTI
FT                   LYHHVPSVTSMPVFLGHLDQLLLPYVGILTENELYIRIKRFWRYLDRTFPDAFMHANLG
FT                   PSDNILTRLFLRADAELAQVVPNLTFLYHPEITPAERLQQAIENICACSKPHIANAPLH
FT                   DNIFTAGGYGIVSCYNALPLGGGGSTLVRMNLKEVALRSRGEEDFFTRTLPDYCQRQTE
FT                   ILRARSDFLFTRSHFFSQSFLVHEGLIDAQRFVPMFGIFALAEAVDILCQQSGVAARYG
FT                   QDEAANALGYRISAWLDAFVRATPLPHAWQQRALLHAQSGISSDRGTTPGARLPYGSEP
FT                   DPIGHLMAVAPHHAYYPAGISDILTLDPTVKSNPQALMQLCLGAFSAGMREFTANVSGN
FT                   DLVRVTGYMVRLSDLARYEQEGSRLNTTWLAEEAARNTGMLERQARVISHEQQTRFSQ"
FT   CDS_pept        512798..513673
FT                   /codon_start=1
FT                   /gene_family="HOG000241644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411065"
FT                   /locus_tag="ETAF_0437"
FT                   /function="deoxyribose-phosphate aldolase activity "
FT                   /biological_process="deoxyribonucleotide catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40561.1"
FT                   /db_xref="GO:0004139"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009264"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001BD0395"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A2"
FT                   /transl_table=11
FT                   /translation="MWDRFTAQAVKTFVPFFLIEPAWAAFSQLESIMTELQTAAQRALR
FT                   LMDLTTLNDNDTDEKVIALCHQAKSPAGNTAAVCIYPRFIPIARKTLREQGTPDVRIAT
FT                   VTNFPHGNDDIEIALVETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKETCAA
FT                   ANVLLKVIIETGELKDAALIRKASEISIKAGADFIKTSTGKVPVNATLESAEIMMSVIR
FT                   DMGVAKSVGFKPAGGVRTAEDAAQYLALADRLLGEGWADSRHFRFGASSLLASLLQTLG
FT                   YDAKGTGSSY"
FT   CDS_pept        513782..515104
FT                   /codon_start=1
FT                   /gene_family="HOG000047313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411066"
FT                   /gene_name="deoA"
FT                   /locus_tag="ETAF_0438"
FT                   /function="thymidine phosphorylase activity"
FT                   /biological_process="pyrimidine base metabolic process "
FT                   /biological_process="thymidine metabolic process "
FT                   /protein_id="ADM40562.1"
FT                   /db_xref="GO:0006206"
FT                   /db_xref="GO:0009032"
FT                   /db_xref="GO:0046104"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR020072"
FT                   /db_xref="UniParc:UPI0001BD0396"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A3"
FT                   /transl_table=11
FT                   /translation="MFLAQEIIRKKRDGHALSEEEIRFFINGIRDNTISEGQIAALAMT
FT                   IFFHDMAMPERVALTMAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAA
FT                   CGGYVPMISGRGLGHTGGTLDKLESIPGFDIFPDDSRFRSIIADVGVAIIGQTSSLAPA
FT                   DKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTFALSEALAQ
FT                   AIVGVANGAGCRTTALLTDMNQVLASSAGNALEVREAVQFLTGEARNPRLFEVTMALCV
FT                   EMLISGKLAADQTEARNKLQAVLDNGKAAEIFGRMVAAQSGPCDFVERYDHYLPQAVLC
FT                   KPVFAEQAGIITAMDTRALGMSVVGLGGGRRQASDSIDYSVGLTEMVRLGDSVDGQRPL
FT                   AVVHARDEASWQQAAEAVRAAVTLGERAPEPTPVVYRRITQ"
FT   CDS_pept        515205..516428
FT                   /codon_start=1
FT                   /gene_family="HOG000008159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411067"
FT                   /gene_name="deoB"
FT                   /locus_tag="ETAF_0439"
FT                   /function="magnesium ion binding"
FT                   /function="manganese ion binding"
FT                   /function="phosphopentomutase activity"
FT                   /biological_process="cellular metabolic compound salvage "
FT                   /biological_process="deoxyribonucleotide catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40563.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008973"
FT                   /db_xref="GO:0009264"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="GO:0043094"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001BD0397"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A4"
FT                   /transl_table=11
FT                   /translation="MKRAFIMVLDSFGIGEAKDAKSFGDEGADTLGHIARACARGEADI
FT                   GRQGPLHLPNLCRLGLGKAALASTGRFPEGLDENAEIIGAYGYANELSSGKDTPSGHWE
FT                   IAGVPVLFDWGYFHEHQNSFPQALLDTLVERANLPGYLGNCHSSGTVILDQLGEEHMKS
FT                   GKPIFYTSADSVFQIACHEETFGLERLYELCEIARDELNKGGYNIGRVIARPFVGDKAG
FT                   HFQRTGNRHDLAVEPPAPTMLKKLVDEKQGEVVSIGKIADIYANVGITKKVKATGIDAL
FT                   FDATLQEMRQAGNDTIVFTNFVDFDSSYGHRRDVAGYAAALELFDRRLPEMLALVKEDD
FT                   ILILTADHGCDPTWHGSDHTREHIPVLVYGPKVKPGSLGERDTFADIGQTVAHYFGLSP
FT                   MAYGKPMF"
FT   CDS_pept        516495..517220
FT                   /codon_start=1
FT                   /gene_family="HOG000274896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411068"
FT                   /gene_name="deoD"
FT                   /locus_tag="ETAF_0440"
FT                   /function="purine-nucleoside phosphorylase activity "
FT                   /biological_process="purine nucleoside metabolic process "
FT                   /protein_id="ADM40564.1"
FT                   /db_xref="GO:0004731"
FT                   /db_xref="GO:0042278"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniParc:UPI0001BD0398"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A5"
FT                   /transl_table=11
FT                   /translation="MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLQDVRQVNNVRG
FT                   MLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRMDVKLRDV
FT                   VIGMGACTDSKVNRLRFKDNDFAAIADFDMVRNAADAAKAKGIDVRVGNLFSADLFYSP
FT                   DPTMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTF
FT                   NDMIEIALESVLLGDQEQA"
FT   CDS_pept        517393..517779
FT                   /codon_start=1
FT                   /gene_family="HOG000127440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411069"
FT                   /locus_tag="ETAF_0441"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /biological_process="electron transport chain"
FT                   /cellular_component="periplasmic space"
FT                   /protein_id="ADM40565.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0042597"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniParc:UPI0001BD0399"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A6"
FT                   /transl_table=11
FT                   /translation="MRKSVLALAGLAMMAGSALAQAASVSEDMDVINQSYRQAQQATTA
FT                   QDFKQALTAMRAAATAAKSEAPSKLQGQASDSADMKDYRHGLDLLIGQIDKAEKLADAG
FT                   QLDQAKTEAQQMLQTRNVYHKKYR"
FT   CDS_pept        517804..518295
FT                   /codon_start=1
FT                   /gene_family="HOG000271303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411070"
FT                   /locus_tag="ETAF_0442"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40566.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniParc:UPI0001BD039A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A7"
FT                   /transl_table=11
FT                   /translation="MRLTHWSVALGFLCNRLYLTVPGSTPHQLIGLTVAGLVLLRLLWG
FT                   VTGARGAARLSAFIPTPSALIHHLHELRTRTVPQAPHHNPLGAIGIWATWLLLLLIALT
FT                   GWGQGNDLAFRWPLDVWHVWLVDALTLVVCVHIAAVFAMSFWLRRNLIGAMLPGRRGGE
FT                   "
FT   CDS_pept        complement(518331..518741)
FT                   /codon_start=1
FT                   /gene_family="HOG000208216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411071"
FT                   /locus_tag="ETAF_0443"
FT                   /function="DNA binding"
FT                   /function="kinase activity"
FT                   /function="transcription elongation regulator activity "
FT                   /protein_id="ADM40567.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="UniParc:UPI0001BD039B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A8"
FT                   /transl_table=11
FT                   /translation="MSRPAIIINELDAERLDRLLERPAFAAQPVAQALNEELDRAQLLA
FT                   PAAMPADVVTMNSRVRFRDLNTNEEHVRTLVYPHLQDSAEDGLSVMAPIGAALLGLRVG
FT                   DAIRWTLPNGNQTHIEVLALLYQPEAAGELLR"
FT   CDS_pept        complement(518911..519183)
FT                   /codon_start=1
FT                   /gene_family="HOG000278398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411072"
FT                   /locus_tag="ETAF_0444"
FT                   /function="kinase activity"
FT                   /function="sugar:hydrogen symporter activity"
FT                   /biological_process="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40568.1"
FT                   /db_xref="GO:0005351"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009401"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR005698"
FT                   /db_xref="UniParc:UPI0001A59F54"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8A9"
FT                   /transl_table=11
FT                   /translation="MSVTQTVEIKNRLGMHARPAMKLFELVQTFDADVILRNENGIEAE
FT                   ANSVIALLMLDSAQGGQIEIQATGPDERQALDAVVSLFNAGFDEE"
FT   CDS_pept        complement(519191..520042)
FT                   /codon_start=1
FT                   /gene_family="HOG000244885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411073"
FT                   /locus_tag="ETAF_0445"
FT                   /function="ATP binding"
FT                   /function="GTP binding"
FT                   /protein_id="ADM40569.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="UniParc:UPI0001BD039C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B0"
FT                   /transl_table=11
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVELLPELARTLA
FT                   TRDTSAAVSIDVRNMPESPEVLETAMDHLPESFTPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLENAIDQENELLEPLRSRADLIIDTSEMSVHELAEMLRARLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQT
FT                   RSYLEQWLPALENNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRHRTLEK
FT                   RR"
FT   CDS_pept        complement(520151..520597)
FT                   /codon_start=1
FT                   /gene_family="HOG000227559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411074"
FT                   /gene_name="ptsN"
FT                   /locus_tag="ETAF_0446"
FT                   /function="protein-N(PI)-phosphohistidine-sugar
FT                   phosphotransferase activity"
FT                   /function="sugar:hydrogen symporter activity"
FT                   /biological_process="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system"
FT                   /protein_id="ADM40570.1"
FT                   /db_xref="GO:0005351"
FT                   /db_xref="GO:0008982"
FT                   /db_xref="GO:0009401"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniParc:UPI0001BD039D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B1"
FT                   /transl_table=11
FT                   /translation="MPLSVVLTPECTRNAVHCASKKRVLEIISELAAAQLNLPTQVVFD
FT                   AILTRERMGSTGIGNGIAIPHGKLEEDTLRAIAVFIHLDQPINFDAIDNQPVDLLFALL
FT                   VPADQCKTHLQTLSLMAQKLSDKGVCRRLRAAQSDEDLYQIITE"
FT   CDS_pept        complement(520735..521022)
FT                   /codon_start=1
FT                   /gene_family="HOG000264773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411075"
FT                   /gene_name="yhbH"
FT                   /locus_tag="ETAF_0447"
FT                   /function="binding"
FT                   /biological_process="primary metabolic process "
FT                   /protein_id="ADM40571.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0044238"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniParc:UPI0001BD039E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B2"
FT                   /transl_table=11
FT                   /translation="MQLNITGHHLEITDAIRQFVSEKFAKLEQYFDRINQVNVTLSIEK
FT                   VDHIAEATVFINGGELHASAQQEDMYAAIDILIDKLARQLNKHKDKLKQH"
FT   CDS_pept        complement(521044..522501)
FT                   /codon_start=1
FT                   /gene_family="HOG000071905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411076"
FT                   /locus_tag="ETAF_0448"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sigma factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /protein_id="ADM40572.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016987"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="UniParc:UPI0001BD039F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B3"
FT                   /transl_table=11
FT                   /translation="MQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQQALESNPLLEQ
FT                   LEPNDEADGDSADDERVQDDADARDDDDPLDTRDALEQREMPDELPLDASWDEIYTAGT
FT                   PSGTGTDYHDDELPVFQGETTQTLQDYLMWQVELTPFSETDLAIATAIVDAVDDTGYLT
FT                   ASLEEILESLGDEHALPEEVEAVLKRIQRFDPVGVAARDLRDCLLVQLSQFAPDTPYLN
FT                   EARSIVDRHLDLLGNHDFRNLMRSTKLKEEVLKEAMQLIQSLDPRPGLSINTGESDYVI
FT                   PDVLVHKHQGRWVVELNQDSVPRLHINQRYAALGAQARSDSDSQFIRSNLQEAKWLIKS
FT                   LESRNDTLLKVSRCIVEQQQAFFEHGAESMKPMVLADIAQQVEMHESTISRVTTQKFLH
FT                   SPRGIFELKYFFSSHVNTEDGGEASSTAIRALVKKLIAAENPAKPLSDSKLTTLLADQG
FT                   IMVARRTVAKYRESLSIPPSNQRKQLV"
FT   CDS_pept        complement(522638..523363)
FT                   /codon_start=1
FT                   /gene_id="IGI22411077"
FT                   /gene_name="lptB"
FT                   /locus_tag="ETAF_0449"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ADM40573.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001BD03A0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B4"
FT                   /transl_table=11
FT                   /translation="MARLIAENLAKSYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDAGRIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLE
FT                   IRDDLNAEQRADRADELLEEFHIAHLRDNLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIEHLRDRGLGVLITDHNVRETLDVCERAYIVSQGNLIAYGSPD
FT                   EILADEQVKRVYLGEEFRL"
FT   CDS_pept        complement(523370..523927)
FT                   /codon_start=1
FT                   /gene_family="HOG000264762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411078"
FT                   /gene_name="lptA"
FT                   /locus_tag="ETAF_0450"
FT                   /protein_id="ADM40574.1"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniParc:UPI0001BD03A1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B5"
FT                   /transl_table=11
FT                   /translation="MKFKASTLKLRDLILAGALLSASASALAVTGDTDQPIHINSMQQS
FT                   LDMQGNVATFTGDVIVTQGTIKITADKVVVTRPNGQQGSEIVEAYGNPVTFYQMQDNGK
FT                   PVEGHSQQLRYELAKDYVILTGKAFLKQLDSNIEGDRITYLVKQQQMEAFSDKGKRVTT
FT                   VLLPSQLQDKGNAKPAPQKKSN"
FT   CDS_pept        complement(523902..524453)
FT                   /codon_start=1
FT                   /gene_family="HOG000125239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411079"
FT                   /gene_name="yrbK"
FT                   /locus_tag="ETAF_0451"
FT                   /protein_id="ADM40575.1"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniParc:UPI0001BD03A2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B6"
FT                   /transl_table=11
FT                   /translation="MIILLTLIALALIGWNLADNSPDGAPTTLDPNTPNYQSQHTLTVV
FT                   YDPSGKLSYKLVAQDVQHYSEQGVTWFTRPVLTTFDPQAAATWSVRADKAKLTNDNMLY
FT                   LYGNVEVNSLTPTSQLERITTDNAQVNLVTQDISSDDEVTLYGSNFTSHGLKMRGNMRD
FT                   KTARLIDKVNTYYEIQSKHP"
FT   CDS_pept        complement(524471..525037)
FT                   /codon_start=1
FT                   /gene_family="HOG000264740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411080"
FT                   /locus_tag="ETAF_0452"
FT                   /function="3-deoxy-manno-octulosonate-8-phosphatase
FT                   activity"
FT                   /biological_process="lipopolysaccharide biosynthetic
FT                   process"
FT                   /protein_id="ADM40576.1"
FT                   /db_xref="GO:0009103"
FT                   /db_xref="GO:0019143"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR013200"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001BD03A3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B7"
FT                   /transl_table=11
FT                   /translation="MQQNTSPIATCYGPVSADVMARAAQIRLLICDVDGVLSDGLIYMG
FT                   NQGEELKAFNVRDGYGIRCLVTQGIDVAIITGRSSQLVADRAATLGIRHLYQGQSDKLI
FT                   AFERILADLQLAPHQAAYIGDDLIDWPVMARVGLSVAVADAHPLLLPNAHYTTRIAGGR
FT                   GAVRELCDIILQAQGNLDQAKGLSI"
FT   CDS_pept        complement(525053..526039)
FT                   /codon_start=1
FT                   /gene_family="HOG000264729" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411081"
FT                   /locus_tag="ETAF_0453"
FT                   /function="arabinose-5-phosphate isomerase activity "
FT                   /function="sugar binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ADM40577.1"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0019146"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001BD03A4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B8"
FT                   /transl_table=11
FT                   /translation="MSHMEFQPDFDFQQAGKDVLRIEREGLAQLDHFINQDFSRACEAM
FT                   LRCSGKVVVMGMGKSGHIGRKIAATLASTGTSAFFVHPGEASHGDLGMVEPRDVVLAIS
FT                   NSGESQEIQALIPVLKRQSVTLICMTNNPDSAMGRAADIHLCIRVPQEACPLGLAPTTS
FT                   TTATLVMGDALAVALLQARGFTAEDFALSHPGGALGRKLLLRVSDIMHSGDEVPTVSPT
FT                   ASLRDALLEITRKNLGLTVICGPDAHIDGIFTDGDLRRIFDMGIDLNNAKIADVMTRGG
FT                   IRIRPTALAVDALNLMQDRHITSLLVAENDRLIGVVHMHDMLRAGVV"
FT   CDS_pept        complement(526094..527083)
FT                   /codon_start=1
FT                   /gene_family="HOG000274121" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411082"
FT                   /locus_tag="ETAF_0454"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40578.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI0001BD03A5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8B9"
FT                   /transl_table=11
FT                   /translation="MLLATLLMLIGLLLLVYGADRVVYGAAAVAHALGVAPLVIGMTIV
FT                   SMGTSLPELTVSLTATLHNQIDTAVGNVLGSNITNILLILGCAALIRPLSVRSDILRRE
FT                   LPLTLGATILCGFLLYDNQLNRIDGAILMTFFGAFLWLMLKMAHRVMPGGQDSYAREQI
FT                   AELPRDTGLPVALLWMALGFIILPLASRMVIDNATVLARYLGVSELIIGLTVIAVGTSL
FT                   PELATACAGAIKGEHDIVLGNIIGSNTFNILVVLGIPALIGPRNPLIDGAAFARDYWVM
FT                   LAFTLVLTLLCLRRRHSIGRLAGALLLCAFIAYIGLLYTQPSLMLYWD"
FT   CDS_pept        527364..528194
FT                   /codon_start=1
FT                   /gene_id="IGI22411083"
FT                   /gene_name="yrbF"
FT                   /locus_tag="ETAF_0455"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ADM40579.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001BD03A6"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C0"
FT                   /transl_table=11
FT                   /translation="MNHQENNLVDIRGMSFSRGNRQIFTDINLTVPRGKVTAIMGPSGI
FT                   GKTTLLRLIGGQLRPDRGEIWFDGENIPALSRGRLFEARKKMSMLFQSGALFTDLSVFD
FT                   NVAFPLREHTRLPESLLRTTVLMKLEAVGLRGAADLMPSELSGGMARRAALARAIALDP
FT                   QMILFDEPFVGQDPITMGVLVKLIDELNHALGITCVVVSHDVPEVLSIADHAYIVAEQR
FT                   VIAHGDRQALRANQDPRVRQFLDGIADGPVPFRYPAGDYRHALLASGEGSSHVA"
FT   CDS_pept        528184..528966
FT                   /codon_start=1
FT                   /gene_family="HOG000255130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411084"
FT                   /locus_tag="ETAF_0456"
FT                   /protein_id="ADM40580.1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="UniParc:UPI0001BD03A7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C1"
FT                   /transl_table=11
FT                   /translation="MLLNGLAAFGRRGIRVCAAFGRAGLMLFSALVGRPEPGKQWPLLR
FT                   RQLYSVGVQSLLIIIVSGLFIGMVLGLQGYLVLTTYSAEASLGMMVALSLLRELGPVVT
FT                   ALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVVAPRFWAGVISMPLLTVIFV
FT                   AVGIWGGSVVGVDWKGIDAGFFWSAMQGAVDYRTDLLNCLIKSLVFAITVMWIALFNGY
FT                   DAVPTSAGISRATTRTVVHASLAVLGLDFVLTALMFGN"
FT   CDS_pept        528971..529504
FT                   /codon_start=1
FT                   /gene_family="HOG000255143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411085"
FT                   /gene_name="yrbD"
FT                   /locus_tag="ETAF_0457"
FT                   /protein_id="ADM40581.1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniParc:UPI0001BD03A8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C2"
FT                   /transl_table=11
FT                   /translation="MQTKKAEVWVGLFMLIALCAAVFLCLQVANVKSLGSEPTYRLYAT
FT                   FDNVGGLKARSPVKIGGVVIGRVAEISLDPQTYLPRVAMDIDQRYNHIPDTSSLAIRTS
FT                   GLLGEQYLALNVGFEDPEMGTAILKDGGTIQDTKSAIVLEDLIGQFLYKSGGENGNASA
FT                   STAPAGNTPAPVAH"
FT   CDS_pept        529525..530175
FT                   /codon_start=1
FT                   /gene_family="HOG000284031" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411086"
FT                   /gene_name="yrbC"
FT                   /locus_tag="ETAF_0458"
FT                   /protein_id="ADM40582.1"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR023094"
FT                   /db_xref="UniParc:UPI0001BD03A9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C3"
FT                   /transl_table=11
FT                   /translation="MLKRIVMAALLCVAPWFSAQASAAPTLDQSNPYTLMNQAAAATFS
FT                   RLKSEQPRIKQDPDYLRTIVREELMPYVQVKYAGALVLGQYYRGATPAQRDAYFKAFQS
FT                   YLEQVYGQALALYHGQRYEVAAERPLGDATIVTIRVTIFDNQGRPPVRLDFQWRKNTQT
FT                   GHWQAFDMIAEGVSMITTKQNEWAAILREKGVDGLTQQLIVAAKQPITLDTKQ"
FT   CDS_pept        530172..530486
FT                   /codon_start=1
FT                   /gene_family="HOG000287451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411087"
FT                   /locus_tag="ETAF_0459"
FT                   /protein_id="ADM40583.1"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="UniParc:UPI0001BD03AA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C4"
FT                   /transl_table=11
FT                   /translation="MTARGELRWRRVDATLYLQGALECDSLDALWQQRQTLLTDITCVD
FT                   ISELSRVDSAGLALLLHVQNLRPETPIPLRGVSERLRTLITLYNLQDIVVCAAPSANLA
FT                   "
FT   CDS_pept        530627..530881
FT                   /codon_start=1
FT                   /gene_family="HOG000255170" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411088"
FT                   /gene_name="yrbA"
FT                   /locus_tag="ETAF_0460"
FT                   /protein_id="ADM40584.1"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="UniParc:UPI0001BD03AB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C5"
FT                   /transl_table=11
FT                   /translation="MNNDQIKDVLMKALALQEVHVTGDGSHFQVIVVGELFAGMSRVKQ
FT                   QQAVYAPLMEYIADNRIHALTIKAYTPDEWQRDRKLSGL"
FT   CDS_pept        530945..532201
FT                   /codon_start=1
FT                   /gene_family="HOG000075602" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411089"
FT                   /gene_name="murA"
FT                   /locus_tag="ETAF_0461"
FT                   /function="UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase activity"
FT                   /biological_process="UDP-N-acetylgalactosamine biosynthetic
FT                   process"
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /biological_process="regulation of cell shape"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40585.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008360"
FT                   /db_xref="GO:0008760"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="GO:0019277"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniParc:UPI0001BD03AC"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C6"
FT                   /transl_table=11
FT                   /translation="MDKFRLQGPTRLDGEVTISGAKNAALPILFAALLAEEPVEIQNVP
FT                   KLRDIDTTMKLLSQLGAKVERNGSVHVDASGVNELCAPYELVKTMRASIWALGPLVARF
FT                   GRGQVSLPGGCAIGARPVDLHISGLEQLGAEIRLEEGYVKASVQGRLQGAHIVMDKVSV
FT                   GATVTIMSAATLAQGTTVIENAAREPEIVDTAGFLNTLGAKISGAGTDRITIEGVERLG
FT                   GGVYRVLPDRIETGTFLVAAAVSRGRVVCRHTRPDTLDAVLAKLREAGADIEVGEDWIS
FT                   LDMHGQRPKAVTVRTAPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHIPELIR
FT                   MGAHAEIEGNTAICHGVETLSGAQVMATDLRASASLVIAGCIAQGTTLVDRIYHIDRGY
FT                   ERIEDKLSAMGARIERVGE"
FT   CDS_pept        complement(532564..533625)
FT                   /codon_start=1
FT                   /gene_family="HOG000223641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411090"
FT                   /gene_name="degS"
FT                   /locus_tag="ETAF_0462"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40586.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="UniParc:UPI0001BD03AD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C7"
FT                   /transl_table=11
FT                   /translation="MLVKLLRSTLLGLAVAIVLMIALPSLRPHGLMPLFSEASFEEQPV
FT                   SYNAAVRRAAPAVVNVYNGSMSGSNSGLAIKTLGSGVIMDEKGYILTNKHVVSAADQIV
FT                   VALQDGRWFEAMLVGSDTLTDLAVLKIQASNLPVITINPKRVPHIGDVVLAIGNPYNIG
FT                   QTTTQGIISATGRVGLSTYGHQNFLQTDASINHGNSGGALVNSLGELVGINTLSLDKSN
FT                   DGETPEGIGFAIPTALATKIMNKLIRDGRVIRGFIGIGGREIVPVRNQPASAERIQGII
FT                   VNSVAANGPAALAGIHPGDIVLNVNGKPAISATETMDQVAEIRPGSEVPVIIMRNGERL
FT                   KLNVTIAEFPNVD"
FT   CDS_pept        complement(533717..535012)
FT                   /codon_start=1
FT                   /gene_family="HOG000223642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411091"
FT                   /gene_name="degQ"
FT                   /locus_tag="ETAF_0463"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40587.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="UniParc:UPI0001BD03AE"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C8"
FT                   /transl_table=11
FT                   /translation="MTRRSLPLLLALSLSLGALPTAQASLPATLNGQALPSLAPMLAKV
FT                   LPAVVSVYVEGKQTPRHRRMEGLGSGVIINADKGYVLTNNHVIRDAQSIRVQLEDGREY
FT                   SARLIGRDAASDIALLQLIDARHLTAIPLADSDKLRVGDFAVAVGNPFGLGQTATAGIV
FT                   SALGRSGLNLEGPENFIQTDAAINSGNSGGALVNLKGELIGINTAILAPAGGNIGIGFA
FT                   IPSNMARSLSDQLIKYGEVKRGVLGIRGRDMTADLANAFKLDSPRGTFVNEVLPKSAAA
FT                   RAGIRAGDVLISLNGTPITSFAELRAKVGSVAPGTALQIGLLRNGKPMNVTVTLENHAL
FT                   ASVQGETLTPALAGASLSPGEAQGAPGIRIDTVEKGSPAAQIGLHKADLIIGVNRLRTR
FT                   DITALRRALAGDPPVIALHLIRGGEGMYLLLR"
FT   CDS_pept        complement(535168..535560)
FT                   /codon_start=1
FT                   /gene_family="HOG000283931" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411092"
FT                   /locus_tag="ETAF_0464"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40588.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniParc:UPI0001A59F69"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8C9"
FT                   /transl_table=11
FT                   /translation="MTWEYALIGLVVGIIIGALAMRFGNRKLRQQKTLQDELEKSKTDL
FT                   DQYRQELVNHFARSAELLDNMAKDYRQLYQHMATSSNNLLPDMPAHDNPFRYRLTEADN
FT                   DQAPVEIPPRDYSEGASGLLRADRHD"
FT   CDS_pept        535758..536891
FT                   /codon_start=1
FT                   /gene_family="HOG000259599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411093"
FT                   /locus_tag="ETAF_0465"
FT                   /function="ATP binding"
FT                   /protein_id="ADM40589.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="UniParc:UPI0001BD03CF"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D0"
FT                   /transl_table=11
FT                   /translation="MSSPYALTPDTPLARYRAALAAGDYQPDAAQQRAVEALDEIHRQW
FT                   AVRWHTAGPAAWRTRLPHWLGGRRTAEPIVGLYLWGGVGRGKTWLMDLFFDTLPGQRKQ
FT                   RLHFHRFMLWVHESLADKQGQADPLSALADALKAQADVLCFDEFFVTDIGDAMLLGTLL
FT                   PALFTRGVTLVATSNIPPAQLYPNGLQRSRFLPAIAQIQTHCQVLNVDGGTDYRLRTLT
FT                   QAHLYLTPLGARTEQAMEALFLRLAGQTGQIGGTLAINHRQMPVLRRAEAVVALHFSAL
FT                   CEAPCSSRDYIALAQRYHTVLLHGVSAMGADREACARRFLALVDEFYERRVTLIISATC
FT                   DMFGLYRGERLAFEYQRCLSRLQEMQSEAYLSLPHRP"
FT   CDS_pept        537148..537576
FT                   /codon_start=1
FT                   /gene_family="HOG000225286" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411094"
FT                   /gene_name="rplM"
FT                   /locus_tag="ETAF_0466"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40590.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="UniParc:UPI0001BD03D0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D1"
FT                   /transl_table=11
FT                   /translation="MKTFTAKPETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNAEKVAVTGNKRLDKKYFHHTGHIGGIKEATFEEMIARRPERVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI"
FT   CDS_pept        537591..537983
FT                   /codon_start=1
FT                   /gene_family="HOG000019802" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411095"
FT                   /gene_name="rpsI"
FT                   /locus_tag="ETAF_0467"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40591.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniParc:UPI0001A59F6C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D2"
FT                   /transl_table=11
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGSGKIVINQRSLEQYFGRETAR
FT                   MVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRSELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
FT   CDS_pept        538319..538960
FT                   /codon_start=1
FT                   /gene_family="HOG000255228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411096"
FT                   /locus_tag="ETAF_0468"
FT                   /protein_id="ADM40592.1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI0001BD03D1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D3"
FT                   /transl_table=11
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVDMDN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGESRLFMH
FT                   QIERDWYSLLYKIEKGSAQEADAARKQLREELLAIAPVFAQKPYFMSDEFSLVDCYLAP
FT                   LLWRLPVLGIELSGAGAKELKGYMTRVFERDAFLASLTEAEREMRLHTRG"
FT   CDS_pept        538963..539454
FT                   /codon_start=1
FT                   /gene_family="HOG000255240" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411097"
FT                   /locus_tag="ETAF_0469"
FT                   /function="peptidase activity"
FT                   /protein_id="ADM40593.1"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="UniParc:UPI0001BD03D2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D4"
FT                   /transl_table=11
FT                   /translation="MELSQMSPRRPFLLRAFYDWLLDNQLTPHLVVDVHCADVMVPMEY
FT                   ARDGQIVLNIAPRAVGGLELADDAVRFNARFGGVPRQVYVPMAAVMAIYARENGAGTMF
FT                   EPEAAYEQDGDETRAETESDEPAMTLIDGDRSPDNEAPADDDGGDEPPPRGRPALRVVK
FT                   "
FT   CDS_pept        complement(539673..540149)
FT                   /codon_start=1
FT                   /gene_family="HOG000282946" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411098"
FT                   /locus_tag="ETAF_0470"
FT                   /function="isomerase activity"
FT                   /protein_id="ADM40594.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="UniParc:UPI0001BD03D3"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D5"
FT                   /transl_table=11
FT                   /translation="MILGHIDDLAQRGDLPTPIRRALQRALEAGAAQLENGTHPIDGER
FT                   LYMNVMTLTPQRAEEKQGEIHRDYLDIQLVLEGEERIDFTLAGQARECQPYQQEGDYQL
FT                   CAAMAQPQRLIMTPGMFAVFLPGEPHKPGCISRTSDPIRKVVVKLHRDCLKEEK"
FT   CDS_pept        complement(540146..541021)
FT                   /codon_start=1
FT                   /gene_family="HOG000150087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411099"
FT                   /locus_tag="ETAF_0471"
FT                   /function="N-acylmannosamine kinase activity"
FT                   /protein_id="ADM40595.1"
FT                   /db_xref="GO:0009384"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniParc:UPI0001BD03D4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D6"
FT                   /transl_table=11
FT                   /translation="MNTLAIDLGGTKLAAALVDVDGQLSQRVEAATPASGDPEALTQAL
FT                   AQLITRYRGMADRVAVASTGIIHQGILSALNPDNLGGLNRFPLQECIERLSALPCHLLN
FT                   DAQAAAWAEYLALTPSGQDMAFITVSTGVGGGLVLNGRLQIGRGAFAGHIGHTLADPAG
FT                   PRCGCGRSGCVESIASGRAIAAAAQDDLVGLDARAIFQRAAAGDAQAQRLIARSAQAIA
FT                   QLIADLRATLDIQCAVIGGSVGLAPGYLDQVQHFLRQMPHAYHATLYSARHQRDAGLIG
FT                   AALWSRRETA"
FT   CDS_pept        complement(541002..541709)
FT                   /codon_start=1
FT                   /gene_family="HOG000236669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411100"
FT                   /gene_name="nanE"
FT                   /locus_tag="ETAF_0472"
FT                   /function="N-acylglucosamine-6-phosphate 2-epimerase
FT                   activity"
FT                   /biological_process="N-acetylmannosamine metabolic process "
FT                   /protein_id="ADM40596.1"
FT                   /db_xref="GO:0006051"
FT                   /db_xref="GO:0047465"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001BD03D5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D7"
FT                   /transl_table=11
FT                   /translation="MSVFTTLQQHIQRNGALIVSCQPVPDSPMDSPEIVAAMAAAAAQA
FT                   GAAALRIEGVANLQAVRPRVTLPIIGIIKRDLDDSPVRITPFLRDVDDLVQAGADIIAF
FT                   DGTLRPRPEQREALLARIQHHGRLAMADCSSLEDGLYCQHLGCDFIGTTLSGYTNGETP
FT                   CEPDLALVHALSSAGCRVIAEGRYNTPAQAAQALSQGAWAVTVGSAITRIEHICQWYCQ
FT                   ALQAEAHHEYAGH"
FT   CDS_pept        complement(541875..542576)
FT                   /codon_start=1
FT                   /gene_family="HOG000252211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411101"
FT                   /locus_tag="ETAF_0473"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="electron transport chain"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40597.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="UniParc:UPI0001BD03D6"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D8"
FT                   /transl_table=11
FT                   /translation="MFAKMWSDLRQNPVETLVRWQEQRFLWLLMALAMGGLIVLAHAFF
FT                   QIYLYMAPCEQCVYIRFAMFVMVIGGLVAAINPRNLALKLFGCIAAFYGAIIGMGYSIK
FT                   LNGIHHAVHSPDALFGVQGCSTDPSFPFGLPLAEWAPSWFKPTGDCGYDAPMVPQGVAL
FT                   DSVQQWFIDMYVQAEGWYLIPSMQFMNMAQACFLAFALCFAILVIMSVAWAIHLLRRRA
FT                   MPADPTASTPR"
FT   CDS_pept        complement(542593..543264)
FT                   /codon_start=1
FT                   /gene_family="HOG000265317" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411102"
FT                   /locus_tag="ETAF_0474"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /cellular_component="outer membrane-bounded periplasmic
FT                   space"
FT                   /protein_id="ADM40598.1"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0030288"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001BD03D7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8D9"
FT                   /transl_table=11
FT                   /translation="MHLTLGKTHLKALLGATLLTCAFGAAAFSEGTDYVVLEKPIPNAQ
FT                   KTLIKVFSYDCPFCYKYDKAVTGPVSDKVKDIVRFEPYHLDTKGVYGPQGSEILAVLLN
FT                   KDRAAGVSIFDDASQFKKAKFAYYAAYHDKKERWKDGKDPAAFTQTGLDAAGLSQADLE
FT                   GGLKDPAVQKTLGEWKASAYDVAKIQGVPAYVVNGKYLIMTKSIKSVDSMADLVKELAA
FT                   K"
FT   CDS_pept        complement(543328..545163)
FT                   /codon_start=1
FT                   /gene_family="HOG000101431" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411103"
FT                   /locus_tag="ETAF_0475"
FT                   /function="arylsulfate sulfotransferase activity "
FT                   /protein_id="ADM40599.1"
FT                   /db_xref="GO:0047686"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="UniParc:UPI0001BD03D8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E0"
FT                   /transl_table=11
FT                   /translation="MIKMDLLQSQENTMLSTTRKTLVAGAIAFAIGAVSPAVHAAGMPA
FT                   APAVGNLGAVVVDPYGNSPLTALINLNGHAISDVNVTVQGKGKNGVAVSYPVGKQSLLT
FT                   YDGIPIFGLYQKHDNQVTVEYKEGGKLKKDAYTIRTSAIVNKYMDNRSLTDLQPVKPVK
FT                   VAKGFEDRLYLVNTHTFTPQGSDLHWSGEKDKNAGLLDASPATGSLPFDIAPFTFIVDT
FT                   QGEYRWWLNQDTLYNGHDVDINQRGYLMGIRETPRGTFTAVQGQHWYEFDMMGQVLNNH
FT                   RLPRGYLDATHESIEIPNGNVMLRVGKRNYLRDDGQRVHTIRDHILEVDKAGRVVDVWD
FT                   LNLILDPLRDSLLGALDAGAVCVNVDLDHAGKQAKLEPDTPFGDALGVGPGRNWAHVNS
FT                   IAYDPKDDSIILSSRHQGVIKIGRDKQVKWILAPAEGWNEKLSAKLLKPVDAQNKPLNC
FT                   SAKGVCENSDFDFSYTQHTAWLSPKGTLTVFDNGDGRHLEQPALPTMKYSRIVEYKIDE
FT                   KNMTVQQLWEYGKDRGYEWYNPITSIVEYQPDRDTMFSFGGSTNLFEPGQPTTGRLNEI
FT                   DYKTKEVKVELDVLSDKANQTHYRAALIRPQGLFL"
FT   CDS_pept        545520..546521
FT                   /codon_start=1
FT                   /gene_family="HOG000156618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411104"
FT                   /locus_tag="ETAF_0476"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40600.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001BD03D9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E1"
FT                   /transl_table=11
FT                   /translation="MRKVDNVAVDSELLALFRALAETGSLTQAAGRVGLSQAAASRALS
FT                   KLRAVFQDQLFVKGGYGMQATPRARELMPRVTAVLQALDHLTMPYEFDPQALRRTLYLG
FT                   AVDNGVWMIFSRVVKSLFQQAPNARIEILPIGDDLFSSLKFGRMDLAIYPLIDIPPDFH
FT                   EANLFKTTFSCLVRQGHPLARQMLRGETPTLAQINAYRRLQVSLHDGQPGATVGNAVHR
FT                   QGKDYDVAMSVPYFLAAPMLLSQTDFVLTLPTQTARHFSQMANLAILPYPDGETTFYTR
FT                   LIWHHRVHHDPVIQWLRTLFLRFASEEAALESARDNADAAGCRVGAERYTQR"
FT   CDS_pept        complement(546506..547924)
FT                   /codon_start=1
FT                   /gene_family="HOG000031439" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411105"
FT                   /locus_tag="ETAF_0477"
FT                   /function="glutamate synthase (NADPH) activity "
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40601.1"
FT                   /db_xref="GO:0004355"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001BD03DA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E2"
FT                   /transl_table=11
FT                   /translation="MSQNVYQFIDLQRIDPPKKPLKQRQGEFIEIYEPFSDGQAQAQAD
FT                   RCLSCGNPYCEWRCPLHNYIPNWLKLANEGRIWDAATLSHQTNSLPEVCGRVCPQDRLC
FT                   EGACTLHDEFGAVTIGSVERYITDKALAEGWMPDLSGVQPTGKRVAIVGAGPAGLACAD
FT                   VLARSGVQAELFDRHPEIGGLLTFGIPAFKLEKQVMVRRREIFSAMGIRFHLNTEIGRD
FT                   ITLESLLSQFDAVFLGVGTYQALPGGLEQEEASGVHSALPYLIATARHLMGYAEDPQTP
FT                   YVSMHGKRVVVLGGGDTAMDCVRSALRQGATQVTCAYRRDEGNMPGSRREVKNAREEGA
FT                   AFRFNLQPLAIETNAAGRVCGVRMAQTTLTDPDAAGRRAVRLVPDAEVTLAADAVILAF
FT                   GFRPHAMTWLAEHGVDLDAQGRIVAADHGDYPHQTSNPQIFAGGDAVRGSDLVVTAIAE
FT                   GRRAAQGILNYLCV"
FT   CDS_pept        complement(547940..552397)
FT                   /codon_start=1
FT                   /gene_family="HOG000031558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411106"
FT                   /locus_tag="ETAF_0478"
FT                   /function="glutamate synthase (NADPH) activity "
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40602.1"
FT                   /db_xref="GO:0004355"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI0001BD03DB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E3"
FT                   /transl_table=11
FT                   /translation="MLYDASHERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAI
FT                   LADGKTGDGCGLLLQKPDRFLRMVAEERGWRLAKNYAVGMLFLSRDEERASAARRIVEE
FT                   ELQNETLSIVGWRDVPVNQEVLGEIALSSMPHIAQIFINAPAGWRPRDLERRLFIARRR
FT                   IEKRIDDPDFYVCSLSNLVTIYKGLCMPADLPRFYHDLADLRMESAICLFHQRFSTNTV
FT                   PRWPLAQPFRYLAHNGEINTITGNRQWARARTYKFKTPLIPDLQDAAPFVNETGSDSSS
FT                   LDNMLELLLSGGMDIVRAMRLLVPPAWQNNPDMDPDLRAFFDFNSMHMEPWDGPAGIVM
FT                   SDGRFAACNLDRNGLRPARYVITKDRLITCASEVGIWDYQPDEVVEKGRVGPGELMVID
FT                   TRAGQILHSRETDDDLKSRHPYREWMEKNVRRLIPFEDLPDERVGSRTLDDAALLTYQK
FT                   QFAYSQEEIDQILRVLGENGQEATGSMGDDTPFAVLSSRPRLIYDYFRQQFAQVTNPPI
FT                   DPLREAHVMSLSTSIGREMNVFCEAEGQAHRLNFKSPVLLYSDFAQLIGQEKEHYRAET
FT                   LDITFDPEQQDLQQALAALCDEAEAQVRRGAVLLVLSDRAISARRLPIPAPMAVGAVQR
FT                   RLVEQSLRCDANIIVETAGARDPHHFAVLLGFGATAIYPYLAYETLAKLVDSGAIARSY
FT                   RQVMLNYRNGINKGLYKIMSKMGISTVASYRCSKLFEAVGLHPAICDLCFPGVISRIGG
FT                   ATFSDFQQDLHNLSRRAWLARQPLEQGGLLKYVHDGEYHAYNPDVVQALQQAVQSGDYR
FT                   DYQRYASLVNQRPITTLRDLLALRPVAQPLALEQVEAESALFQRFDTAAMSIGALSPEA
FT                   HEALAQAMNGLGGFSNSGEGGEDPARYNTDKASRIKQVASGRFGVTPAYLVNADVIQIK
FT                   VAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQV
FT                   NPRALISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKHAGCPWELGL
FT                   VETQQALVANGLRHKIRLQVDGGLKSGADIIKAAILGAESFGFGTGPMVALGCKYLRIC
FT                   HLNNCATGVATQDEKLRRDHFHGLPLRVTHYFHFIARETRELMAQLGVSRLVDLIGRTD
FT                   LLTVLEGVTAKQSRLDLAPLLHTATPHPGKGLYCSEGNPPFDPGQLNQSLLSQLQDNIA
FT                   TRQGRALFCDIHNTDRSVGAALSGAIAERYGEQGMAASPLKIQFSGTAGQSFGVWNAAG
FT                   LELTLTGDANDYVGKGMAGGRIVIRPPVGSAFRSHEASIIGNTCLYGATGGKLFAAGRA
FT                   GERFAVRNSGALTVVEGIGDNGCEYMTGGIVCVLGRTGINFGAGMTGGFAYVLDEDGEF
FT                   RQRVNAELVEVLEMAALPIHEEHLRGLITEHVRLTGSGRAEAILADWPQWAARFVLIKP
FT                   KSSDVKALLGHRSRSAAELRVQAQ"
FT   CDS_pept        553033..553983
FT                   /codon_start=1
FT                   /gene_family="HOG000027270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411107"
FT                   /locus_tag="ETAF_0479"
FT                   /function="catalytic activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /protein_id="ADM40603.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001BD03DC"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E4"
FT                   /transl_table=11
FT                   /translation="MAKLASGLYKASFTIMQLQQLVNMFGADLQRRYGEKIHKLTLHGG
FT                   FSCPNRDGTLGRGGCTFCNVASFADEQMQRRSIAEQLEAQARKVNRARRYLAYFQAYTS
FT                   TYAEVCILRDMYREALQQADMVGLCVGTRPDCVPESVLDLLAEYREQGYEVWLELGLQS
FT                   ANDKTLRRINRGHDFACYQRTTRAARARGLKVCSHLIVGLPGESHADCLDTLQRVVETG
FT                   VEGIKLHPLHIVTGSVLAKAWQAGRLQDLTLERYVHTAGEMIRHTPPEVIYHRISASAR
FT                   RPTLLAPQWCENRWTGMVAINNYLLECGGQASALS"
FT   CDS_pept        554172..556508
FT                   /codon_start=1
FT                   /gene_family="HOG000272667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411108"
FT                   /gene_name="arcB"
FT                   /locus_tag="ETAF_0480"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM40604.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="UniParc:UPI0001BD03DD"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E5"
FT                   /transl_table=11
FT                   /translation="MKQIRVLAQYYVDLMVKLGLVRFSILLASALVLLAMVVQMAVTML
FT                   LRGQVDSIDVVRSVFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVNKLEEMRHRDLKL
FT                   NQQLKDNISQLNQEIADRVKAEEARLQVLDTLQHEIDQRELAQVELEQQSALLRSFLDS
FT                   SPDLVYYRNEDGEFSGCNRAMELLTGKSEKQLIGLTPRDVYDPDIAQKVIETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASR
FT                   EKTTFISTISHELRTPLNGIVGLSRILLDTELNEEQLKYLKTIHVSAIALGNIFNDIIE
FT                   MDKLERRKVQLDNQAIDFTGFLTDLENLSGLLVQPKGLSFTLTPDPALPHKVMADGTRL
FT                   RQILWNLIGNAVKFTQRGGVSVRVWREQQDKLLFEVRDTGIGIPPEEQDKIFAMYYQVK
FT                   DMHGGKPATGTGIGLAVSKRLAQTMGGDIVVSSVAGEGACFTLSIRAPVVEEALSEPPA
FT                   EEEMPLPALHVLLVEDIELNVIVARSVLEKMGNSVDVAMSGAEALAMFVPQEYDLVLLD
FT                   IQLPDMTGLDIARTLCQRYGKPALPPLVALTANVLKDKKEYLDAGMDDVLSKPLAVPAL
FT                   TAVIRRFWDSAPATTLEAGEPHAHDLCELLDTEMLQQYLDLVGPQLIDQSLAVFEKMMP
FT                   GYLSVLESNMTARDQKGITEEGHKIKGAAGSVGLRHLQQLAQQIQTPTLPAWWDNVQEW
FT                   IDELKQEWRHDVQVLRDWVAQANKK"
FT   CDS_pept        556884..557537
FT                   /codon_start=1
FT                   /gene_family="HOG000269874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411109"
FT                   /locus_tag="ETAF_0481"
FT                   /protein_id="ADM40605.1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0001BD03DF"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E6"
FT                   /transl_table=11
FT                   /translation="MKRVGVVLSGCGVFDGSEIHEAVLTLLALSRAGAQAVCLAPDREQ
FT                   AQVIDHLRGEPTAERRNVLVEAARIARGDVTSLAQADASQLDALIVPGGFGAAKNLSSF
FT                   ATDGAACSIDPALQHLVTRLHRDGKPLGFICIAPALLPKLLGVPVRVTIGNDAATADAI
FT                   AAMGGEHVACAVNDIVVDEAQRVVTTPAYMLANTIAEAAEGIDKLVAQVLDMTR"
FT   CDS_pept        557534..558268
FT                   /codon_start=1
FT                   /gene_family="HOG000288117" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411110"
FT                   /gene_name="mtgA"
FT                   /locus_tag="ETAF_0482"
FT                   /function="transferase activity, transferring pentosyl
FT                   groups"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /biological_process="regulation of cell shape"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peptidoglycan-based cell wall "
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40606.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0008360"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="GO:0009274"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016763"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="UniParc:UPI0001BD03E0"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E7"
FT                   /transl_table=11
FT                   /translation="MSQTAASRRVLQRIRRWGSRLVIALLGAWIAALLIFAVLPVPYST
FT                   VMVQRQVGAWLHGDFSYVAHQTWRPMSQIAPPMALAVIAAEDQKFPQHWGFDLTAIGQA
FT                   LDSADEGGRPLRGASTLSQQTMKNLLLWDGRSWLRKGLEAPLTLAEELVWSKRRILTVY
FT                   LNIAEFGPGVFGVEEAAQRYFHKPASRLTAGEAALLAAVLPNPHRFSVRAPSRYVLQRQ
FT                   RWILRQMRQLGGEAFLQRYDLR"
FT   CDS_pept        complement(558330..558920)
FT                   /codon_start=1
FT                   /gene_family="HOG000254779" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411111"
FT                   /locus_tag="ETAF_0483"
FT                   /protein_id="ADM40607.1"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniParc:UPI00005B54E4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E8"
FT                   /transl_table=11
FT                   /translation="MTMRFPLTRCFPALVVLSALLLQGCVAAVIGSATMATQAASDPRS
FT                   VGTQVDDGTLEARISNALSKDAQLKKEARVVVTAYQGQVLLTGQAPSQALISRAKQIAM
FT                   GVEGTKAVYNEIRLGQPVSLGTASADAWITTKVRSQLLASDQVKSTNVKVTTENGEVFL
FT                   LGLVTPKEGQAAAQTASKVSGVKHVTTAFSLLK"
FT   CDS_pept        complement(558931..559521)
FT                   /codon_start=1
FT                   /gene_family="HOG000237572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411112"
FT                   /locus_tag="ETAF_0484"
FT                   /function="isomerase activity"
FT                   /function="sugar binding"
FT                   /biological_process="DNA replication"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ADM40608.1"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="UniParc:UPI0001BD03E1"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8E9"
FT                   /transl_table=11
FT                   /translation="MLERIKGCFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKIL
FT                   SCGNGASGANAQHFAATLINRFETERPSLPAIALNADSVVLTAIGNDRLHDEIYAKQVR
FT                   ALGHAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQQDVEIRI
FT                   PSHRSTRIQEMHMLTVNCLCDLIDNTLFPHQAD"
FT   CDS_pept        complement(559568..559954)
FT                   /codon_start=1
FT                   /gene_family="HOG000016278" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411113"
FT                   /locus_tag="ETAF_0485"
FT                   /function="DNA binding"
FT                   /function="nuclease activity"
FT                   /protein_id="ADM40609.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniParc:UPI0001BD03E2"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F0"
FT                   /transl_table=11
FT                   /translation="MAAVPERQHRPGAITAHQIGAHYEQRARRYLERAGLRFHAANVRL
FT                   RGGEIDLIMRDGATWVFVEVRYRKTACYGGAAASIDSRKRQRLQRCAAYWLAAQNQSIE
FT                   TADCRFDVLAITGSQLQWLPNAFV"
FT   CDS_pept        complement(559912..561936)
FT                   /codon_start=1
FT                   /gene_family="HOG000125217" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411114"
FT                   /locus_tag="ETAF_0486"
FT                   /protein_id="ADM40610.1"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="UniParc:UPI0001E354E4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F1"
FT                   /transl_table=11
FT                   /translation="MAATLLAACSGRVSTTPPAPVQSEATASADYYLQQMQQSSDDSKA
FT                   DWQLLAIRALLREGKLPQAADLLGQLPSQLSEAQQLEQRLVSAELEIARHAPQQAQAIL
FT                   TKLDVAQLSQAQQLRYYQAVIAAAQGKTTLAQIRAYIALQPLLTQEKQRKANIDATWAA
FT                   LSTLTPADLNGMVINANEDILRGWLDLLRLYQDNRQDPALLKAAIKDWQTRYPNNPAAT
FT                   LLPSALDNILHLQSASTASIALLLPLNGQAKVFSDAIEAGFNAAKNGAFSQNSAPTAAA
FT                   ATDNGAPASSGTLAAATTPSAPADVNAAGAVSPSAQGTDAAAPAAPNDSAALPPLDAAG
FT                   DPIAPSVSPGNPDAHIQVYDTSSQPLPALLSQAQQAGASLVVGPLLKNNVDQLNTLSTP
FT                   LNILALNQPEQVQNHPNICYFALSPEDEARDAARHIWAQGKRTPLLLIPRSPLGDRVAK
FT                   AFATEWQSLGGGSVLQQTFGSSAELRSTINGGTGIRLTGQPVSIAPAQPASVTIAGLTI
FT                   PAPVQPPVASGGGVDAVYIIATPAEITLIKPMIDLANGTHNGIGLYASSRSYQAGAGPD
FT                   FRLEMEGVQFSDIPLLAGSDPAILQQAPAQYRNDYSLMRLYAMGADAWTLANHFAQLRQ
FT                   IPGFQVQGATGTLSANDNCVIQRKLPWLQYQKGSIVPVQ"
FT   CDS_pept        562051..562920
FT                   /codon_start=1
FT                   /gene_family="HOG000195941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411115"
FT                   /locus_tag="ETAF_0487"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ADM40611.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="UniParc:UPI0001BD03E4"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F2"
FT                   /transl_table=11
FT                   /translation="MNQNDHAAISAATLYVVPTPIGNLGDITQRALETLKAVDLIAAED
FT                   TRHTGMLLQHFAINARFFALHDHNEQQKADQLLAKLREGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALCAAGVASDRFCYEGFLPAKGKARRDRLRDLQQEA
FT                   RTLIFYESTHRLLESLADMVSELGAERYVVLARELTKTWENIHGAPVAELLAWVQQDEN
FT                   RRKGEMVLIVEGYQADDEALSPEALRTLALLQAELPLKKAAALAAEIHGVKKNTLYKYA
FT                   LAQQSGDK"
FT   CDS_pept        complement(563359..564039)
FT                   /codon_start=1
FT                   /gene_family="HOG000127853" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411116"
FT                   /locus_tag="ETAF_0488"
FT                   /protein_id="ADM40612.1"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniParc:UPI0001BD03E5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F3"
FT                   /transl_table=11
FT                   /translation="MVKATLRFRLHRTAIVLICLALLVILMQGASYFSLSHQRARLDQV
FT                   SELAQTLAQQVAARLSPLINDDTPDTKKIAPILEALTRHSRILDASVYALDGSLIAQAG
FT                   ERVEVRDRLALDGQRAGSYFNHQIVQPIDGRDGPLGFLRLTLDTHVLATESQQVDNTTN
FT                   LLRLMMLLALAIGIILARTLLQARRSRWQQSSYLLTANVPLEEESERDAPTQENAASTT
FT                   PPTS"
FT   CDS_pept        564146..565123
FT                   /codon_start=1
FT                   /gene_family="HOG000231115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411117"
FT                   /locus_tag="ETAF_0489"
FT                   /function="phosphoserine phosphatase activity"
FT                   /biological_process="L-serine biosynthetic process "
FT                   /protein_id="ADM40613.1"
FT                   /db_xref="GO:0004647"
FT                   /db_xref="GO:0006564"
FT                   /db_xref="InterPro:IPR004469"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001BD03E6"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F4"
FT                   /transl_table=11
FT                   /translation="MPNSLTFCDLPAEIYRWPGLPLSLSGDEVMPLDYRAGHTGWLLYG
FT                   RHLDKAALQAFQRRLAAPLVVVAAWCIEDYQVVRLAGGMPARAAKLANEQGIDTAVLGR
FT                   LPHLRSPGLLVMDMDSTAITIECIDEIARLAGVGGEVAAVTERAMRGELDFAASLRQRV
FT                   AALEGADAAILQQVRDDLPLMPGLTSLVRKLQAFDWHVAIASGGFTYFADHLRTRLNLS
FT                   AAVANALEVHNGRLTGRVTGRIVDAQCKEDTLCELAQRLNIPLTQTVAIGDGANDLKMI
FT                   QRAGLGIAFHAKPCVYDRAPLAIRHADLIGVLCVLSATLKHEER"
FT   CDS_pept        565178..566566
FT                   /codon_start=1
FT                   /gene_family="HOG000218329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411118"
FT                   /gene_name="radA"
FT                   /locus_tag="ETAF_0490"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent peptidase activity"
FT                   /function="damaged DNA binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM40614.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001BD03E7"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F5"
FT                   /transl_table=11
FT                   /translation="MAKAVKRAFVCNECGADYPRWQGQCSACQAWNSISEVRLAAAPAA
FT                   GRSARLSGYAGDAGSLSKVQKLSEISLEALPRFSTGFTEFDRVLGGGVVPGSAILIGGN
FT                   PGAGKSTLLLQTLCRLSQQMKTLYVTGEESLQQVAMRAHRLGLPTEGLNMLSETSIEQI
FT                   CLIAEQEQPKLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHV
FT                   TKDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREV
FT                   SNPSAIFLSRGEEITAGSSVMVVWEGTRPLLVEIQALVDTSMMSNPRRVAVGLEQNRLA
FT                   ILLAVLHRHGGLQMADQDVFVNVVGGVKVSETSADLALLMSLVSSLRDRPLPQDLVIFG
FT                   EVGLAGEVRPVASGQERIIEAAKHGFRRAIVPHANVPKKAIPNMTVYGVKKLSDALDIL
FT                   QDLA"
FT   CDS_pept        complement(566629..568296)
FT                   /codon_start=1
FT                   /gene_family="HOG000271639" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411119"
FT                   /gene_name="yjjK"
FT                   /locus_tag="ETAF_0491"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ADM40615.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="UniParc:UPI0001BD03E8"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F6"
FT                   /transl_table=11
FT                   /translation="MAQYVYTMNRVGKIVPPKRHILKDISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGVDTDIEGEARPQPGIKIGYLPQEPKLNLEQTVREAVEEAVGDVKQALTRL
FT                   DEVYALYADPDADFDKLAKEQGELEAIIQSHDGHNLDNQLERAADALRLPAWDAKIANL
FT                   SGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYFL
FT                   DNVAGWILELDRGEGIPWEGNYSSWLEQKDQRLAQEASAEAARRKSIEKELEWVRQGAK
FT                   GRQSKGKARLARFEELNNTDYQKRNETSELFIPPGPRLGDKVLEVSNLSKSYGDRLLID
FT                   ALSFSIPKGAIVGIIGPNGAGKSTLFRMISGQEQADSGSITLGDTVTLASVDQFRDAMD
FT                   DKKSVWEEISGGQDIMRIGNFEIASRAYVGRFNFKGTDQGKRVGELSGGERGRLHLAKL
FT                   LQVGGNMLLLDEPTNDLDVETLRALENALLEFPGCAMVISHDRWFLDRIATHILDYQDE
FT                   GRVEFFEGNFSEYEEYKKRTQGAEALQPHRIKYKKIAK"
FT   CDS_pept        568683..570611
FT                   /codon_start=1
FT                   /gene_family="HOG000275388" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411120"
FT                   /locus_tag="ETAF_0492"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /cellular_component="periplasmic space"
FT                   /protein_id="ADM40616.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0042597"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR016026"
FT                   /db_xref="UniParc:UPI0001BD03E9"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F7"
FT                   /transl_table=11
FT                   /translation="MVMVGKWRYWSVGLCLALSAAAASADSLDAQRARYQQIKQAWDGN
FT                   RMDSVNQLMPTLRDYPLYPYLAYRALTQDMSQVNAQQIKAFLQQYPTLPPARSLTSRYV
FT                   NELARREDWIGLLAFSPQPPQPVAARCNYYYAQYATGHAEAAWRGAQTVWMSGQSLPSS
FT                   CDKLFDAWKGAGGLRDQAILARLRLALEKGNAGLVKYLQQQLPANYQTLNTALTALQAN
FT                   PRSVEAFARSVAPSDFTRDIVGVAFASLARQDADAARAMLPTLVRLQHIPSSQRQAMEE
FT                   TIAWRLMGSDASADDRRWRDGVIRRSHNAALLERRLRMALGEGNPAQVREWLGRLPQSV
FT                   RDKDEWRYWQAVALIDEGKRSEGQAILRALIKQRGFYPMVAAQRLGIPYPLQVMRAVRP
FT                   DAALAQEPAIARVRELMYWNMDNTARSEWSALVASKPRPQQEALARYALDQGWADLSVQ
FT                   ATIVAKLWDHLQERFPLAWPQEFRSATEDKGITQSYAMAIARQESAWNPEARSSVGASG
FT                   LMQLMPKTAEHTAKMFSLSHYQNSSQLFDPKINIDIGTRYLEYVYQSLGRNRILASAAY
FT                   NAGPSRVNTWLGNSDGRVDAVAFIESIPFSETRGYVKNVLAYDAYYRYFMHRPDQILTD
FT                   AEWARRY"
FT   CDS_pept        570703..571035
FT                   /codon_start=1
FT                   /gene_family="HOG000288846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411121"
FT                   /gene_name="trpR"
FT                   /locus_tag="ETAF_0493"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription repressor activity"
FT                   /biological_process="negative regulation of transcription,
FT                   DNA-dependent"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40617.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016564"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0045892"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013335"
FT                   /db_xref="UniParc:UPI0001BD03EA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F8"
FT                   /transl_table=11
FT                   /translation="MQKTTPAPDQAPAEPDDWQRFIQLLQQAYQEGCQEPMLQLFLTPD
FT                   ERDALATRVRIIEELLKGEMSQRELKSQLGAGIATITRGSNSLKMASPDFKRWLVRQLL
FT                   PSTPQA"
FT   CDS_pept        complement(571026..571562)
FT                   /codon_start=1
FT                   /gene_family="HOG000098033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411122"
FT                   /locus_tag="ETAF_0494"
FT                   /function="hydrolase activity"
FT                   /protein_id="ADM40618.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="UniParc:UPI0001BD03EB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8F9"
FT                   /transl_table=11
FT                   /translation="MYHVVAATTNPAKIQAITLAFDAAFGAGQYRIEGIDVDSGVPEQP
FT                   LGSTQTRSGARHRVICARQLRPEADFWVGIEAGIEDNMTFAWMSVENHCHRGESRSASL
FT                   TLPDSVMDGIRQGQTLGHEMRRLSGIDDINRREGAIGIFTQGRLSRTSVYYQALLLALA
FT                   ALEPGYHREPPPHYA"
FT   CDS_pept        571816..572373
FT                   /codon_start=1
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411123"
FT                   /locus_tag="ETAF_0495"
FT                   /function="phosphoglycerate mutase activity"
FT                   /protein_id="ADM40619.1"
FT                   /db_xref="GO:0004619"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0001E354FA"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G0"
FT                   /transl_table=11
FT                   /translation="MGEQQARQVGARLGQMGITHVIASDLGRTQQTGEIIAAACRCPLT
FT                   LDARLRELSMGVLESRLLASLSPQEEQWRLSMLDGSPQGCIPQGETMAQLAERMQQALN
FT                   DCLALPQGSRPVLVSHGIALGCLLSTVLGLPPYAERRLRLRNCSLSRVDYQQSAWLASG
FT                   WVVETAGDVQHLAQPSMDEVLR"
FT   CDS_pept        complement(572370..573260)
FT                   /codon_start=1
FT                   /gene_family="HOG000127886" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411124"
FT                   /locus_tag="ETAF_0496"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADM40620.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniParc:UPI0001BD03ED"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G1"
FT                   /transl_table=11
FT                   /translation="MDQADIIHDLLNWLEGHLDHPLTLDNVAAKAGYSKWHLQRMFKDV
FT                   TGQAIGAYIRARRLSNAAAALRLTSRPILDIALQYRFDSQQTFTRAFKKQFNKTPALYR
FT                   REEEWHAYGMRPPIRLGDYAIPTPEFITLPSLSLVGVTQSYTCTLEQICRVRTELRTQF
FT                   WRDFLHAVQDIRDIPPVLYGLHHSHPNPDKDDEQSIMYTTALEPHLLPKQVTREVQSIE
FT                   LAGGEYAKFSYQGPTEHFQAFIMSLYNSALPTLNLTRRRGYDVERFYPLVDSTQRPPKN
FT                   LRCEYLIPIRHTPSS"
FT   CDS_pept        573455..573943
FT                   /codon_start=1
FT                   /gene_family="HOG000257967" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411125"
FT                   /gene_name="creA"
FT                   /locus_tag="ETAF_0497"
FT                   /protein_id="ADM40621.1"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniParc:UPI0001BD03EE"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G2"
FT                   /transl_table=11
FT                   /translation="MNKYFVGLCVALTTLWGASVHAEEIGSVDTVFKLFGPDHKIVVEA
FT                   FDDPDVENVTCYVSRAKTGGIKGGLGLAEDTSDAAISCQQVGPIALSEKIRNKKADGEV
FT                   VFRKRTSLVFKKLQVVRFYDSKRNVLIYLSYSDRVVEGSPKNAISAVPVMPWSAAPQG"
FT   CDS_pept        complement(574014..575732)
FT                   /codon_start=1
FT                   /gene_family="HOG000076893" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411126"
FT                   /gene_name="proS"
FT                   /locus_tag="ETAF_0498"
FT                   /function="ATP binding"
FT                   /function="proline-tRNA ligase activity"
FT                   /biological_process="prolyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40622.1"
FT                   /db_xref="GO:0004827"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006433"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniParc:UPI0001BD0417"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G3"
FT                   /transl_table=11
FT                   /translation="MRTSQYLLSTLKETPADAEVVSHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLNKVENIVREEMNYAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGDRPF
FT                   VLGPTHEEVITDLVRNEISSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTTQASLQETYDAMYAAYGRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSTASDYAANIELAEALAPTAERAAATQPMQLVDTPNAKTIAELVEQHGLPIEKTVKTL
FT                   LVHASEESGHTLVALLVRGDHELNEVKAEKLALVASPLTFANEAEIRALVNAGPGSLGP
FT                   VNLPLPVVADRAVAAMSDFGAGANIDGKHYFGINWERDVALPQIADIRNVVEGDPSPDG
FT                   KGTLLIKRGIEVGHIFQLGTKYTEALNATVQGEDGRNQLMTMGCYGIGVTRVVAAAIEQ
FT                   NHDERGIIWPDAIAPFQVAILPMNMHKSFRVKEVAERLYDELRAKGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTVVIGDRNLDNNEIEYKYRRSGEKLMISVDEIAAFLQAQIAR"
FT   CDS_pept        complement(575851..576555)
FT                   /codon_start=1
FT                   /gene_family="HOG000225518" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411127"
FT                   /locus_tag="ETAF_0499"
FT                   /protein_id="ADM40623.1"
FT                   /db_xref="InterPro:IPR001378"
FT                   /db_xref="UniParc:UPI0001BD0418"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G4"
FT                   /transl_table=11
FT                   /translation="MSQFQFAPIGVIRSPYKEKFAIPRQPGLICDGGGALELLPPYNQP
FT                   DAVRGLEGFSHLWVIFVFHQTMDGGWRPTVRPPRLGGNARVGVFATRSTFRPNPIGMSL
FT                   VELHGIETRNGVRLQLGSLDLVDGTPVLDIKPYLPFAESQPQARAGFAQQAPPADMPVV
FT                   FSPDAQAQIAQRQRDYPHLARFIRQVLTQDPRPAYRHAEEDDRVYAVHLLDFNLRWQVK
FT                   NGVCDVLGLDPR"
FT   CDS_pept        complement(576552..576974)
FT                   /codon_start=1
FT                   /gene_family="HOG000280809" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411128"
FT                   /gene_name="rcsF"
FT                   /locus_tag="ETAF_0500"
FT                   /protein_id="ADM40624.1"
FT                   /db_xref="UniParc:UPI0000590459"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G5"
FT                   /transl_table=11
FT                   /translation="MRALPLCLLTASLALSGCSLLSRPAAPIKPLAADRTPETVAKPRA
FT                   VTPRQTPITLYESAEDLIGKPFRDLGEVSGSVCQTRPHHSAPSLTTARKRMLYKAAQLK
FT                   ANAVLLHSCQILSQSHGCYRQATCTGSALSIATPAQ"
FT   CDS_pept        complement(577085..577900)
FT                   /codon_start=1
FT                   /gene_family="HOG000222928" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411129"
FT                   /locus_tag="ETAF_0501"
FT                   /protein_id="ADM40625.1"
FT                   /db_xref="InterPro:IPR004478"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniParc:UPI00005B54E5"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G6"
FT                   /transl_table=11
FT                   /translation="MSTKFTSLALVGTLLGTLALAGCGQEEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLNVELVTFNDYVLPNEALNKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLNELQDGAQIAIPNDPTNLGRSLLLLQSVGLIKLKDGIGL
FT                   LPTVLDITENPKHLKLVELEAPQLPRSLDDNQIALAVINTTYASQIGLTPAKDGIFVEG
FT                   KDSPYVNLIVAREDNKDAENVKKFVQAYQSDEVYNAANKIFNGGAVKGW"
FT   CDS_pept        complement(577963..578592)
FT                   /codon_start=1
FT                   /gene_family="HOG000222815" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411517"
FT                   /locus_tag="ETAF_0502"
FT                   /function="transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40626.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniParc:UPI0001BD0419"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G7"
FT                   /transl_table=11
FT                   /translation="MVRGIWETVVMTLVSGFFGFVIGLPVGVLLYTSRPGQILENARLY
FT                   NLLSALVNIFRSIPFIILLVWMIPFTRLIVGTSIGLQAALVPLTIGAAPFIARMVENSL
FT                   LEIPSGLIEAARAMGATPMQIVNKILLPEALPGLINAATITLITLVGYSAMGGAVGAGG
FT                   LGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQFSGDRIVKAISRK"
FT   CDS_pept        complement(578609..579640)
FT                   /codon_start=1
FT                   /gene_id="IGI22411518"
FT                   /locus_tag="ETAF_0503"
FT                   /function="ATP binding"
FT                   /function="D-methionine transmembrane transporter activity "
FT                   /function="amino acid-transporting ATPase activity "
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40627.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0015424"
FT                   /db_xref="GO:0048474"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="UniParc:UPI0001BD041A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G8"
FT                   /transl_table=11
FT                   /translation="MIKLTHITKVFQQGQRRISALDDVSLHVPAGQIYGVIGSSGAGKS
FT                   TLIRCVNLLERPTQGQVFVDGQDLTAMSTGQLTRTRRQIGMIFQHFNLLSSRTVYGNIA
FT                   LPLELDRVPRDEITRRVTELLALVGLADKRDAYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRAILELLKDINRRLGLTILLITHEMDVVKRICDQVAVISQGKLIEQ
FT                   GSVGEVFSHPKTPLAQQFIHATLHLDIPDDFAERMTPTRSADSQPLLRLEFTGQSVDAP
FT                   LISQAVRRFNVDISILSSQMDYAGGVKFGVMLAEVHGDDADAQAAIAFFEQHHVKVEVL
FT                   GYV"
FT   CDS_pept        579832..580395
FT                   /codon_start=1
FT                   /gene_family="HOG000016501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411519"
FT                   /locus_tag="ETAF_0504"
FT                   /function="histidinol-phosphatase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="histidine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40628.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004401"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001BD041B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8G9"
FT                   /transl_table=11
FT                   /translation="MAQQIPAIFLDRDGTMNVDHGYVHDSDDFQFIDGVIDAMRELKAM
FT                   GFALVMVTNQSGIARGMFTEDQFMHLTEWMDWSLADRGVDLDGIYYCPHHPQGSVPEYT
FT                   QACDCRKPQPGMLLEAQRFLNIDMAASYMVGDKREDLQAAQAAGVGTKVLVRSGKPLSA
FT                   EGEALADIVLDSLAQLPQAIKARG"
FT   rRNA            580878..582306
FT                   /gene_name="rrsA"
FT                   /locus_tag="ETAF_3242"
FT   tRNA            582405..582480
FT                   /gene_name="tRNA-Glu"
FT   rRNA            582649..585577
FT                   /gene_name="rrlA"
FT                   /locus_tag="ETAF_3244"
FT   rRNA            585666..585785
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="ETAF_3245"
FT   CDS_pept        complement(585920..587566)
FT                   /codon_start=1
FT                   /gene_family="HOG000289688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411520"
FT                   /locus_tag="ETAF_0505"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40629.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniParc:UPI0001BD041C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8X4"
FT                   /transl_table=11
FT                   /translation="MVRLLRVILPLLSLLWSAALSAAEPRLAPDEAEQARTVTILQQPI
FT                   VMLQAHFGLATPEERVKQAAQDLQNIAPGDLQSPVQITPTQRYGQPVRLFSINGKPLLL
FT                   LAQQDLDVGDDLSLDQAAERIQQRLENLRGALIEQHSTHYLALAALRFAGGTALLFALL
FT                   WLARRVQKRIRSHFDILIMQHRGWVPYRLRSYVGGLERRISAVLLLLGCAIAGYIWLVW
FT                   ALKLFPATRYWGYSLHRYSLAAATQLLQDLIAALPDLLSLAAIAAVALLIQRLLRLLFR
FT                   QVESGRLKLPGLYPDTIKATRRLLSVIIWMFALSMAYPFFPGADTLAFKGVSVFFGLMI
FT                   TLGSAGLVSHAMSGLVLIYSRALHQGDYVRIGEYDGFVDDIGILATKLKTREGFDVTIP
FT                   NAVVASGKIVNLSTHAAHGGIIISTGVTIGYDVPWRQVHAMLLLALQQTEGIQHDLEPT
FT                   IRQNELQDWYVSYELRAEIVAGAAPAQVKSALHGHILDVFNRFGVQIMSPHFVMQPKEA
FT                   IWVSQEKWFSPPAQPPAPSAAEENRGDKAGP"
FT   CDS_pept        complement(587676..589031)
FT                   /codon_start=1
FT                   /gene_family="HOG000270167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411521"
FT                   /locus_tag="ETAF_0506"
FT                   /function="CDP-diacylglycerol-serine O-
FT                   phosphatidyltransferase activity"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="ADM40630.1"
FT                   /db_xref="GO:0003882"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="UniParc:UPI0001BD041D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8X5"
FT                   /transl_table=11
FT                   /translation="MLSKFKRAKHQQHLAQLPKLPQQVGEVETLFSPAAFRQALLEAIG
FT                   QATQRIYLVALYLENDDGGRDVLNALYQAKRQRPQLEIFVLVDWHRAQRGRIGAEASNT
FT                   NADWYCRMASEYPDVIVPIYGVPVNTREALGVLHLKGFIIDDRVIYSGASLNDVYLHRH
FT                   DKYRYDRYHFIQNPRLAGVMCQFVQSTLLSNPAVQRLDRCDRPKNPEIRNETRQFRHAL
FT                   RDSGYQVPAEAGNEELAVTPLAGLGKQNILNKTIHHLICSTERTLTLCTPYFNLPAPLV
FT                   RDIIFLLRQGKQVEIIVGDKKANDFFIPEEEPFKIIGALPYLYEINLRRFISRLQPYLD
FT                   NGQLTVRLWRDDDNTYHLKGMWVDDRWQLITGNNLNPRAWRLDLENAILIHDPRGEIQH
FT                   QRQHELECIRRHTQVVRSYEDLETLQQYPLKVRKLIRRLRRIRVDRLISRIL"
FT   CDS_pept        complement(589166..591838)
FT                   /codon_start=1
FT                   /gene_family="HOG000220090" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411522"
FT                   /locus_tag="ETAF_0507"
FT                   /function="ATP binding"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ADM40631.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001BD041E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8X6"
FT                   /transl_table=11
FT                   /translation="MSQRSLESLLRPKSIAVIGASNQPSRSGHLVMLNLLNGGFPGPIM
FT                   PVTPRYQAVCGVLAYPTIADLPCVPDLAILCTNAQRTPALIAELGAKGCRAAIVIAAPA
FT                   SQADALRSLALRHGVRLLGPNSLGLLAPWQKLNASFSPVPILPGRLAFISQSAAVSNTI
FT                   LDWARQREIGFSLFVALGDSLDTDVDDLLDYLARDAKTSAILLYLEHLHDARRFLSAAR
FT                   SAARNKPILVIKSGRSPQARRVLGEAAGLDIAYDAAIQRAGLLRVQNTHELFSAVETLS
FT                   HMHPLRGERLLIVGNGAAPLAMALDELQRRGGHPAPCDDALHSALCTALPAETYLQGPI
FT                   DLRDDATPARYQATLQHLLDSRCYDALLIQHAPSATAPATETARALIETLSAHPRARHV
FT                   TLMTNWSGENTSQEARRLFSEAGIPTYRTPEGAVTAFMHMVEYRRNQRQLMETPALPAS
FT                   LPANAALAHRLLAQAQADGVTRLDTHEVRDILACYGLDTLPSWIANDSTEAVHIAERIG
FT                   YPVALKLRSPDIAHNSDVQGVMLYLRNAREVEQAANAIFDRARQAYPQARILGLLVQST
FT                   ANRIGAQELRICVENDAVFGPLILLGEGGAEWDAQRDAAAALPPLNMNLARYLIVQAQK
FT                   RGHIRRRAPLADLDIAGLSQVLVQVSHLIVDCPTIQRLEIHPLLACGSTFTLLDVSLQL
FT                   LDRHAAPTRLAICPYPHQLKESIRLKNGGDALLRPILPEDEPLLQQFIQRVSKEDLYYR
FT                   YFSEINEFTHEDLAKMTQIDYEREMAFVAVQSTPQGEEILGVTRALIDPDNTDAEFAVL
FT                   VRSDRHGLGLGSILLDKLIRYARQRQLRRLLGITMPTNRGMIALARKIGFQVEILLEDG
FT                   IVNLSLSLSDSTLPDSEKC"
FT   CDS_pept        complement(591912..592601)
FT                   /codon_start=1
FT                   /gene_family="HOG000278320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411523"
FT                   /locus_tag="ETAF_0508"
FT                   /protein_id="ADM40632.1"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="UniParc:UPI0001E354FB"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8X7"
FT                   /transl_table=11
FT                   /translation="MSANAVLRLRAARLSQSTRPFHARGCRVQRCQRCLLPQIHCLCDT
FT                   LASYPAHSRFCLMMYDTEPLKPSNTGRLIADVLPDTLAYGWSRTQPDPQLLQLLDDPAY
FT                   QPYVVFPGSYAEPERVVTEVRCDDRRPLFIMLDGTWPEARKMFRKSPYLDRFPVFSINM
FT                   AQAPGYLLREAHRPEQYCTAEVAAALLALADDRQASQGLLQHFHHFRQQYLLGKSHPQV
FT                   PVAAAVE"
FT   CDS_pept        complement(592700..593131)
FT                   /codon_start=1
FT                   /gene_family="HOG000292979" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411524"
FT                   /locus_tag="ETAF_0509"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /function="protein-disulfide reductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40633.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0047134"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI0001BD0420"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8X8"
FT                   /transl_table=11
FT                   /translation="MNTVCPACHTTNRIPDDRRSEQATCGRCSHALFDGAIVNASEETL
FT                   DKLLQDDLPVLIDFWAPWCGPCQGFAPVFAAVAAARAGEVRCIKVNTEDQPALSSRFRI
FT                   RSIPTIMLYRNGQRVDMLNGAMPQAPFEAWLDEQLAKQA"
FT   CDS_pept        593338..594519
FT                   /codon_start=1
FT                   /gene_family="HOG000218800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411525"
FT                   /gene_name="yfiF"
FT                   /locus_tag="ETAF_0510"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ADM40634.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="UniParc:UPI0001BD0421"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8X9"
FT                   /transl_table=11
FT                   /translation="MSDSLNGKNGKVKVMYVRDSDAADERQSRAPAKGRPGARGDRSRS
FT                   DRNDRGDRSRSDRNDRGDRSRSDRNDRGDRSRSDRNDRGDRSRSDRSDRGDRAARPARS
FT                   EQGVGERSPWRTVSLGDNGGVGGESDHGGISGKSFIDPEQLRRQRAEETRVYGENACQA
FT                   LFASRPEAIVRAWFLQAVTPRFREALRWMAANRKAYHVVDDAELTKASGTDHHGGVCFL
FT                   IKKRRSLDAQQYLANQAEDAVDCVLALENVANPHNLGGIMRTCAHFGIRGIIAPESAAL
FT                   ESGAAVRTAEGGAEHVQAIDAEDFSAALDTFRRAGYTIVTTSSHKGTTQLHRATLPAKI
FT                   VLVVGHEGDGLSDGTLQQGDLSVSIGGTGSVESLNVSVATGIMLAEWWRQNAR"
FT   CDS_pept        complement(594593..595309)
FT                   /codon_start=1
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411526"
FT                   /gene_name="arcA"
FT                   /locus_tag="ETAF_0511"
FT                   /function="DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40635.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001A5A071"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y0"
FT                   /transl_table=11
FT                   /translation="MQTPHILIVEDELVTRNTLKSIFEAEGYIVHEANDGAEMHQILSE
FT                   FDINLVIMDINLPGKNGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRTMNLGSGTEERKSVEHYRFNGWELDINSRSLVSPDGEQYKLPR
FT                   SEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEII
FT                   ATIHGEGYRFCGDLEE"
FT   CDS_pept        595958..596665
FT                   /codon_start=1
FT                   /gene_family="HOG000229629" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411527"
FT                   /locus_tag="ETAF_0512"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ADM40636.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="UniParc:UPI0001BD0423"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y1"
FT                   /transl_table=11
FT                   /translation="MQIHIVLVAPARAENVGAAARAMKTMGFTSLRIVDSKADGEPAAR
FT                   WVAHGAGDILDGARHFDTLAQALADVDFSVASTARSRARFHYYCTPQELCAVLQEKQRW
FT                   MASCALVFGREDSGLTNDELALVDLLTGVPMAADYPSLNLGQAVMVFCYQLSSLMQVQA
FT                   AQAPAAQGEQLAALRARTDRLLTTLGVDGDTKLSDWLDQRIGLLAQRDTAMLHRLLHDI
FT                   ESALETSASGKKM"
FT   CDS_pept        597140..599497
FT                   /codon_start=1
FT                   /gene_family="HOG000271593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411528"
FT                   /locus_tag="ETAF_0513"
FT                   /function="NADP or NADPH binding"
FT                   /function="amino acid binding"
FT                   /function="aspartate kinase activity"
FT                   /function="homoserine dehydrogenase activity"
FT                   /biological_process="aspartate family amino acid
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40637.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0004412"
FT                   /db_xref="GO:0009067"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="UniParc:UPI0001E354FC"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y2"
FT                   /transl_table=11
FT                   /translation="MLSAPARITNHLVALIERTIAGQDIQPILGDAEKIFTDLIDGLAQ
FT                   AQPGFDAAPLRLRVSQEFGQIRQVLHGIALLGQCPDSVNAALICRGEALSIAIMAALLR
FT                   ARGRQVTVIDPVSSLLARGGYLESSVDIAESARRIAAQAIPADSLILMAGFTAGNERGE
FT                   LVVLGRNGSDYSAAVLAACLRAACCEIWTDVDGVYTCDPRLVPDARLLESMSYQEAMEL
FT                   SYFGAKVLHPRTISPIAQFQIPCLIKNTANPQAPGTLIGAQRRGDDALPVKGITHLNHM
FT                   AMLNVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISFCVPQGELARACQAL
FT                   QDEFFLELKDGLLEPLDVIEHLAIISVVGDGMRTQRGISAKFFSALARANINIVAIAQG
FT                   SSERSISVVVNNDAATTAVRVTHQMLFNTDQVIEVFVIGVGGVGGALLAQIERQQAWLK
FT                   SKHIDLRVCGIANSRALLTHVHGIDMANWRGALEQASQPFNLGRLMRLVNEYHLLNPVI
FT                   VDCTSSQALADQYADFLGNGFHVVTPNKKANTASLDYYRLLRQKAAGSQRKFLYDTNVG
FT                   AGLPVIENLQNLLSAGDELQRFCGILSGSLSFIFGRLEEGATFSQATREARQLGYTEPD
FT                   PRDDLSGMDVARKLLILAREAGYALELDDICVEPVLPAAFDARGDVDTFLANLAQADDA
FT                   FSARVAAAQARGCVLRYVGEIDQGRCSVRIAEVDSDDALYKVKNGENALTFYSRYYQPL
FT                   PMVLRGYGAGNDVTAAGVFADLLRTLSWKLGV"
FT   CDS_pept        599502..600428
FT                   /codon_start=1
FT                   /gene_family="HOG000247198" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411529"
FT                   /gene_name="thrB"
FT                   /locus_tag="ETAF_0514"
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40638.1"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001BD0426"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y3"
FT                   /transl_table=11
FT                   /translation="MKIYAPASIGNVSVGFDVLGAAVTPLDGTLLGDCVSVEASDRFAL
FT                   HCRGRFVDSLPAAAQENIVYQCWQRFCEVTGRELAVEMVLEKNMPIGSGLGSSACSVVA
FT                   ALAALNRFAGDPLDAQRLLTLMGELEGRISGSVHYDNVAPCYLGGLQLMLEAQGIISQP
FT                   VPCFDDWLWVMAYPGIKVSTAEARAILPLHYSRGDCVRHGRHLAGFIHACHTRQPSLAA
FT                   ALMQDVIAEPYRCGLLPGFADARRAAGELGTLACGISGSGPTLFAVCDDPAAAQAVAQW
FT                   LTQHYLQNEQGFVHICRLDTAGARQLG"
FT   CDS_pept        600432..601718
FT                   /codon_start=1
FT                   /gene_family="HOG000230743" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411530"
FT                   /locus_tag="ETAF_0515"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="threonine synthase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /protein_id="ADM40639.1"
FT                   /db_xref="GO:0004795"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniParc:UPI0001BD0427"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y4"
FT                   /transl_table=11
FT                   /translation="MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHALPALARAQIDA
FT                   LLEQDFVTRSAHILAAYLGDEFPFETLRDRVQAAFDFPAPVVPVSDDIAALELFHGPTL
FT                   AFKDFGGRFMAQMLQQVAGERPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVS
FT                   PLQEKLFCTLGGNIRTLAIEGDFDACQALVKQAFDDPTLCRELGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQAARNQLVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPR
FT                   FLSSGVWQPHETVATLSNAMDVSRPNNWPRVEELFRRREWSLGALGSGALSDAQTAAAM
FT                   RELAALGYVSEPHAAIAYRALRDDLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQA
FT                   LAARAALPLLSQTLPADFSRLRAALLDRP"
FT   CDS_pept        complement(601776..602573)
FT                   /codon_start=1
FT                   /gene_family="HOG000218488" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411531"
FT                   /gene_name="yaaA"
FT                   /locus_tag="ETAF_0516"
FT                   /protein_id="ADM40640.1"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniParc:UPI0001BD0428"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y5"
FT                   /transl_table=11
FT                   /translation="MLTIISPAKTLDYTSPLATQRYTQPQMLAQAETLMQTVRTLTPAQ
FT                   LGSLMKISDKLAGLNAARFTEWQPRFTPENARQAILAFKGDVYTGLQAETFSEQDFDFA
FT                   QRHLCMLSGLYGVLRPLDLMMPYRLEMGTRLHTPYGNDLYAFWGDSITRQLNQQLQQQG
FT                   DRVVVNLASDEYFKAVRPAALEGELIKPIFMDEKNGSMKVISFYAKKARGLMSRFIIQA
FT                   RLRDPEQLKAFDLEGYAFAGETQGRQGRELLFTRRHSAISPAR"
FT   CDS_pept        complement(602685..604118)
FT                   /codon_start=1
FT                   /gene_family="HOG000255107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411532"
FT                   /locus_tag="ETAF_0517"
FT                   /function="sodium:amino acid symporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40641.1"
FT                   /db_xref="GO:0005283"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniParc:UPI0001BD0429"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y6"
FT                   /transl_table=11
FT                   /translation="MTDLISFINNILWGSVLIYLLIGAGLYFTFRTGFIQFRHFGHMFS
FT                   VLKNSNKADSGGISSFQALCTSLAARVGTGNLTGVAIALTAGGPGAIFWMWIIALIGMA
FT                   TSFIESTLAQLYKTRDDQGNFRGGPAYYMEKGLGMRWMGILFSLFLLVAFGLVFNAVQA
FT                   NSIAQATAVAFHIPPLYVGIALMLMCGVVIFGGLRSIARTAELVVPVMAIAYLLLAFWV
FT                   MGHNLARMPEVLLLVIKSAFGLQEAAAGAIGYGISQAMTQGIQRGLFSNEAGMGSAPNA
FT                   AASATPYPPHPASQGYVQMLGVFMDTLVICSATAAIILSSGVLDAAPGTISGIELTQRA
FT                   LSSAVGDWGGIFIAVAIFFFAFTSIIANYAYAESNLIFLEHNHPHGLVFLRLCTLGMVM
FT                   FGALAELPLVWKMADLSMALMAITNLIAILLLSGVAFKLARDYNHQRRLGLLPTLDLSK
FT                   YPEIQQQVEPGIWEKPPRQ"
FT   CDS_pept        604549..605502
FT                   /codon_start=1
FT                   /gene_family="HOG000281234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411533"
FT                   /gene_name="tal"
FT                   /locus_tag="ETAF_0518"
FT                   /function="transaldolase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40642.1"
FT                   /db_xref="GO:0004801"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniParc:UPI0001BD042A"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y7"
FT                   /transl_table=11
FT                   /translation="MTDKLTSLRQLTTVVADTGDIAAMKQYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAITWARAQSGDRAQQIVDASDKLAVNIGLEILKLIPGRISTEVDARLSYD
FT                   TEASVAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAERLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWHKANGDKSEFAPAEDPGVISVTEIYNYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTISPSLLKTLSESTGSVERKLAYQGEVKARPARMSEAEF
FT                   YWQHNQDPMAVEKLADGIRKFAVDQGKLESMIGALL"
FT   CDS_pept        605632..607083
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411534"
FT                   /locus_tag="ETAF_0519"
FT                   /function="succinate-semialdehyde dehydrogenase [NAD(P)+]
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ADM40643.1"
FT                   /db_xref="GO:0009013"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0001BD042B"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y8"
FT                   /transl_table=11
FT                   /translation="MMQLHDMGLFRQQALIDGVWCDADSGDVMTVINPASGDTLGSVPK
FT                   MGAAETRRAIEAAAHALPGWRARTGKARAQILRRWFDLILAHQEDLARLMTLEQGKPLA
FT                   ESRGEIAYAASFIEWFAEEAKRVYGDTIPAPQGDKRLLVIKQPIGVTAAITPWNFPAAM
FT                   ITRKAGPALAAGCTMVLKPASQTPYSALALAELALRAGVPQGVFSVVTGSAGAVGNELT
FT                   ANPLVRKLSFTGSTEIGRQLMAQCAHDIKKVSLELGGNAPFIVFDDADLDQAVAGAMAS
FT                   KFRNAGQTCVCANRLYVQEGIYERFAEKLCSAVQALKVGNGLDDGVTVGPLIDSRARAK
FT                   VEAHIADAVARGARIACGGQADARGENFFCPTVLLDVPADAQVAREETFGPLAPLFRFR
FT                   DEDEVIARANATEFGLASYFYTRDVGRVFRVAEALEYGIVGINSGLISNEMAPFGGVKS
FT                   SGLGREGAKYGIEDYLEIKYLCLGL"
FT   CDS_pept        607254..607910
FT                   /codon_start=1
FT                   /gene_family="HOG000156621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411535"
FT                   /locus_tag="ETAF_0520"
FT                   /function="hydrolase activity"
FT                   /protein_id="ADM40644.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001BD042C"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Y9"
FT                   /transl_table=11
FT                   /translation="MWRKHFAAIFLDMDGALLDSDDHAEQVWEQWAHQRQIDHALLRPR
FT                   IYSQRVQETLRQLAPRYSDDAECQRLEQALLAAVRQRRSRLRQDAAAWLAMLGETPWGV
FT                   VTQAGQPRAAEQIAHSGMCPPPLVIGAEQVSCGRPDPEPYLLAASHYGLDPRDCLVIES
FT                   DEAGIRAAQAAGMTVIALSYRRPRHSLQRADVVIGGWRSIILHPQPEGIVVEVIA"
FT   CDS_pept        607907..608494
FT                   /codon_start=1
FT                   /gene_family="HOG000281103" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411536"
FT                   /gene_name="mogA"
FT                   /locus_tag="ETAF_0521"
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="ADM40645.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniParc:UPI0001BD042D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Z0"
FT                   /transl_table=11
FT                   /translation="MNTLRIGLVSISDRASSGVYQDLGIPALEAWLASALATPYTLETR
FT                   LIPDEQPLIEQTLCELVDERGCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALIINLPGQPKSIRETLEGLKDASGAPLVHGIFASVP
FT                   YCIQLLEGPYVETHSAVIAAFRPKSAQRETIN"
FT   CDS_pept        608616..609926
FT                   /codon_start=1
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411537"
FT                   /gene_name="proP"
FT                   /locus_tag="ETAF_0522"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ADM40646.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001BD042E"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Z1"
FT                   /transl_table=11
FT                   /translation="MELHNHRRLNHQDYKTLALAALGGALEFYDFIIFVFFAAVVGALF
FT                   FPPDMPEWLRLVQTFGIFAAGYLARPLGGIIMAHFGDRVGRKRMFSLSILLMALPTLVM
FT                   GMLPTYQSIGIAAPLLLLLMRVLQGAAIGGEVPGAWVFVAEHVPPQRIGFACGILTSGL
FT                   TSGILLGSLVATWLNSWLTPQEVLAGGWRIPFFLGGLFGLMAMYLRRWLHETPVFLAMQ
FT                   ARRALAAELPLKQVVRDHRRAVAVSMLLTWLLSACIVVVILMTPSLLQTQYGLPAALTL
FT                   QANSVAIVTMSLGCVLAGGLVDRVGAGRLFIGGGLLLALCTWQFFSSLSPQIEPAQLFW
FT                   RYGLAGFSIGTIGAVPFVMVCAFPAEVRFSGISFSYNLAYAVFGGLTPIAVTLLLTLTP
FT                   LAAGGYVLALSLLGVALGFYFQRAPLRAAQGEARLSR"
FT   CDS_pept        complement(610011..610514)
FT                   /codon_start=1
FT                   /gene_family="HOG000224166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411538"
FT                   /locus_tag="ETAF_0523"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADM40647.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI0001BD042F"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Z2"
FT                   /transl_table=11
FT                   /translation="MLNLHNAGLFPLTSVILAMGIFFGGIAQILAGLLEYKKGNTFGLT
FT                   AFTAYGSFWLTLVALLTLPKMGLAEATDALSLGAYLALWGIFTLFMFFGTLRSNRVLQF
FT                   VFASLTVLFFLLAYGNITANAAVLHIAGIEGIICGASAIYLAMAEVINEQYGRDVLPIG
FT                   AKHA"
FT   CDS_pept        610897..612804
FT                   /codon_start=1
FT                   /gene_family="HOG000228136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411539"
FT                   /gene_name="dnaK"
FT                   /locus_tag="ETAF_0524"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to stress"
FT                   /protein_id="ADM40648.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI0001BD0430"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Z3"
FT                   /transl_table=11
FT                   /translation="MGKIIGIDLGTTNSCVAVMDGGKARVLENAEGDRTTPSIIAYTQD
FT                   GEVLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDAEAQRDKDIMPYQIVAADNGDAWVE
FT                   VKGQKIAPPQISAEVLKKMKKTAEDFLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   DVKRIINEPTAAALAYGMDKGVGNRTIAVYDLGGGTFDISIIEIDDVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVDEFKKEQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVARSMEPLKVALKDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKQVADFFGKEPRKDVNPDEAVAIGAAVQGGVLAGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGIQPAPRGMPQIEVTFDIDADGILHVSAKDKNSGREQNITIKASSGLSEDEIKQMVR
FT                   DAEANAEADRKFEELVQVRNQADQLVHGTRKLVEEAGDKLPATDKSAIEDAVKALEAAS
FT                   KGEDKADIEAKIQALVQSSAKLQELAQQQAQAGEAQADTSAKKDDDVVDAEFEEVKDKK
FT                   "
FT   CDS_pept        612915..614051
FT                   /codon_start=1
FT                   /gene_family="HOG000226717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411540"
FT                   /gene_name="dnaJ"
FT                   /locus_tag="ETAF_0525"
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="metal ion binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="DNA replication"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ADM40649.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0001BD0431"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Z4"
FT                   /transl_table=11
FT                   /translation="MAKKDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAED
FT                   KFKEIKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGAGGFGGGADFSDIFGDVFGDI
FT                   FGGGRRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLVECDVCHGSGAKKGSEPITC
FT                   PTCHGAGQVQMRQGFFTVQQPCPHCHGRGTIIKDPCNKCHGHGRIEKSKTLSVKIPAGV
FT                   DTGDRIRLAGEGEAGENGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGE
FT                   IEVPTLDGRVKLKIPAETQTGKMFRMRGRGVKSVRGGAQGDLLCRVVVETPVNLNDKQK
FT                   QLLRELEESFGGPASDKNSPRSKRFFDGVKKFFDDLTR"
FT   CDS_pept        614299..615477
FT                   /codon_start=1
FT                   /gene_family="HOG000218489" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411541"
FT                   /gene_name="nhaA"
FT                   /locus_tag="ETAF_0526"
FT                   /function="antiporter activity"
FT                   /function="sodium ion transmembrane transporter activity "
FT                   /biological_process="regulation of pH"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ADM40650.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006885"
FT                   /db_xref="GO:0015081"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniParc:UPI0001BD0432"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Z5"
FT                   /transl_table=11
FT                   /translation="MIKSLQRFVGSDAFGGVILIIAAALAMILANTDWTSHIYQAFLNT
FT                   PVEVRVGSLHINKNMLLWVNDALMAIFFLMIGLEVKRELVCGSLASARQAAFPVIAALG
FT                   GMVVPALIYLLFNGQDAVASTGWAIPAATDIAFALGVLALLGNRVPLALKVFLLALAII
FT                   DDLGAIIIIALFYTSDLSILSLAVAGAAIVALALLNLFNVRRVGLYILVGVVLWTAVLK
FT                   SGVHATLAGVVIGFFVPLKEQDGKSPARSLEHALHPWVAYMILPLFAFANAGVSLDGVT
FT                   LSGLFSLLPLGVIAGLFIGKPLGISLFCWLAVKLKLATLPQGTTFKEIIAIGVLCGIGF
FT                   TMSIFIASLAFGDADPALAVFSRLGILLGSSLAAIVGYLLLRRVLPAQKAAA"
FT   CDS_pept        615693..616595
FT                   /codon_start=1
FT                   /gene_family="HOG000233515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411542"
FT                   /gene_name="nhaR"
FT                   /locus_tag="ETAF_0527"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ADM40651.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001A5A084"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Z6"
FT                   /transl_table=11
FT                   /translation="MRLSHINFNHLYYFWQVCKEGSVVGAAEALFLTPQTITGQIKALE
FT                   ERLGGKLFKRQGRGLVPSELGQLVFRYADRMFMLSQEMLDIVNYRKESSMLFDVGVADA
FT                   LSKRLVSQVLETAVADHEQIHLRCFESTHELLLEQLSQHKLDMILSDCPVDSSQQEGLF
FT                   SVKLGECGVSFFCRQPLPEMPFPTCLEQRKLLIPGRRSMLGRKLLNWFNSQGLQVQILG
FT                   EFDDAALMKAFGLYHDAIFVAPSIYAQDMYANVQDNIREVGRIDNVQEEYYVIFAERMI
FT                   QHPAVQRVCNKDFSALFSR"
FT   CDS_pept        complement(616665..616928)
FT                   /codon_start=1
FT                   /gene_family="HOG000097048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411543"
FT                   /gene_name="rpsT"
FT                   /locus_tag="ETAF_0528"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ADM40652.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="UniParc:UPI0001E3550D"
FT                   /db_xref="UniProtKB/TrEMBL:E0T8Z7"
FT                   /transl_table=11
FT                   /translation="MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVYAAIATGDKA
FT                   AAQAAYNDMQPIVDRQANKGLIHKNKAARHKANLTAQINAMQ"
FT   CDS_pept        617340..618302
FT                   /codon_start=1
FT                   /gene_family="HOG000006845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22411544"
FT                   /locus_tag="ETAF_0529"
FT                   /function="FMN adenylyltransferase activity"
FT                   /function="riboflavin kinase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="