(data stored in ACNUC7421 zone)

HOGENOMDNA: EDWTF_2

ID   EDWTF_2; SV 1; circular; genomic DNA; GRV; PRO; 44194 BP.
XX
AC   CP002155_GR;
XX
DT   23-NOV-2010 (Rel. 127, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 2)
XX
DE   Edwardsiella tarda (strain FL6-60) plasmid pFL6-60, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Edwardsiella tarda (strain FL6-60)
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Edwardsiella.
OG   Plasmid pFL6-60
XX
RN   [1]
RA   van Soest J.J., Henkel C.V., Jansen H.J., van den Hondel C.A.M.J.J.,
RA   Bloemberg G.V., Meijer A.H., Spaink H.P.
RT   "Genome comparisons of Edwardsiella bacteria analysed using deep
RT   sequencing technology.";
RL   Submitted (AUG-2010) to the EMBL/GenBank/DDBJ databases.
XX
CC   This Genome Reviews entry was created from entry CP002155.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..44194
FT                   /organism="Edwardsiella tarda"
FT                   /strain="FL6-60"
FT                   /mol_type="genomic DNA"
FT                   /plasmid="Plasmid pFL6-60"
FT                   /db_xref="taxon:718251"
FT   CDS_pept        join(43992..44194,1..1813)
FT                   /codon_start=1
FT                   /gene_family="HOG000127786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22661853"
FT                   /locus_tag="ETAF_ple001"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ADM43318.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018774"
FT                   /db_xref="UniParc:UPI0001E35478"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAQ9"
FT                   /transl_table=11
FT                   /translation="MSPKGMAALGAGRGSNWYSMKASAEDTADISIYEEIGGWGISARQ
FT                   FAEELTALGQVNHINLHIHSPGGDVFDGIAIYNLLKNHPASKTVYIDGLAASMASVIAM
FT                   VGDPIIMPENAMMMIHKPWGVAGGDANEMRDYADLLDKVESVLIPAYAEKTGKTADEIA
FT                   ALLEQETWLSGVECVEQGFADKTIKPVKAMACIQSKRVEEFEHMPKSIRNLINPQANAG
FT                   RQPTHQEPAAPAGNLDVNAIRAQVQEEQRQRVTGIQDLFAMFGNRHADLMAQCVSDVDC
FT                   SVDQAKDKLLAELGKGATPTNQLNGTQNRTNSHIYAGNGNFTGDGIRAALMAQSGYEEG
FT                   QRDNPYAGMTLREMARMSLTERGIGIAGYNPMQMVGLAFTHSSSDFGNILLDVANKSIL
FT                   QGWEDAGETFEQWTKKGQLSDFKVAHRVGLGGFSSLRQVREGAEYKYVTTGDSQATIAL
FT                   ATYGELFSITRQAIINDDLNMLTDVPMKLGRAAKATIADLVYAVLTKNPKMSTDGVVLF
FT                   DSAKHHNVLSSAAMDVPSLDKGRQLMRTQKEGDRHLNIRPAFVLVPTAMEANANQVIKS
FT                   ASVKGADVNSGVINPIQNFATVIAEPRLDAASVSTYYLAAAKGSDTIEVAYLNGVDAPY
FT                   IDQLDGFDVDGVTTKVRIDAGVSPLDHRGLVRCSAS"
FT   CDS_pept        1879..2202
FT                   /codon_start=1
FT                   /gene_family="HOG000127797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670085"
FT                   /locus_tag="ETAF_ple002"
FT                   /protein_id="ADM43319.1"
FT                   /db_xref="InterPro:IPR011231"
FT                   /db_xref="UniParc:UPI0001E35479"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR0"
FT                   /transl_table=11
FT                   /translation="MAKNFVQEGKTIQFTAAKDAESGALVQVGDVMAVSLSDVAAQAQG
FT                   VGMAEGVFLLPKLRTDDMATGKKVYLKSDKVQLANSASEPYVGVVWEAAGTSDDFVPVK
FT                   INA"
FT   CDS_pept        2195..2476
FT                   /codon_start=1
FT                   /gene_family="HOG000127798" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670086"
FT                   /locus_tag="ETAF_ple003"
FT                   /protein_id="ADM43320.1"
FT                   /db_xref="UniParc:UPI0001E3547A"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR1"
FT                   /transl_table=11
FT                   /translation="MPNPFDELAGRMDATISLRFGKPAEINGASVTVVPSSLSAILGPV
FT                   EASVLTLIVFSPSYRPHRGDDVRWNKKAYTVSKFHQQNGKWVIQLEIG"
FT   CDS_pept        2488..3066
FT                   /codon_start=1
FT                   /gene_family="HOG000119464" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670087"
FT                   /locus_tag="ETAF_ple004"
FT                   /protein_id="ADM43321.1"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniParc:UPI0001E3547B"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR2"
FT                   /transl_table=11
FT                   /translation="MALVKGMDRLEAVLRDLSDKAVPAAVRRASRKVAEAAMLRAAERV
FT                   ASKEKLPIDKVKRRMRLYTPRGGIAAYSKITVYRSAMPVINRGSPQLILGPRGRGHTGW
FT                   RGSVLTAGGRSYPGSFLVYIPKYRHWQIMHRTAAAIAAKQRLMIDATREDMSGVLTQAF
FT                   EMEKDNILSEMEDELGKQLTSQLKREMKR"
FT   CDS_pept        3063..3476
FT                   /codon_start=1
FT                   /gene_family="HOG000119465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670088"
FT                   /locus_tag="ETAF_ple005"
FT                   /protein_id="ADM43322.1"
FT                   /db_xref="InterPro:IPR009312"
FT                   /db_xref="UniParc:UPI0001E3547C"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR3"
FT                   /transl_table=11
FT                   /translation="MSATEIRKALVDEFRRVLKDEPEEVAIFNGLPAFVDGEEELPAVS
FT                   VHLSDIADDDEFLDDPKWRAVLHVAVFVKSSAPDSTLDHWASRLVFPVVPNCRELLRLC
FT                   SSIELVGCTYDRSDVAATWAAIDVKYNITFEWE"
FT   CDS_pept        3478..4248
FT                   /codon_start=1
FT                   /gene_family="HOG000119486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670089"
FT                   /locus_tag="ETAF_ple006"
FT                   /protein_id="ADM43323.1"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniParc:UPI0001E3547D"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR4"
FT                   /transl_table=11
FT                   /translation="MADPLKNEPIKGAKTTFWYYIGRGVGTPQSPEPDWRRLGKVKSLK
FT                   PGEMKADTEDDSYLDDPDADWKQSSPGQKSVSEASVTLAWMPGDPGQQALMDAFMLGKT
FT                   LAFRIKYPNDTADFFTGFITNLGKEINSKDVITRDIKIQPSGKPISAEGLIPALTGIKI
FT                   STGQSADGTAVALTGSQGKWTGSAPVSKGRISLTIEPIPAGAAIPALSVVSSAPDKALI
FT                   PDATAPDIVPLMAGEAAITISGGGFTDKLTLTLS"
FT   CDS_pept        4301..4699
FT                   /codon_start=1
FT                   /gene_family="HOG000119497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670090"
FT                   /locus_tag="ETAF_ple007"
FT                   /protein_id="ADM43324.1"
FT                   /db_xref="InterPro:IPR010027"
FT                   /db_xref="UniParc:UPI0001E3547E"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR5"
FT                   /transl_table=11
FT                   /translation="MFLKKEKFTHCEHSVELRELSALQRIEYMEYAAANQINDDGEIEP
FT                   MKYISALNRMDIKLNAMLVAMATVSPEKMEDPTEMQVLQHSIMRAWPSDALGKAGKLVM
FT                   ALSGMLPPEPAPGESPDGTLGEHDAGKF"
FT   CDS_pept        4708..5034
FT                   /codon_start=1
FT                   /gene_family="HOG000119508" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670091"
FT                   /locus_tag="ETAF_ple008"
FT                   /protein_id="ADM43325.1"
FT                   /db_xref="InterPro:IPR009350"
FT                   /db_xref="UniParc:UPI0001E3547F"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR6"
FT                   /transl_table=11
FT                   /translation="MAFVLGLAREFRRADWRRWLSSMSCTEFKAWADYYATRPFFVDLV
FT                   DCEFASLKLNQFLLAGGKSDEVSMQDFCLITAGDEALEPEEDMGDDQIMAAATFIPGGV
FT                   RFGQ"
FT   CDS_pept        5024..7840
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670092"
FT                   /locus_tag="ETAF_ple009"
FT                   /protein_id="ADM43326.1"
FT                   /db_xref="InterPro:IPR006431"
FT                   /db_xref="InterPro:IPR009628"
FT                   /db_xref="UniParc:UPI0001E35480"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR7"
FT                   /transl_table=11
FT                   /translation="MASETDLEIFIGANTAQFRESMQKARDDIQIVNEEVRSAAAATED
FT                   GADKFTAAQVRATQRLLRSIDPTLRSMDALEVKQRKVEQSLRDGKISTEEYSRAMQILS
FT                   RDLEQTQAKERLHAAAFGQATAAMQRQDQMLKKMNISVGQYRSAVGMLPAQMTDVVTQL
FT                   AGGQNPLLILLQQGGQIKDSFGGIKNTFLALSSVISPAALGVVALSGGIGGLAYALYKA
FT                   EQEQQAFNRSLIMTGNYAGKTTGELQALARAMSGDGLSQRDMASALAQTVGTGVFSGAT
FT                   VGIVASAAARLENATGASIDSTIEQFKRLQKDPVSAVKELDGQLHFLTATQLEQINALA
FT                   SLGREQDAAKIAMEAYAHTVNTRAEEMKNNLGLLERAWRGVKTAIGETADAAMDFGRKS
FT                   TPEDSIAVLESELKRLKAQPQSIVGNRDAVANVSNKLAVLKQAQVLQSDISGVAKDTTA
FT                   ANEARKKQVEATEKLNREYENEADRHNRALAKIRNSGASKDAIERAINAENERYAKSQS
FT                   RGSHGTQQGESLADRYSQRLAQTREALQLEQAGAQTLTQSERDLIALRQRLDDLKGRSL
FT                   TKTEQSVVANAAILEKLLSQNVAEEKALEQQKALNEMKRKGAQLSMQMEQEAQRDSRTR
FT                   SFELQGFRMGDLARERARQEMALRDHYDQVMGELERSATQKGTKGSAEYSDAVRMLQES
FT                   LEQRLQALRGYYSAVDAERARWDIGVSRSMQNIKEAGDDAAGAAGEALTGAFNSAADSL
FT                   ANFVSSGKANFRSLTTSILSDLARIAARMALSKAVGGLFSMFGGAAASGVNAFSSGEYG
FT                   NLPLVANASGGVYRSSDLSAYSGQVVSQPTFFAFARGAGLMGEAGPEAIMPLTRDSKGR
FT                   LAVTAVGAGAHGSVFSPNYNVVIQNDGKNGEIGPGALKAVYDLGQKAAADFLRQQGRDG
FT                   GHLSGAYR"
FT   CDS_pept        7840..8169
FT                   /codon_start=1
FT                   /gene_family="HOG000119530" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670093"
FT                   /locus_tag="ETAF_ple010"
FT                   /protein_id="ADM43327.1"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniParc:UPI0001E35481"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR8"
FT                   /transl_table=11
FT                   /translation="METFRWQVRPDMVVESEPRVHVVKFGEGYEQRRSSGLNGDLKSYE
FT                   VTIKVSRDDAHALEAFLSRHGGVSAFLWTPPYVHRQIRVVCRKWASRVEMLNTVFTATF
FT                   NQVIS"
FT   CDS_pept        8185..8883
FT                   /codon_start=1
FT                   /gene_family="HOG000119541" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670094"
FT                   /locus_tag="ETAF_ple011"
FT                   /protein_id="ADM43328.1"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniParc:UPI0001E35482"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAR9"
FT                   /transl_table=11
FT                   /translation="MRNIPQETRNETTKTEQGARIDLWEFDLSSIGGDRYFFCNELNHN
FT                   GEPVTWQGRQYQPYPIQCSGIEIKGKGATNRPSLAVSNLFGLVTGMAEDLQSLVGASVV
FT                   RRQVYSRFLDAENFPDGNLEADPEQEAVVRYVVEQLAELTAETATFVLSLPTETDGAVF
FT                   PGRIMLAEVCAWRYRSDECGYSGPPVADVFDSPTVDPSLDQCSRCPRGCKMRSNIDSFG
FT                   GYLSINKLSQ"
FT   CDS_pept        8962..9291
FT                   /codon_start=1
FT                   /gene_family="HOG000263016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670095"
FT                   /locus_tag="ETAF_ple012"
FT                   /protein_id="ADM43329.1"
FT                   /db_xref="UniParc:UPI0001E35483"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS0"
FT                   /transl_table=11
FT                   /translation="MELFIVAALLGLIPAFIAQSKGRSFGAWWLYGFLLFIVAIIHSLL
FT                   ISKNDKAIEDKQLENGMRKCPFCAELVKKEAIKCKHCGSDIPISEKEQTLGEEQEKKPK
FT                   AQWFG"
FT   CDS_pept        9394..10131
FT                   /codon_start=1
FT                   /gene_family="HOG000119553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670096"
FT                   /locus_tag="ETAF_ple013"
FT                   /protein_id="ADM43330.1"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI0001E35484"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS1"
FT                   /transl_table=11
FT                   /translation="MIDDEILEHALQCAPMESCGYVVRMDQRAVYMPFENRSIEPTQYF
FT                   RMAPEDFLAAQARGEVIAMVHSHPGGQPYLSEGDRTLQLASALSWWLVCDGNIHRFRCV
FT                   PRLLGRQFEHGILDCYTLFRDAYELAGLTLPDFHRDDDWWKRGENLYLENFEKTGFYRV
FT                   TASDAQAGDVVLCCFGSSVANHAAIYCGDGMLLHHVPDQLSKRERYSDKWQRRTHSIWR
FT                   HRDWQASAFTGIYNDLVVNLTSM"
FT   CDS_pept        10029..10682
FT                   /codon_start=1
FT                   /gene_family="HOG000119565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670097"
FT                   /locus_tag="ETAF_ple014"
FT                   /protein_id="ADM43331.1"
FT                   /db_xref="InterPro:IPR010654"
FT                   /db_xref="UniParc:UPI0001E35485"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS2"
FT                   /transl_table=11
FT                   /translation="MATANTLNMETPGLASIRFHGDLQRFGRQFDLHVNTAAEGIRALC
FT                   IQLPGLRQQMSQGHYQVRIAGLTITPADVAQRMREPLPHGSIIHVVPRAAGAKRGGVFQ
FT                   IIAGVAMIAVAWWNPAGWMGAAAVSGLYAAGASMALGGVAQMLAPQPKAPSMAQADNGK
FT                   QSTYFSSLDNMVAQGNPLPVLYGEMLIGSRRISQMLSTRDEGGSGKVVVIGRRT"
FT   CDS_pept        10723..13842
FT                   /codon_start=1
FT                   /gene_family="HOG000119577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670098"
FT                   /locus_tag="ETAF_ple016"
FT                   /protein_id="ADM43332.1"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="UniParc:UPI0001E35486"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS3"
FT                   /transl_table=11
FT                   /translation="MGKGSGGGHTPYEAPDNLRSSQLLSVIDALSEGPIEGPVDGLQSI
FT                   LVNQTPTVDADGNVNVHGVTVVYRVGEQEQSSLDGFEESGAETMLNAEVKNANPITRTI
FT                   TSKEIDRLRFTFGVSSLVAGTDDGDQVETSVNLSIQIQRAGAWVTEKDVTIQGKRTSQF
FT                   LASVVVDNLPPRPFGIRMVRNTPDSTSARLQNKTLWSSYTEIIDLQQRYPNTAVVGVRV
FT                   DAEQFGSQQVTMNYHVRGRIVRVPSNYDPITRAYTGIWDGSFKPAYTNNPAWCLLDLLT
FT                   HPRYGMGDRMGMADVDIWSLYAIAQYCDQSVPDGFGGTEPRMVCNAYLATQRKVYDVLA
FT                   DFCSLMRCMPVWDGLTMTFVQDRPADKVWTYSNSNVVDGSFKYGFSALKDRHNAVEVRY
FT                   IDPQNGWKASVELVEDQAAIVRYGRNLLKMEAFGCTSRGQARRMGLWVIQTELLETQTV
FT                   DFMIGAEGLRHLPGDIIEICDNDYAGVTVGGRILDADTVSRTVTLDRDIALPPGGSAEM
FT                   NLIGADGSPIIIPVVDLPAPNMVRLQTVPAGIQAYGVWGLRLSSMRRRLFRCMMLREND
FT                   DGTYAVTALQHVPEKEAIVDNGAHFEPLPDTDHGVIPPAIQHLSVNVRPDNNLYQAIAQ
FT                   WDTPRVVKGVKFIVRLTSGAGTKDNPTRLVASATVSETEFILHSLPLGDYQLTVRAMNS
FT                   IGQQGAPTSVGFSIQAPEPPVNIDVMSGYFQLTLIPHQTYYSSDVQYEFWFSETRITNA
FT                   GQIESNAKRLGIATYWVKDGLQKLGTDYYFYVRSVNQVGKSAFVEAVGQVNSDADGVLD
FT                   ILKDKITSDQITKDFLKGIDNNLVRDEFNKALNDSEAKVDQALTVLESAVGDSKAQLQA
FT                   LSQTVATEDAALSQKIDNVNAQVGENASAVQVISKAQADLKGDVSAMWSMQVQTTEDGK
FT                   KVIAGIQATAEGGVGQVLILADRFAVMNPNNGSELLPFIIQNGQVIIDEAFMKSLNIND
FT                   RFIVTPDGQLTIRSHKDSRVGLMMDSDLIQINDESGRPVIKLGDLRKTLV"
FT   CDS_pept        13839..14840
FT                   /codon_start=1
FT                   /gene_family="HOG000140847" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670099"
FT                   /locus_tag="ETAF_ple017"
FT                   /protein_id="ADM43333.1"
FT                   /db_xref="UniParc:UPI0001E35487"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS4"
FT                   /transl_table=11
FT                   /translation="MSDYGLRIFRDDGSFLTLNSETTVSKILGVSRVPGDGLNLAKAPF
FT                   NTGIVIPDGYDYYCWNSAPIAGYDRLSIGGPWGFHRRYSRLDGARRVLIDTTNTADYRI
FT                   PALFYAVIAWPTKTQQKATYGLEVLNGSALFRLTGDTSFSTELFRGEVTIDYGWAPSRI
FT                   NPAFNRYNSVVFFYTTDPTVCISCHEEPQQINFYPVDISNAAPRSVRAKVVIFGTGNGG
FT                   GGLQRDTYGLELYNNGVLAYNSGWRMLTRPILLNMNGMAQNSMTGVSGVRRPMYMPTGV
FT                   GQCGVRKLYQRSDGFSIGVAMGRVSGEFAHSSPWFVGDSPLMVLDAEDYFSF"
FT   CDS_pept        14894..15556
FT                   /codon_start=1
FT                   /gene_family="HOG000158919" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670100"
FT                   /locus_tag="ETAF_ple018"
FT                   /cellular_component="cell outer membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM43334.1"
FT                   /db_xref="GO:0009279"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniParc:UPI0001E35488"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS5"
FT                   /transl_table=11
FT                   /translation="MRVCILCPAILLFAAGMAQASSGDSTITLTYIQQSNSQVEKDLVG
FT                   FKQITDQFIGSEHFGASTAPYRDAEGVALSYRYEFTDCWGVIGRLSYTGLRRGMQIRRG
FT                   HNYGPGVPVLVDGRSRSQRWGIMTGPSYRVTDNLSLYGLAGASVDRLSWHIQVDDGAND
FT                   ALGTALHTAEQQLTRVSMAYAAGVQLNAGGYVLDFSYTGVGGDDRSHGFLVGVGLIF"
FT   CDS_pept        15736..16608
FT                   /codon_start=1
FT                   /gene_family="HOG000005118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670101"
FT                   /locus_tag="ETAF_ple019"
FT                   /protein_id="ADM43335.1"
FT                   /db_xref="UniParc:UPI0001E35489"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS6"
FT                   /transl_table=11
FT                   /translation="MNKRKYVFLLFFIFPICAFGADGAEDSVPVFTTPWSRLFSGSEAR
FT                   LSTAITYNAPLSNQDKYIPVSYTESETKNIYNQRVFVSFQYSPLSSFFANLTVRTPLQN
FT                   INRYRADFVYSFGYDDWRPGTFSLVYSNYGDNNKFFPQEGDRRTKIEQGMITAAYKFSL
FT                   PNSWNKNILIYPSDSLTCQIGYLYGPRYYSTQESRIRKGKSVLLGSCGYTLKHNYFFRV
FT                   STFFYPDRSQQQPWDADYTYSIGYVSGYQPGDLSISYSNYSGTRYFWRGDRNANFRDGT
FT                   ISITWALPF"
FT   CDS_pept        16642..18825
FT                   /codon_start=1
FT                   /gene_family="HOG000158918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670102"
FT                   /locus_tag="ETAF_ple020"
FT                   /protein_id="ADM43336.1"
FT                   /db_xref="InterPro:IPR013609"
FT                   /db_xref="UniParc:UPI0001E3548A"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS7"
FT                   /transl_table=11
FT                   /translation="MAFFIYGVNMARITGILKDGMGKPITNCEIALKALRTSASVIVHT
FT                   VASQSPGEAGLYDMAAEPGQYRVTLCVDGYPPEYVGDIQIYHDSPDGTLNYFLGLPVDG
FT                   DLRPDVMKEFEIMVAKVSAQSAEVEKNKDAAAESARSALNSQQSAHSSESAAAESAAAA
FT                   LASQNAAKASEQLAASGAQSAQASQQAAKASESAAADSAAAALASQNAAKESEQAAASS
FT                   ALAAQASQQSAHGSESAAAESAAAALASQNAAKASELAATSSAETAANDAAAKAAQATE
FT                   ATLKEAVRADADRAASSATEAHSSTEQAAGSASSAHNSQMAAAQSASQAAGLADKVKAS
FT                   EAAAAESASSAAQSVSQASSSASAAAGSASAAKSSETAAAGSALAAEGSAQSAKVEADR
FT                   ISGGLDTKQDKSELLGAIAALQDAANKIVVLTGPSSVEAADLSTFAKSLLSKTDQDSAI
FT                   ECLGLKETVTLAGNAWSKKYIGRLNNGGAFAGCNQGGIYEVSIGTPSSVADFPMKNGTY
FT                   IYGYGVLYVTSNSGTISQLYISHNGQIAARIKWGDQPNFKSWAVYDPNSSFEYGCPLIG
FT                   SLIPWALERMPQEIWPNCGMHFIPYMGQSFDPELFPKLHDVYPDNRLPTDMRGYTARGW
FT                   DNGRGIDIGRALLSYQDDAIQNITGQFGWMPFNGSSPVASGAFSVDKIGANVWGGGTER
FT                   RDCAIGFNASNVVRTAEQTRVKSVAWNYITRAK"
FT   CDS_pept        18828..19409
FT                   /codon_start=1
FT                   /gene_family="HOG000118670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670103"
FT                   /locus_tag="ETAF_ple021"
FT                   /protein_id="ADM43337.1"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniParc:UPI0001BD096A"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS8"
FT                   /transl_table=11
FT                   /translation="MLDKNGNAINDIVMTVYGFSRNDHEFIGGYDVRLLSGTGIPSDST
FT                   ILTPPKEISGKTRIFNGSAWEYIDDHRGDTVYSTSTGESSQVTYLGDIKPGYTLIKPST
FT                   PYDAWDGTAWVTDLNAQHAANVELAEQKKSLLLSEAQEKIGLWQTELQLGMITDSDKAA
FT                   LITWMTYIKAVQAVDTSAAPDIAWPPKPAG"
FT   CDS_pept        20052..21281
FT                   /codon_start=1
FT                   /gene_family="HOG000127629" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670104"
FT                   /locus_tag="ETAF_ple022"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /biological_process="DNA recombination"
FT                   /protein_id="ADM43338.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniParc:UPI0001E3549B"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAS9"
FT                   /transl_table=11
FT                   /translation="MSISDSYLKSCLGRERERVEEKSDRDGLWVRISKKGAVTFFYRFR
FT                   FLGKQDKMTIGSYPEFSLKAARDEVAKWAAILARGENPRIRQSLDKAKINSQYTFEELF
FT                   REWYSMVCIQKETAGQILRTFELHVFPKIGKYPAHQLTLHNWLTVLDRLAQGYTEITRR
FT                   VISNGRQCYSWAVKRQLLDVNPLSEMTGRDFGIQKKMGERTLNRKELAMVWRAIEDSRL
FT                   IERNKILYKLSLVWACRVGELRLAETVHFDFEEGIWTVPWENHKTGRKSKRPIVRPIIP
FT                   ELLPLLKRAIELAPGRFVFSKYEDKPMSECFHMSISSNLVKFMLKAYNEQVPHFTIHDL
FT                   RRTARTNFSELTEPHIAEIMLGHKLPGVWAVYDKYTYIDEMRDAYSKWWARLMSIIEPD
FT                   VLEFTPRQVG"
FT   CDS_pept        complement(21259..21543)
FT                   /codon_start=1
FT                   /gene_family="HOG000095787" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670105"
FT                   /locus_tag="ETAF_ple023"
FT                   /protein_id="ADM43339.1"
FT                   /db_xref="UniParc:UPI0001E3549C"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT0"
FT                   /transl_table=11
FT                   /translation="MSTKTDSFELMSTRDICCQLSISPRTLERYRKRPDDGNPFPEPDC
FT                   SYMGGSNRWLKTRVHEWQIREMSRPVRRPMSHLNLPRDSKGRLIRPDEA"
FT   CDS_pept        complement(21606..22409)
FT                   /codon_start=1
FT                   /gene_family="HOG000267972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670106"
FT                   /locus_tag="ETAF_ple024"
FT                   /function="DNA binding"
FT                   /protein_id="ADM43340.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniParc:UPI0001E3549D"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT1"
FT                   /transl_table=11
FT                   /translation="MANSFKKMSRKGGPISRRDSGMFISLDNIHVQEGFNKRIDDERTQ
FT                   QADDDLFQFLFSGGVVPPLEVRPRDEGGVWVVEGHRRIRAYRRVREAGKPIELIAIVPF
FT                   TGSDVERVARIMTSNNQLPLTQFEQSLVVKELSAFNLTPDEIAKLIHKSRATVDKLLIL
FT                   STSNHDVQQLVKSGEVAMDVAVDRVKEHGESAGDVLQEDVKRAKAQGRKKVTRSVTGGQ
FT                   FSATRARRLVELLSDAEMDDDGRTLVLRDGIGEEVMKIINEYMQK"
FT   CDS_pept        complement(22402..22686)
FT                   /codon_start=1
FT                   /gene_family="HOG000081334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670107"
FT                   /locus_tag="ETAF_ple025"
FT                   /protein_id="ADM43341.1"
FT                   /db_xref="UniParc:UPI0001E3549E"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT2"
FT                   /transl_table=11
FT                   /translation="METFAKYSATDWMIMLQVVIIWLWMSIKAWQWVFAIALRKGWRWW
FT                   NRKDDKSLALESFCEAFNLEAIQPGRSIVVKTKGDMLILISRTKEVSNG"
FT   CDS_pept        complement(22686..23291)
FT                   /codon_start=1
FT                   /gene_family="HOG000158921" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670108"
FT                   /locus_tag="ETAF_ple026"
FT                   /protein_id="ADM43342.1"
FT                   /db_xref="UniParc:UPI0001E3549F"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT3"
FT                   /transl_table=11
FT                   /translation="MTKDVVIDTETMDTVPSALLLSIGAFAVDVSNLEDTQANILKVSR
FT                   DIDLQDFSVLAFYTRLDATDQLMLGRTVSQKTQMWWKDQAEDAHEALTGDRVALSEALI
FT                   GLSRWLDYHPGARVFFRGPDFDGAILENAYRMCGLECPWRYNGKRDVRTYIDTKVPTRG
FT                   RKGYLEGHQPCFQMIKHHALHDAMNDAEQMAIAYQEAC"
FT   CDS_pept        complement(23284..23433)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670109"
FT                   /locus_tag="ETAF_ple027"
FT                   /protein_id="ADM43343.1"
FT                   /db_xref="UniParc:UPI0001BD0979"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT4"
FT                   /transl_table=11
FT                   /translation="MKLTKERLQEIVEDGFLKHGESKELARIALAKKLNLEIIHQTTKA
FT                   ASDD"
FT   CDS_pept        complement(23433..24155)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670110"
FT                   /locus_tag="ETAF_ple028"
FT                   /protein_id="ADM43344.1"
FT                   /db_xref="UniParc:UPI0001E354A0"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT5"
FT                   /transl_table=11
FT                   /translation="MTTITKERAKQIFLGIGDAPTACEERELARIALASLEAEPVAWRY
FT                   RTTDINGNPKPRWSFSEDASLRGLYQPLYTAQPAPVLEPAISDNSVHDLFLRAKSLMYQ
FT                   SGGSPIEHSLNPVDAWLFEAERSGLPVAPLYTAQPAPAVIDERALFDAWNNEDNLPIAG
FT                   VGAKNAAWLAWQERAKMGNQPAPELKMAHLINKFYERYPLNTFKSDSRSEALGYFMAGA
FT                   ELQCFGEFINYAELLGDE"
FT   CDS_pept        complement(24159..24389)
FT                   /codon_start=1
FT                   /gene_family="HOG000289384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670111"
FT                   /locus_tag="ETAF_ple029"
FT                   /protein_id="ADM43345.1"
FT                   /db_xref="UniParc:UPI0001E354A1"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT6"
FT                   /transl_table=11
FT                   /translation="MANGTWFAVLDIPGMEKLVNQLHTNDSLNVTPAKAKKMADLVERW
FT                   TPPNGWSGQCQEKMKGYIVEFLRGCNGFRSH"
FT   CDS_pept        complement(24450..24923)
FT                   /codon_start=1
FT                   /gene_family="HOG000235501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670112"
FT                   /locus_tag="ETAF_ple030"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ADM43346.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="UniParc:UPI0001E354A2"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT7"
FT                   /transl_table=11
FT                   /translation="MAEQAVLDMCCGSRMFWFDKQNERAVFSDIRAEQHTLCDGRSLVI
FT                   NHDVIADFRALPFGDASFPVVVFDPPHLERVGENAWMGKKYGRLNKETWRDDLRAGFRE
FT                   AFRVLRPQGVLIFKWNETQIPVSQILALTDEKPAIGQRTGKGDKTHWIIFVKD"
FT   CDS_pept        complement(24925..25440)
FT                   /codon_start=1
FT                   /gene_family="HOG000158920" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670113"
FT                   /locus_tag="ETAF_ple031"
FT                   /protein_id="ADM43347.1"
FT                   /db_xref="UniParc:UPI0001E354A3"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT8"
FT                   /transl_table=11
FT                   /translation="MSYSTVISVWPGEKSEKMEELQNAWGSAPVIWNDMAVRYLGMARN
FT                   SYTWEIDKVWPLPKRMDIPEHNRAVLAMTYDNMIVVREDYARAAQCIRQYLIDFPVDER
FT                   YVNHWPRIAEIFESNPESPAIGLWLTSVCENPFAGEWNEDADEYDQQDWSKYWNVFEWL
FT                   DAGASKGE"
FT   CDS_pept        complement(25437..25808)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670114"
FT                   /locus_tag="ETAF_ple032"
FT                   /protein_id="ADM43348.1"
FT                   /db_xref="UniParc:UPI0001E354A4"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAT9"
FT                   /transl_table=11
FT                   /translation="MSQVDKQALREAALNAKIAGEAPVMPFDKRIDALNAFTKLLTPVT
FT                   AIALLDENESLAAENADLKHPRTYLPSKITTAETDAFINEMMAQGVEMLAKKCSENVWC
FT                   EDDVNFMLCYAKQLREGKA"
FT   CDS_pept        complement(25805..26719)
FT                   /codon_start=1
FT                   /gene_family="HOG000117544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670115"
FT                   /gene_name="rdgC2"
FT                   /gene_synonym="rdgC1"
FT                   /locus_tag="ETAF_ple033"
FT                   /biological_process="DNA recombination"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleoid"
FT                   /protein_id="ADM43349.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0009295"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniParc:UPI0001E354A5"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU0"
FT                   /transl_table=11
FT                   /translation="MKTFNVKNVLIYRLTKDINLDTKAIEAALAPMVFTPCASQDMSRS
FT                   GWTAPIATADSLIHAANGYLLMRYRREQKILPAEVIQKHLRERIAKLEQEQCRKLKKTE
FT                   KDALRDEVLHSLLPRAFSRTHQSWLWIDSAKKLVMVDAASAKKAEGILALLRKSLGSLP
FT                   VVPLTMKTPIELTLTQWVRTGKASAGFTLGDEAELKAILEDGGIIRTKQQDVDTDEITV
FT                   HIEAGKMVTKLAMGWNDRIQFVLDDNGTIKRLKFSNTLLDQNDDIDPEDAVQRFDADFV
FT                   LLSGELSALIANLVTALGEEASA"
FT   CDS_pept        27081..27626
FT                   /codon_start=1
FT                   /gene_family="HOG000247309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670116"
FT                   /locus_tag="ETAF_ple034"
FT                   /protein_id="ADM43350.1"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniParc:UPI0001E354A6"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU1"
FT                   /transl_table=11
FT                   /translation="MSPQKLSRISQHMSTASLFIIIFMLGFNSLFWIFPSLLSDSGGYG
FT                   LTAQMMGLTNFEMLPWWKITGGIILSGIPLVSLSYGLYQLRVLFHTYSKGDYFSTNAAR
FT                   LLGSVGKSIIIWILLNILCEPLLSYWLTFQEPIGNRVIFVSIDFQYIAAVFFAFCVILI
FT                   SEILKKASVINAENQQII"
FT   CDS_pept        27639..27866
FT                   /codon_start=1
FT                   /gene_family="HOG000225392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670117"
FT                   /locus_tag="ETAF_ple035"
FT                   /function="sequence-specific DNA binding"
FT                   /protein_id="ADM43351.1"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniParc:UPI0001CB35CC"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU2"
FT                   /transl_table=11
FT                   /translation="MSIIVRLDVLLAERKIKSKDLASAIGITEQNISILRQGKVKGIRF
FT                   STLEAICRYLNCQPGDLLIFNDEDDSTITG"
FT   CDS_pept        complement(28304..28954)
FT                   /codon_start=1
FT                   /gene_family="HOG000006606" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670118"
FT                   /locus_tag="ETAF_ple036"
FT                   /function="sequence-specific DNA binding"
FT                   /protein_id="ADM43352.1"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI0001E354A7"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU3"
FT                   /transl_table=11
FT                   /translation="MKSETMGYRIHKRRKELKLSQVSLSKAVGVSNVAISQWERDETSP
FT                   RGDALLNLAEALQCSAEYLVNGGDVDHNIEFRKERTQKGMYPVISWVSAGQWSEAIEAY
FT                   PIMAVDRWYGTTEECHASSFWLDVKGDSMTSPVGLSIPEGMAILVDPEAAPDNGKLVVA
FT                   KLVNDNEATFKKLVIDSGRRFLKPLNPQYPMIEINGNCQIIGVVVDAKITNLP"
FT   CDS_pept        29034..29219
FT                   /codon_start=1
FT                   /gene_family="HOG000119879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670119"
FT                   /locus_tag="ETAF_ple037"
FT                   /function="DNA binding"
FT                   /protein_id="ADM43353.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniParc:UPI0001E354A8"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU4"
FT                   /transl_table=11
FT                   /translation="MLKKAVIEHFGSQHAVAKALQVSDSAVSQWKGVIPERAALLVHQI
FT                   TKGKLKYSKDFYKKIT"
FT   CDS_pept        29313..29843
FT                   /codon_start=1
FT                   /gene_family="HOG000267971" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670120"
FT                   /locus_tag="ETAF_ple038"
FT                   /protein_id="ADM43354.1"
FT                   /db_xref="UniParc:UPI0001E354A9"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU5"
FT                   /transl_table=11
FT                   /translation="MVDIKTTIKEMCKAYPGGQKAMAVQLGMTYDAFRNHLDQKCASRF
FT                   FTLAEIELMEDLSGTSLLAEYHAARRGKLLVDIPVLEQIDNVELYEHSMREIAADGELA
FT                   KAKVEAVADGVICSDEKQELTTLFWKKMRNHAYGFFAFMALNGAAIADDSAVWVAHREC
FT                   RPSAPAHKTLCGD"
FT   CDS_pept        29848..30045
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670121"
FT                   /locus_tag="ETAF_ple039"
FT                   /protein_id="ADM43355.1"
FT                   /db_xref="UniParc:UPI0001E354AA"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU6"
FT                   /transl_table=11
FT                   /translation="MNILNPKRPSTQFRCRIVGGRLSYEQIVAASNRPGNNQPRRGLVV
FT                   GRAAVDAAWGEFYGNGRIHG"
FT   CDS_pept        30038..30214
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670122"
FT                   /locus_tag="ETAF_ple040"
FT                   /protein_id="ADM43356.1"
FT                   /db_xref="UniParc:UPI0001E354AB"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU7"
FT                   /transl_table=11
FT                   /translation="MAKFPRVGHMYKDRYGHTVRVVSTCADRQRVAYQLKGYEWTINAA
FT                   LIVFNARIRRDAA"
FT   CDS_pept        30217..31122
FT                   /codon_start=1
FT                   /gene_family="HOG000276987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670123"
FT                   /locus_tag="ETAF_ple041"
FT                   /protein_id="ADM43357.1"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001E354AC"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU8"
FT                   /transl_table=11
FT                   /translation="MTLMAKAMAIKVGNPVRKLVLIKLADNANDNGECWPSYQHIADHC
FT                   ECSKSAVRTHIEALIGMGLLVKENRIGNNNGKGNKSNVYYLNLNAPMSAESTPPVPSKS
FT                   IAPMSSKSTAMSSGDTPCAATWQTPVPSDDTRTYQLEPVIEPIGEKQTSDRKIKRATQL
FT                   PDDFKPSDSHRAMASEFGVDIDLELAQFCDYHLAKGTTFKSWPAAFNTWLRNAKKFAGN
FT                   RGQRAKSEAAGDTTLRDAAFRRFIGSALPLREPSALEQAARKAASMANVSKMSPEWAQK
FT                   RWNSIWTEVEQRQGAAGEAA"
FT   CDS_pept        31119..31361
FT                   /codon_start=1
FT                   /gene_family="HOG000156710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670124"
FT                   /locus_tag="ETAF_ple042"
FT                   /protein_id="ADM43358.1"
FT                   /db_xref="UniParc:UPI0001E354AD"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAU9"
FT                   /transl_table=11
FT                   /translation="MSIKKSAMATAHCERAEALASRGFYRRAITELTAAAMCASASQIG
FT                   GVVERRNELSRRVRCSQRVSGDPRMDYDNCVGGVL"
FT   CDS_pept        31358..31885
FT                   /codon_start=1
FT                   /gene_family="HOG000119309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670125"
FT                   /locus_tag="ETAF_ple043"
FT                   /function="DNA binding"
FT                   /function="site-specific DNA-methyltransferase (adenine-
FT                   specific) activity"
FT                   /protein_id="ADM43359.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0009007"
FT                   /db_xref="InterPro:IPR008593"
FT                   /db_xref="UniParc:UPI0001E354AE"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV0"
FT                   /transl_table=11
FT                   /translation="MSIKSNTPAEAKDCWQTPLWLFDALDLEFGFWLDAAASESNALCV
FT                   KYLTEVDNALGCEWESAGAIWCNPPYSKIGPWVAKAAEQSARQIQTVVMLVPEDMSVGW
FT                   FSEALKTVDEVRVITGGRVNFVHAVTGAEQKGNSKGSMLLIWRPFTTPLHRITTVSKSM
FT                   LEAIGRPVRSAA"
FT   CDS_pept        31966..32274
FT                   /codon_start=1
FT                   /gene_family="HOG000119986" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670126"
FT                   /locus_tag="ETAF_ple044"
FT                   /function="magnesium ion binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ADM43360.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR016281"
FT                   /db_xref="UniParc:UPI0001E354AF"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV1"
FT                   /transl_table=11
FT                   /translation="MSARGRAFHTECQARVLEQLRRYPTPMAGDLSVHVVLYPPTRARR
FT                   DLDNFFKAPLDSMTKIGIWHDDSQIKRMTAEFGEVVKGGCVEIVIQPFTSMPKKLPT"
FT   CDS_pept        32441..33124
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670127"
FT                   /locus_tag="ETAF_ple045"
FT                   /protein_id="ADM43361.1"
FT                   /db_xref="InterPro:IPR019104"
FT                   /db_xref="UniParc:UPI0001E354B0"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV2"
FT                   /transl_table=11
FT                   /translation="MYPILPANGALTMSTREIAELTGKRHDHVLRDARNLLAELQSPQS
FT                   WGDYQDGQGRTYPMILLDKSQSICLVAGYSAKYRMAIISRWQELEQSARPKSQLEMIAQ
FT                   MAMEAARIERQVEAVQQQVALVDQQVKDIAAGAIPPGWQTIRNLSAESGLSEQKTRDLI
FT                   KAFGVRSKKVPFMTPGGIVTNATVADEEDFLRAVGVVIHEATRPMRSKYWYHPKLGRFE
FT                   RREVA"
FT   CDS_pept        33124..34167
FT                   /codon_start=1
FT                   /gene_family="HOG000119975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670128"
FT                   /locus_tag="ETAF_ple046"
FT                   /protein_id="ADM43362.1"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR010373"
FT                   /db_xref="UniParc:UPI0001E354B1"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV3"
FT                   /transl_table=11
FT                   /translation="MRMLFTAYPQRSAGVVLLKTGKLTRRFTDGQRVMLADVPAAFHDS
FT                   PAGELVSDQLIAADPVWRPFFAHDRVQKAASLYMNFSEYLESFHYCQWKGVRDGYHDIQ
FT                   LTNTHGEHGGARLCWTCDNAMRGTEGALFTALCEKNRAEWVIESARRGLKLPEGHQLTE
FT                   PELCWWALVFGVADQIPGGIARRITGVELEEITGVMSESTIIPDRPTAQGVLAAAVEAA
FT                   EAVIPQEKMKPVIKLAADEAPAAGFMLRPKLQRWECPTYLRWVKTQQCSGCGSSADDPH
FT                   HIINSGLGLGGVGTKTHDLYVIPLCRRCHDELHRDVSAWERQHGSQIELLVQFLNRALG
FT                   IGAILKA"
FT   CDS_pept        34187..34861
FT                   /codon_start=1
FT                   /gene_family="HOG000267820" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670129"
FT                   /locus_tag="ETAF_ple047"
FT                   /protein_id="ADM43363.1"
FT                   /db_xref="UniParc:UPI0001E354B2"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV4"
FT                   /transl_table=11
FT                   /translation="MTLKNSQKGSASRANKQNAWVTVAGAPRRSYLGKYHRLTPAQSRW
FT                   VRSLLNQWGGMYGGSGVEHLSGGGGLWSVILTGWTGEQQERIASVLSDLRRMGYSGQAL
FT                   FDHAKAIIWPKKSLSSLIGKAVDEDEAEFMEAVILKSFALSSPVYVIGKDYYTRRNTMN
FT                   SMARWMQQHYAPFLTEKQCIDRVRWCIELFNSAVYFTLMSELCIENAETCKKDLKTSFE
FT                   AA"
FT   CDS_pept        complement(34873..35004)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670130"
FT                   /locus_tag="ETAF_ple048"
FT                   /protein_id="ADM43364.1"
FT                   /db_xref="UniParc:UPI0001E354B3"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV5"
FT                   /transl_table=11
FT                   /translation="MRAHRHRFNRIPALLRTKTKNPLNGGLIKFVSLLLAAEPAQLR"
FT   CDS_pept        complement(35042..35320)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670131"
FT                   /locus_tag="ETAF_ple049"
FT                   /protein_id="ADM43365.1"
FT                   /db_xref="UniParc:UPI0001E354B4"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV6"
FT                   /transl_table=11
FT                   /translation="MDYETKSELDQIKIMMVVREQAVSLIFHNIVKTIERIDPSGHLVR
FT                   ELKSDINNSLTSLHHGNDLKTFINRLMDYPEGTSSGFLVKDKKSFLD"
FT   CDS_pept        35520..35891
FT                   /codon_start=1
FT                   /gene_family="HOG000219279" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670132"
FT                   /locus_tag="ETAF_ple050"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ADM43366.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="UniParc:UPI0001E354B5"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV7"
FT                   /transl_table=11
FT                   /translation="MSDPLTGTGSAAGALAGVTFVGIFSGADAGVVIAAFAGAVVFVLS
FT                   AVEFPAWKRIAFGFVSFLMGVIAAGFTASIIDWFLPDQVVVDKPIGALVASACVIWVLM
FT                   FIISKAKNPPPLNFKGGGK"
FT   CDS_pept        35888..36169
FT                   /codon_start=1
FT                   /gene_family="HOG000123107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670133"
FT                   /locus_tag="ETAF_ple051"
FT                   /protein_id="ADM43367.1"
FT                   /db_xref="InterPro:IPR008473"
FT                   /db_xref="UniParc:UPI0001E354B6"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV8"
FT                   /transl_table=11
FT                   /translation="MTIDLFLLHINAAVCGLIAMRLLLFRRNGSQHKRRGAALAYVLIV
FT                   ASASVTFRVLIGVYHAVDISETIINVFLMALVMRAKGNVMQLFRGASR"
FT   CDS_pept        36166..36711
FT                   /codon_start=1
FT                   /gene_family="HOG000013717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670134"
FT                   /locus_tag="ETAF_ple052"
FT                   /protein_id="ADM43368.1"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="UniParc:UPI0001E354B7"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAV9"
FT                   /transl_table=11
FT                   /translation="MTKDEIFDGLLKREGGYVNHPADRGGPTNWGITEKTARANGYTGD
FT                   ISMLSRDQALRIYRADYWESPRFDLIDVVSQPIAVELLDTGVNMGPSVAAKMLQRCLTA
FT                   LNDGGRLYPDLQVDGAIGNRTANALRAYLAKRGHDGETVLLKALNCCQGARYIELSEAR
FT                   PANEAFLYGWLRERVALS"
FT   CDS_pept        36835..37683
FT                   /codon_start=1
FT                   /gene_family="HOG000266165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670135"
FT                   /locus_tag="ETAF_ple053"
FT                   /protein_id="ADM43369.1"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniParc:UPI0001E354B8"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW0"
FT                   /transl_table=11
FT                   /translation="MATSLWATFLGNEACFYKVTIDMNTSVASSYTDASSNHHVVNEFA
FT                   DIVPVVSGRIGERETNVVSGTSLHKALGVATRMTDWIKRRIGEYGFKEGLDYIIVENLR
FT                   SPNLSSSKSRQQISHEYMTTLDMAKELAMVERSEQGRAIRRYFIQCEEALQLTAPEVAA
FT                   RYRRKLKARIGVANLFKPMCSALESVRAEQGKATQSHHYSNESNMISRIVLGGLTAKQW
FT                   AGMNGVVGDPRDSMNAEQLEHLSYLESTNITLLDMGMDYPQRKVELTRLSQRWMARRLG
FT                   S"
FT   CDS_pept        37787..38182
FT                   /codon_start=1
FT                   /gene_family="HOG000028364" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670136"
FT                   /locus_tag="ETAF_ple054"
FT                   /protein_id="ADM43370.1"
FT                   /db_xref="UniParc:UPI0001E354B9"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW1"
FT                   /transl_table=11
FT                   /translation="MVGERLWKPLALIALVALSYWGLSSWRYAVGHADGKGEADRTWQV
FT                   KWSQRDAGEAQAITDNVMLTLNIMNQAVEANRNAKHQIALESQRAASDIKAAVADDDCA
FT                   RRPVPAGAAQRLRQYADSVRSGASATD"
FT   CDS_pept        38151..38384
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670137"
FT                   /locus_tag="ETAF_ple055"
FT                   /protein_id="ADM43371.1"
FT                   /db_xref="UniParc:UPI0001E354BA"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW2"
FT                   /transl_table=11
FT                   /translation="MYVPAPVPPISTELTADTPVPAVPDPLTWGASLDLNINLLSALGQ
FT                   CNADKAGIRRVELMRASPATGNKNHIDNRGNE"
FT   CDS_pept        38396..38671
FT                   /codon_start=1
FT                   /gene_family="HOG000023971" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670138"
FT                   /locus_tag="ETAF_ple056"
FT                   /protein_id="ADM43372.1"
FT                   /db_xref="UniParc:UPI0001E354BB"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW3"
FT                   /transl_table=11
FT                   /translation="MQIAVNAPAFKFDLNQMVNVRVSDEFGEVRGRAQYANAENQYYIH
FT                   YRAADGRATSSWFDESLLVAAEDDRHPGCPIYGCAEMPEGATVEDE"
FT   CDS_pept        38785..38997
FT                   /codon_start=1
FT                   /gene_family="HOG000004981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670139"
FT                   /locus_tag="ETAF_ple057"
FT                   /protein_id="ADM43373.1"
FT                   /db_xref="UniParc:UPI0001E354BC"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW4"
FT                   /transl_table=11
FT                   /translation="MLQDYFSHSTSDQERRLLAVQAALEIVKASVGSPTSYTGGKAFAD
FT                   FKAVTEGVGSLADAIQDALESNDDE"
FT   CDS_pept        39113..39274
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670140"
FT                   /locus_tag="ETAF_ple058"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ADM43374.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI0001E354BD"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW5"
FT                   /transl_table=11
FT                   /translation="MTSSPFQFTRGRRCSYCGSLTHIVQFCPKTYAGRSNIESRERVKQ
FT                   LVNSTRNQ"
FT   CDS_pept        complement(39474..39617)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670141"
FT                   /locus_tag="ETAF_ple059"
FT                   /protein_id="ADM43375.1"
FT                   /db_xref="UniParc:UPI0001E354BE"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW6"
FT                   /transl_table=11
FT                   /translation="MHLATVQNTLTRWIYIFYILIMILRQVLMMAIKVQKLAARRVARD
FT                   PQ"
FT   CDS_pept        39680..40216
FT                   /codon_start=1
FT                   /gene_family="HOG000127741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22670142"
FT                   /locus_tag="ETAF_ple060"
FT                   /protein_id="ADM43376.1"
FT                   /db_xref="InterPro:IPR009901"
FT                   /db_xref="UniParc:UPI0001E354BF"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW7"
FT                   /transl_table=11
FT                   /translation="MGTVDDLGTAFAWSISKISEAFSLDRATVRKRLAEAGVEPAGESR
FT                   GNSLYALRDVGPALFSTNSAPADIDAIQNPALMPPKDRKDWYQSENERVKLEESTRQLI
FT                   PESEVVSVFSSMTKAVVQVLETVPDLLERDCALSPQAVSHVQNVIDDLRFTLAERTYHA
FT                   CASDLAGSEEGLGED"
FT   CDS_pept        40216..42309
FT                   /codon_start=1
FT                   /gene_family="HOG000127752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22661850"
FT                   /locus_tag="ETAF_ple061"
FT                   /protein_id="ADM43377.1"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniParc:UPI0001E354C0"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW8"
FT                   /transl_table=11
FT                   /translation="MYASAKMIGQDLSARLKPPRRMRVSEAVGKYMRVPKSAGNSVAWD
FT                   PNVSPYVLEPLDCLSSREFDAVIFVGPARTGKTVALVDGWIVYNICCDPSDMLIVQISE
FT                   EKAREHSKKRLDRTFRCSPAVRRRMSPRRNDNNVHDKILRDGSYLKIGWPSVNIMSSSD
FT                   YRFVALTDYDRLPEDINGEGDAFSLASKRTTTFMSAGMTLVESSPGRDIVDTKWKRTTP
FT                   HEAPPSTGILSLYNRGDRRRWYWPCPHCGEFFQPIMENVVGYRDNPDPMEASEAARVQC
FT                   PHCMGLIEPHQKRELNARGIWLRDGEISYADGERSGTPRRSRIASFWMEGPAAAYQTWA
FT                   QLIYKILTAEQEYEATGSEETLKTVINTDCGQPYMPRRSLESRKSDVLMARAEVIEKRV
FT                   VPEGVRFLIATVDVQGGKNRRFVVQIIGYGADGERWVVDRYNIRYSMRFNENGESQPIN
FT                   PASFAEDWDLLRTDVLDKTYPLESSPDIRMPILAMGVDSGGEDGVTDNAYTFWRRCRRD
FT                   GESRRVYLLKGDSVSRSKLISRSYPDNTDRSDRRAKARGDVPIYLLQTDKLKDRISGAL
FT                   SRDIPGPNYIHFPDWLGEWFYEELTYEERDISGKWRKPGHGANEAFDLFCYAHAIAILR
FT                   GYERINWESPPVWARLPTEPSSKPVTQPASEENKPVNTINFEAVLAAPTVVPDKEIKGG
FT                   WIL"
FT   CDS_pept        42306..42509
FT                   /codon_start=1
FT                   /gene_family="HOG000228843" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22661851"
FT                   /locus_tag="ETAF_ple062"
FT                   /protein_id="ADM43378.1"
FT                   /db_xref="UniParc:UPI0001E354C1"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAW9"
FT                   /transl_table=11
FT                   /translation="MTREELEQRRQAYLEAERAVLMGKSISINGQEMTMESLSVIRKGL
FT                   EDIDAQLRAKTRPRSLHSVARF"
FT   CDS_pept        42509..44035
FT                   /codon_start=1
FT                   /gene_family="HOG000127765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI22661852"
FT                   /locus_tag="ETAF_ple063"
FT                   /function="DNA binding"
FT                   /cellular_component="viral capsid"
FT                   /protein_id="ADM43379.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0019028"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniParc:UPI0001E354C2"
FT                   /db_xref="UniProtKB/TrEMBL:E0TAX0"
FT                   /transl_table=11
FT                   /translation="MGILGKMVTAIAPHWKLSRLRAQHTIRAYEAVMPTRTHRAHRENR
FT                   SPNQATQFGGKSLREQARWLDENHDLVIGALDKLEERIIGSRGIIVEPQPLTPDGALNK
FT                   ELAEDIRMAWAEWSVAPDVSGQYTRPVLERLLLRTWLRDGEVFVHTICGSAVGLSKVAG
FT                   VPCWLEAMEPDYVPLGMSDQETNLVQGIQFNNWMRPTGYQVYKTYPGFGVGLADTKVIS
FT                   ADNMLHLKFTRRLNQARGVSLLSGVIIRLADLKNYEDSERIAARLGAAFGAYIKRGDAQ
FT                   TFNDDNYEKGKERELNITPGMIFDGLGPGEDIGMIKSDRPNPNLETFRMGQLRAVAAGT
FT                   RSSFSSIARNYDGTYSAQRQELVEAQEGYAILQDAFIAAITRPMYRRWLSAAIAAGRIT
FT                   VPRGIDKETLFNAVYSGPVMPWIDPLKEANAWKVILRGGAGTESDWIRARGGTPADVKR
FT                   RRKAEIDENRELGLVFDTDPANDTGGDPSGGKEEPNHESKGDGRTRSRTR"
XX
SQ   Sequence 44194 BP; 10505 A; 10324 C; 12407 G; 10958 T; 0 other;
     tgatgtcttt gatggcatcg ccatctataa cctgctgaaa aatcacccag ccagcaaaac        60
     ggtgtatatc gatggcctgg ccgcttcgat ggcctcggtg atcgccatgg ttggtgaccc       120
     aatcatcatg ccggaaaacg ccatgatgat gatccacaag ccctggggcg ttgccggcgg       180
     tgatgccaat gaaatgcgtg attacgctga tttgctggac aaggttgaat cagtgctgat       240
     cccggcctat gccgagaaaa cagggaagac ggcagacgag atcgcggcgc tgctggagca       300
     agagacgtgg ctgagcggcg tcgagtgtgt cgagcaagga ttcgctgaca aaaccatcaa       360
     gcctgtcaag gcgatggcct gcatccaatc taaacgagta gaggaattcg aacatatgcc       420
     gaagagcatc cgtaatctga tcaatccgca agccaatgct ggccgtcagc ctacccatca       480
     ggaaccggcg gcgccggcgg gaaatctcga cgttaacgct attcgcgccc aggtgcagga       540
     agagcagcgc cagcgtgtca ccggtatcca agacctattt gccatgtttg gtaaccgcca       600
     tgccgatctg atggcgcagt gcgtgtccga tgtcgattgc tctgtcgatc aggcaaagga       660
     caagctgctg gccgaattgg gtaaaggtgc gacgccgacc aatcagctga acggtacgca       720
     gaaccgcact aactcgcaca tctacgcggg caacggtaac ttcactggcg atggcattcg       780
     tgctgccctg atggcgcaat ccggctatga agaaggccag cgcgataacc cgtatgccgg       840
     gatgacgctg cgcgaaatgg cgcgaatgtc gctgacagag cgtgggatcg gcattgccgg       900
     ctataacccg atgcagatgg tcggtctcgc ttttacccac tcaagctcag acttcggcaa       960
     catcctgctg gacgtggcca ataagtctat tctgcaaggc tgggaggatg caggggagac      1020
     gtttgagcag tggacgaaga aggggcagct ttccgacttc aaagttgcgc atcgtgtcgg      1080
     cctgggtggc ttctcctcac tgcgtcaggt gcgcgaggga gctgagtata agtacgttac      1140
     caccggtgat agccaagcga cgatcgcgct ggcgacgtat ggtgagctct tcagcattac      1200
     tcgccaagct atcatcaacg acgatctgaa catgctgacc gatgtgccga tgaagttggg      1260
     gcgagccgcc aaggcgacga tcgctgatct ggtttatgcc gttctgacga aaaacccgaa      1320
     aatgtcgacg gatggtgtcg tgctgtttga tagcgccaag caccataacg tattgagcag      1380
     tgccgccatg gatgttccca gcctggataa aggtcgccag ctgatgcgga cgcaaaaaga      1440
     aggcgatcgc catctgaaca tccgtccggc gtttgtcctg gttccgacag cgatggaggc      1500
     taatgccaat caggttatta agtcggccag cgtgaaaggg gctgacgtta actctggcgt      1560
     tattaacccg atccagaact ttgccaccgt tatcgccgaa ccgcgcctgg atgctgccag      1620
     tgtatcgacc tattacctgg cggccgcgaa aggcagcgac acgattgagg tcgcctatct      1680
     caacggcgta gacgctccgt atatcgatca gctggatggt ttcgacgttg atggagtgac      1740
     gacgaaagtc cgcattgatg ctggtgtttc tccgctcgat caccgcggcc tggtgcgctg      1800
     ctctgcatcg taatatcggt cgataatccg aacaccacga actgaatttg gcctctcacg      1860
     gagaggcctg gaggctttat ggctaaaaat tttgtacagg aaggtaagac catccagttt      1920
     actgcggcga aggacgcgga aagtggcgcc ctggttcaag tgggcgacgt tatggctgtt      1980
     tccctttccg atgttgctgc tcaagcgcag ggcgttggca tggctgaggg ggtattcctg      2040
     ttaccgaaac tgcggaccga tgatatggcc accggtaaaa aggtgtacct gaagagcgac      2100
     aaagtgcagt tggccaatag tgccagcgag ccctatgtcg gtgtggtgtg ggaggctgcc      2160
     ggcactagcg atgatttcgt gccggtaaaa atcaatgcct aacccattcg acgagctggc      2220
     tggcaggatg gatgcgacta tctctctgcg tttcggtaag ccagccgaga tcaacggcgc      2280
     ttcggttacc gtggtgccct catcgttatc agcgattctc ggtccagtgg aagccagcgt      2340
     gctgactctg atcgtgtttt ctcccagtta tcgtcctcat cgcggtgatg atgtgcgttg      2400
     gaacaagaaa gcctacaccg tgagtaagtt tcatcagcaa aacgggaagt gggtgatcca      2460
     actggaaatc ggctaatcgg ggggggtatg gcattagtta aaggcatgga caggttggag      2520
     gccgtcctgc gtgatctcag cgataaagct gtccctgccg ccgtgcggcg tgcgtcaagg      2580
     aaggtcgcag aggcggccat gttgcgcgcc gcagagcgag tagccagtaa agagaagctg      2640
     cccatcgata aagtcaaaag gcgcatgagg ttgtacaccc ctcgtggcgg cattgcggcc      2700
     tattcgaaaa tcacggtgta tcgcagcgcg atgccggtca ttaaccgtgg ctcgcctcag      2760
     cttatcctcg gaccaagagg ccgaggtcat actggttggc gcggatcggt attaacggcg      2820
     ggtggccgct cttatcccgg gtctttcctt gtctacatcc ccaagtatcg ccactggcag      2880
     atcatgcaca ggactgcggc ggcgattgcc gccaagcaga ggctgatgat tgacgcgacg      2940
     cgtgaggata tgtcaggcgt gttgacgcag gcatttgaga tggagaaaga caacatcttg      3000
     agtgagatgg aggatgagct gggtaagcag ctgacgtcac agctgaagcg ggagatgaag      3060
     cgatgagcgc aacggagatc cgtaaggccc tggtcgatga gttccgcagg gtcttaaaag      3120
     acgagcctga agaagtcgcc attttcaatg ggctgccggc gtttgttgac ggtgaggagg      3180
     agttaccggc ggtttctgtg catctgtcag atattgcgga tgacgatgag tttctcgacg      3240
     atccgaaatg gcgggcagtt ttgcatgtgg ccgtgtttgt taaatcgagc gcgccggata      3300
     gtacgttaga tcactgggct agccgcttag ttttcccggt tgttcctaac tgtcgggagt      3360
     tattgcgcct gtgttcatca atcgagttag tgggatgcac ctatgaccgc agtgatgtcg      3420
     ctgcgacttg ggctgctatt gatgtgaaat ataacattac gtttgagtgg gagtgatatg      3480
     gctgatccgc tgaaaaatga gccgattaaa ggcgcaaaga ccacgttctg gtattacatc      3540
     gggcgtggtg ttggaacccc ccagtcgccg gagcctgact ggcgtcgatt gggtaaggta      3600
     aagtcactga agccgggaga gatgaaagcc gacactgagg atgattccta tctcgacgat      3660
     cctgatgccg actggaagca gagctctccg gggcaaaaat cagtatcgga ggcgtcggta      3720
     acgttagcgt ggatgcctgg agacccgggg caacaggcgt tgatggatgc gtttatgctg      3780
     ggtaaaacgc tggcatttcg cattaaatac ccgaacgata ctgccgattt ttttacggga      3840
     ttcattacca atcttggcaa agagatcaac agtaaagatg ttattacgcg agacattaaa      3900
     attcagccat ccggtaagcc gatctcagca gaaggactta tcccggcgct gactggtatc      3960
     aaaatctcta ccgggcaatc tgcagatggt acggcggttg cactgacagg cagccaaggc      4020
     aaatggacgg ggagcgctcc cgtatctaag gggcgtatca gcctaaccat tgaacctatt      4080
     ccggcggggg cagccattcc agcattgagt gttgtttcct ctgcgccaga taaggcgttg      4140
     atccccgatg ctacggctcc cgatattgtg ccgttaatgg cgggtgaggc ggcgatcacg      4200
     atcagtggcg gtggctttac tgataaatta acgctcacgt taagttgatt tttcattgca      4260
     gcagcccgcc attttggcgg gttttttatt gggggcgtgg atgtttttaa aaaaagagaa      4320
     atttactcac tgcgagcatt ctgttgagct tcgtgagctg tcagcactgc agcgtattga      4380
     gtatatggag tatgcggcag caaaccagat caatgatgac ggcgagattg agccgatgaa      4440
     gtatatctcg gcgcttaatc gcatggatat caagctgaat gccatgttgg ttgccatggc      4500
     cacggtatcc ccagaaaaaa tggaggatcc gacggaaatg caggtgttac agcacagcat      4560
     catgcgggca tggccatcgg atgcgctggg aaaggcggga aaattagtga tggccttgag      4620
     cggtatgctt cccccggaac ctgccccggg agagtctcca gacggaaccc tcggagagca      4680
     tgatgcggga aagttttagg gcgggaaatg gcctttgttt tgggactggc gcgagagttc      4740
     cggcgcgctg actggcggcg atggttgtcc tctatgagct gcacggagtt taaagcatgg      4800
     gcagattact atgctacccg ccccttcttt gttgatctgg ttgattgcga gtttgcttcc      4860
     ctgaagctga atcagttcct gttggcaggc ggaaagagtg atgaggtctc tatgcaggat      4920
     ttttgcctaa tcaccgccgg cgatgaagcg ctcgagcccg aggaagatat gggagacgat      4980
     caaattatgg cggccgcgac atttattcct gggggggtgc gatttggcca gtgaaactga      5040
     tcttgagata tttatcggcg ctaacacggc gcagttccgt gagtcgatgc aaaaagctcg      5100
     cgatgatatt cagatcgtga acgaggaagt gcggtccgcg gctgccgcga cagaagacgg      5160
     cgccgataaa tttacggcag cccaagtccg ggcaacgcaa cgcctcctgc gttcgatcga      5220
     tccgacgttg cggtctatgg acgcccttga agtaaagcag cgcaaggtcg agcagtcact      5280
     tcgtgatggc aaaatctcaa cggaagagta ttcgcgcgcc atgcaaattc tgtcccgaga      5340
     tctggaacag acacaggcta aagagcggct gcatgcggcc gcgtttgggc aggctaccgc      5400
     ggctatgcag cggcaagatc agatgctcaa aaaaatgaac atctcagtcg gacaataccg      5460
     tagcgccgtt ggcatgttac cggcgcagat gactgacgtg gttacgcagt tggcgggtgg      5520
     tcaaaatcct ctgctcatcc tgttgcagca aggcgggcag attaaggact cattcggcgg      5580
     aataaagaat acgtttttag cgttaagctc ggttatttca cccgcagcgc tgggcgtcgt      5640
     agccttatcc ggcggtattg gtgggttggc atatgcgctg tataaggccg agcaggaaca      5700
     gcaggcgttt aatcgcagcc tgattatgac gggtaactat gccgggaaaa cgacggggga      5760
     gttacaagcg ctggcgcgag ccatgtctgg cgatggtctg tcccaaagag atatggcttc      5820
     ggcattggct caaactgtcg gaactggtgt ctttagcggc gcaaccgtgg ggatagttgc      5880
     tagtgctgca gctcgtttag aaaatgcgac aggagcttct attgattcga cgatcgaaca      5940
     gtttaagcgc ttgcagaaag atcccgtatc ggcagtgaag gagttggatg gtcagttgca      6000
     tttcttgacg gcgacacaat tggagcagat taatgctttg gcctctttag ggcgggagca      6060
     agatgcggca aaaattgcta tggaagccta cgcccatacg gtaaatacaa gggctgagga      6120
     gatgaaaaat aatcttgggc ttttagagcg agcgtggcgc ggcgtgaaaa cagcaatagg      6180
     agaaacagct gacgctgcaa tggactttgg gcggaaaagc actccagagg atagcattgc      6240
     tgtattagaa agcgagctta agcgcctaaa agcacaacct caaagtattg tcgggaatcg      6300
     tgatgctgtg gctaatgttt ccaataaatt agcagtatta aagcaagcgc aggtattgca      6360
     gagtgatatc tctggcgttg ccaaggacac cactgcggcc aatgaggcaa gaaaaaaaca      6420
     ggttgaagcg accgaaaagc ttaatcgtga atacgaaaat gaggcagatc ggcataacag      6480
     agctttggca aaaattcgca actctggtgc atcgaaagat gctattgagc gtgctatcaa      6540
     tgctgaaaat gaacgctatg caaaatctca gtcacggggt agtcatggca cccagcaagg      6600
     ggagagcctg gccgatcgct atagccagcg ccttgctcaa acccgagaag cattgcagtt      6660
     ggagcaggct ggagctcaaa ccctaacaca atcagagcgt gacctgatcg cacttcgtca      6720
     gcgtttggat gacctgaagg ggcgcagcct gactaaaact gagcaaagcg tagtggcgaa      6780
     tgccgccatt ttagagaagt tactctccca gaacgtagca gaggaaaagg cgctagagca      6840
     gcagaaagcg ctgaatgaaa tgaagcgcaa gggcgctcag ctctctatgc agatggaaca      6900
     agaagcgcaa cgagatagcc ggacacgctc atttgaactg cagggatttc gaatgggtga      6960
     cctagcccgt gagcgggcgc ggcaggagat ggctctccgc gatcactacg atcaggttat      7020
     gggggagtta gagcgaagcg ccacacaaaa agggacaaag ggtagtgcag agtattcaga      7080
     cgcagtccgc atgttgcagg agagcctgga gcagcggtta caggcattgc gtggttacta      7140
     ttccgcggtt gatgcggagc gggcccgctg ggatattgga gtaagccgct ctatgcaaaa      7200
     tattaaagag gctggggatg atgccgctgg cgccgccggg gaggcgctaa cgggggcgtt      7260
     taatagtgct gcggactctc tggcaaactt tgtatcaagt ggtaaagcta actttcgtag      7320
     cctgacaaca tcgatcctat ctgatttagc ccgcattgct gcacgaatgg cattatcaaa      7380
     ggccgttggt gggttgttta gtatgttcgg cggggcggca gcaagcgggg ttaatgcctt      7440
     ttcttcggga gaatatggca acctgccact ggtcgcaaac gcatccggcg gcgtgtatcg      7500
     ctcgtcagat ttgagtgcat atagcggcca ggtggtttca caaccaacgt tttttgcttt      7560
     tgctcgcggg gcgggcttga tgggggaggc agggccagag gcgatcatgc cattgacccg      7620
     agatagtaaa ggacgtttag cggtaactgc ggttggggct ggagcgcatg gctcggtatt      7680
     ttctccgaac tataacgttg ttattcagaa cgacggtaaa aatggcgaga taggtccagg      7740
     ggcactaaaa gccgtatatg acctcgggca aaaagctgca gctgattttt tgcggcagca      7800
     ggggcgtgat ggtggtcatc tgagcggggc atatcgataa tggaaacatt tcgctggcaa      7860
     gttcgccccg atatggtcgt agagtctgag ccacgggtgc atgttgtaaa gttcggagag      7920
     gggtacgaac agcgccgatc ctccggttta aatggcgatc tgaaaagcta tgaagtaaca      7980
     atcaaggtct cgcgggatga cgcccacgcg ctggaggcgt ttttatctcg acacggcggt      8040
     gtttcagcgt tcctatggac gccgccctat gtgcatcggc agatcagggt cgtatgccgg      8100
     aaatgggcgt cacgggttga aatgcttaac accgttttta cagcaacgtt taaccaggtg      8160
     atttcctgat tgagaggagg aataatgcgc aatattccgc aggagacccg aaacgaaacc      8220
     acaaaaactg agcagggagc tcgcattgat ctgtgggagt tcgacctgtc atccataggc      8280
     ggggatcgtt actttttttg caatgagtta aatcacaatg gtgagccggt aacgtggcag      8340
     gggagacaat atcaacccta tcccattcag tgctcgggta tcgaaattaa gggaaagggg      8400
     gcaactaatc gcccttcgct cgccgtatct aatctgtttg gcctggtcac tggaatggcg      8460
     gaggatttgc agagccttgt tggggcttct gttgtgcgcc ggcaggtata ttctcggttt      8520
     cttgatgcgg agaatttccc cgatggtaac ctagaggccg atcctgagca ggaggccgtg      8580
     gttcgctacg ttgttgagca attggcagag ctgactgcag aaacggcgac gtttgtttta      8640
     tctctcccta ctgagactga cggagccgta ttccccgggc gtatcatgct cgcagaggtt      8700
     tgcgcatggc gctatcgatc tgatgagtgt ggctattctg gcccaccggt ggcggacgtg      8760
     ttcgatagtc caacggttga tccctccctt gaccagtgta gtcgatgtcc gagggggtgt      8820
     aagatgagaa gcaatatcga tagctttggt ggttacctgt ctattaataa actgtcgcaa      8880
     tgataatttg gtagtatcat cttttacctt tacacctatc atttgttagt atgtggctac      8940
     attactaatg aggatggtga tatggaatta tttattgttg ctgcattgct tggattaatt      9000
     cctgcattca tagcacagag taaagggcga tcttttggtg cgtggtggtt atacgggttt      9060
     cttctgttca ttgtggcaat aatccactct cttttaatat ctaagaatga taaagcgata      9120
     gaagacaaac agctggaaaa tgggatgagg aaatgcccat tttgcgctga attagtaaag      9180
     aaagaagcta ttaaatgcaa gcattgtggt agtgatattc ctataagtga gaaagagcaa      9240
     acgctggggg aagaacaaga gaaaaaacca aaggctcagt ggtttgggta attgtatgaa      9300
     aatggttctt atctgtttct atgcattatt gctatcataa ataaaaaata acaaaacccc      9360
     ggcaataagt cggggtttta tatggggaat catatgattg atgatgaaat attggagcat      9420
     gctttacagt gtgcgccgat ggagtcatgc ggttatgtgg tgcgtatgga tcagagagcg      9480
     gtatatatgc catttgaaaa ccggtctatt gagcctacgc agtatttcag gatggcgcca      9540
     gaggactttt tggcggcaca ggccaggggg gaggttatcg ctatggtgca tagccatcca      9600
     ggggggcagc cctatctcag cgagggagac cgaacgctgc agttggccag cgccttgtcg      9660
     tggtggttag tctgcgatgg caatatccat cggtttcgct gcgttccccg cttattgggg      9720
     cggcagtttg agcacgggat attggattgc tacaccctct ttcgtgacgc ctatgagctc      9780
     gctggcctga cgttgcccga ttttcatcgg gatgatgatt ggtggaagcg tggcgaaaat      9840
     ctgtatctgg aaaactttga gaaaaccggg ttttaccggg ttaccgccag tgatgcgcag      9900
     gccggggatg tggtcctgtg ctgctttggg tcatccgtag cgaatcatgc ggcgatttat      9960
     tgtggtgacg gaatgttgct gcatcacgtc cctgatcagt tgagcaagag agagaggtat     10020
     agcgataaat ggcaacggcg aacacactca atatggagac accgggactg gcaagcatcc     10080
     gctttcacgg ggatttacaa cgatttggtc gtcaatttga cctccatgta aataccgccg     10140
     ctgagggaat tcgtgcgctg tgcatacagc tcccaggtct gcgccagcag atgtcgcaag     10200
     ggcattatca agtgcgcatt gcaggactaa ctattacccc ggcagatgtg gctcagcgca     10260
     tgcgggagcc tttgccgcac gggtcaatta ttcatgttgt tcctcgagct gctggcgcaa     10320
     agcgcggcgg cgtatttcag attatcgctg gtgtggcaat gatcgccgtg gcgtggtgga     10380
     accctgctgg ctggatgggg gctgctgcag tatctgggct gtacgcggca ggggctagta     10440
     tggcccttgg tggcgttgct cagatgttgg ctccacagcc gaaagcgcca tcaatggcac     10500
     aggctgataa cggaaagcaa agcacctatt tttccagctt ggataacatg gttgcacagg     10560
     gaaacccatt accggttttg tacggcgaga tgttaatcgg atcgcgccgt atctcgcaga     10620
     tgctgagcac ccgtgatgaa ggtggcagcg gaaaagttgt cgtgataggc cgcagaacat     10680
     aaaccgcctt ttggcggttt tgttatatga ggggtgtgca ttatgggtaa gggtagtggc     10740
     ggtgggcata cgccgtatga ggcacctgat aatttacgat cttctcaact gctcagcgtg     10800
     attgatgcgt tgagtgaagg tccgatagag gggccagtgg atggcctgca gagcatcctg     10860
     gttaatcaaa cgcccactgt cgatgctgat ggtaatgtta atgtccacgg tgtcacggtg     10920
     gtttaccgtg ttggagagca ggagcagtcg tcactggatg ggtttgagga atctggcgct     10980
     gaaacaatgt taaatgccga ggtgaaaaac gctaatccaa taaccaggac cattacatca     11040
     aaagagatcg atcgcctgcg ctttacgttc ggtgtttcat cattggttgc tggcaccgat     11100
     gacggtgatc aggtcgaaac cagcgttaat ctgagcattc aaatacagcg cgccggcgcc     11160
     tgggtgacag aaaaagatgt gacgatccaa ggaaagcgga catcgcaatt tttagcatca     11220
     gtagtcgtcg ataatttgcc tccccgcccg ttcggtattc ggatggtcag gaatacgcct     11280
     gacagtacat ctgctcgttt gcagaacaaa acattatggt cgagttacac cgagattatc     11340
     gatctgcagc agcgctatcc taatacggct gtagtaggtg tgcgtgtgga tgctgagcaa     11400
     ttcggcagcc agcaggtcac gatgaattac cacgttcgcg gccgcattgt ccgggtccca     11460
     tccaactatg atccaattac gcgggcgtat accggtattt gggatggatc tttcaaaccg     11520
     gcgtatacca ataaccctgc gtggtgtctg ctggatctgc ttacgcaccc acggtatggc     11580
     atgggcgatc gtatggggat ggcagacgtt gatatctggt ccctgtatgc cattgcacag     11640
     tattgcgatc agtctgttcc tgatgggttt ggtgggacgg agccgaggat ggtgtgtaac     11700
     gcctacctag cgactcagcg aaaggtttat gatgtcttgg ctgacttctg ctcattaatg     11760
     cgctgtatgc ccgtttggga cggtctgacg atgacgtttg tgcaggacag gcccgcagac     11820
     aaagtgtgga cgtattcaaa cagcaatgtc gttgacggca gttttaagta cggcttcagc     11880
     gcactgaaag atcgtcataa tgcggtagag gtgcgataca ttgacccgca gaatggctgg     11940
     aaagcctctg tggaacttgt agaggatcag gcggccatcg ttcgctatgg gagaaacctg     12000
     cttaaaatgg aggcctttgg ttgtacgtcg cgtggccaag cgcgacgtat ggggctatgg     12060
     gtgatccaga ctgaattgct ggagacgcaa accgtcgatt tcatgatcgg tgccgaggga     12120
     ttgcgccatc tacccggtga cataattgaa atctgcgata atgattatgc aggtgtcaca     12180
     gttggtgggc gaatactgga tgctgatacg gtcagccgaa cggtcaccct cgatcgtgat     12240
     attgctctac ctccaggtgg ttcggcagag atgaatctta tcggtgccga tggctcgcca     12300
     atcatcatcc ctgttgttga tctccctgcg ccaaatatgg tgcggctgca gacagttccg     12360
     gccggtattc aggcgtatgg tgtatgggga ctgcggcttt catctatgcg ccggcgctta     12420
     tttcgctgca tgatgctccg cgaaaatgat gacgggacat atgccgttac ggcgctgcag     12480
     catgtaccgg agaaagaggc tattgtggat aatggcgcgc atttcgagcc tctgccagat     12540
     acagatcatg gagtaatccc acctgccatt cagcatttat cggttaatgt tcgtccagat     12600
     aataatctgt accaggccat tgctcaatgg gatacacccc gcgtagtaaa aggggttaaa     12660
     tttattgtta ggttaacatc gggtgcaggg acaaaagata atcctactcg acttgttgca     12720
     tcagcaacag ttagtgagac tgagtttatt ctacattcat tgccgttggg tgattatcag     12780
     ttaactgtta gagcaatgaa tagcattggc cagcaagggg cgccaacatc agttggattt     12840
     agcatacaag cacctgagcc ccctgttaat attgatgtaa tgtctggtta ttttcagtta     12900
     acgctgatac ctcaccagac atattacagc tccgatgtgc aatacgaatt ttggttctca     12960
     gagacacgta ttacaaatgc tggacagatt gaatctaatg ctaaacgcct tggtattgct     13020
     acctattggg ttaaggatgg tctccagaag ttaggtacag attattactt ttatgttcgc     13080
     agtgttaatc aggttggaaa gtctgctttc gttgaggctg ttggtcaggt aaatagtgat     13140
     gctgacggtg ttctcgatat tctgaaagac aaaatcacct ctgaccaaat aacaaaggat     13200
     tttctgaaag gaattgataa taatctggta cgtgacgagt ttaataaagc actgaatgat     13260
     tcagaagcta aagttgatca ggcactgacg gttctggagt ctgctgttgg tgactctaag     13320
     gctcaattac aggcgttgtc tcagactgtt gccacagagg atgctgcgtt atctcagaag     13380
     attgataacg ttaatgctca ggtcggcgaa aatgcctctg ctgtccaggt gatttccaag     13440
     gcgcaggcag atcttaaggg cgatgtgtct gccatgtggt caatgcaggt tcagaccaca     13500
     gaagatggta aaaaggttat tgctggcatt caggctacgg ctgagggggg cgttggccaa     13560
     gtgctgatac ttgccgatcg ttttgccgtt atgaatccca ataatggcag cgagttgttg     13620
     cctttcatca ttcagaatgg ccaggttatt attgatgagg cttttatgaa atcactcaat     13680
     attaacgata ggtttattgt tactccagat ggacagctca ccattcgatc tcacaaagat     13740
     agccgcgttg gtttaatgat ggatagcgat ctgatacaga ttaatgatga atcaggccgg     13800
     ccagttataa aattgggaga tttgaggaaa acgctggtat gagtgactat ggtctgagga     13860
     tttttcgtga tgatggttca ttcctaacac tgaatagcga gacaaccgta tcaaaaattt     13920
     tgggagtatc aagagttcct ggtgatggct taaatctcgc caaggcgcca ttcaatacag     13980
     ggatcgttat tcctgatggg tacgattact attgctggaa tagtgccccc atcgctggtt     14040
     atgacaggtt atcgatagga gggccgtggg ggtttcatcg gagatactcg cgccttgatg     14100
     gcgcaaggcg agtgcttata gatacaacca ataccgccga ttatcgtatt cctgccctgt     14160
     tttatgctgt cattgcgtgg ccgactaaaa cgcagcagaa agccacatat ggtttggaag     14220
     tgttaaatgg gtctgcatta tttaggttga caggtgatac atcatttagc actgagcttt     14280
     tcagaggaga ggtaaccata gattacggat gggctccgtc cagaatcaac ccagcattta     14340
     atcgatataa ctctgtggta tttttctata ctactgatcc tactgtttgc atatcgtgtc     14400
     atgaggagcc gcagcaaata aatttttacc cggtagatat cagtaatgcg gcgccaagat     14460
     ctgttcgtgc taaagttgtt atctttggta caggaaatgg aggtggcggg cttcaacgtg     14520
     atacctatgg ccttgaacta tacaataatg gcgtgctggc ctataactca gggtggcgta     14580
     tgctaacacg accaatacta ttaaatatga atggtatggc tcaaaatagt atgaccgggg     14640
     tttccggcgt tcgcaggcca atgtatatgc ctacaggtgt tggtcagtgt ggggttcgca     14700
     agctatatca gcgcagcgat ggcttttcga tcggcgtagc aatggggcgg gtttctggtg     14760
     agtttgctca ttcatcgcca tggtttgttg gtgactcgcc attgatggta ctcgacgcag     14820
     aagattactt ctccttttaa cttcctccct tatttctact atttcacatt aacccttcat     14880
     aaaaggatct ggtatgcgtg tatgcatttt atgtcctgct attttgcttt ttgctgctgg     14940
     tatggcccaa gcgagttcag gtgattcaac aataacgctg acttatatac agcaatcgaa     15000
     tagccaggtt gagaaagatc tggttgggtt taagcagatt acagatcagt ttattggatc     15060
     tgaacacttt ggtgcgtcca cggcgccata ccgcgatgct gaaggtgttg cactttccta     15120
     tcgctatgag tttaccgact gctggggcgt gatagggcgg ctaagttaca cgggattacg     15180
     ccggggaatg cagatccggc gcgggcataa ttatggaccg ggtgtccctg tacttgttga     15240
     tgggcgtagc cgttcccagc gatgggggat catgacgggt ccatcgtatc gagttaccga     15300
     caatctcagt ttatatgggc tggcgggtgc cagcgttgat cggctgagct ggcatattca     15360
     ggtggatgat ggcgctaacg atgcgcttgg gacggctttg cacactgcgg agcagcagtt     15420
     aacccgtgta tcgatggctt acgccgccgg agtccagctt aacgctggag gttatgtcct     15480
     ggacttctca tataccggtg ttggcggtga tgaccgcagc catggctttt tggttggggt     15540
     tggtcttatt ttttagagtt ttgacatgac gggtaagtgt ggtgcgatta aatgttattg     15600
     gttcgctttg cactttctta taaatcaata agatgtgtat tcattttgtt gttttctctc     15660
     tatggggtgg agaaagcatc cacctgtatc tattcttaat taaagaaaag cctaaggatg     15720
     gttgagatga gataaatgaa taagagaaaa tatgtttttt tattgttttt tatttttccg     15780
     atatgtgctt ttggtgctga tggtgcagag gactctgttc ccgtgtttac caccccgtgg     15840
     tctcgccttt tttctggttc agaagcgaga ttgtctacag ctattactta taatgcacca     15900
     ttgtctaatc aagacaagta tataccagta agttatactg agagtgagac caaaaacata     15960
     tataaccaaa gagtctttgt tagttttcag tactccccat taagctcttt ttttgctaat     16020
     ttgacggtta ggacaccatt gcaaaatatt aatcgttata gagctgattt tgtttatagt     16080
     tttggctatg atgattggag gccaggaaca ttcagcctag tatatagcaa ttatggtgac     16140
     aataataaat tcttcccaca agaaggtgat cgcagaacaa aaatagagca aggaatgatt     16200
     actgcggcat ataagttttc gcttccgaac tcatggaata aaaatatatt gatatatcct     16260
     agtgatagcc taacatgcca aataggctat ttatatggcc caagatatta ctcgacacaa     16320
     gagagtagaa tacggaaagg gaagagtgta ttgcttggaa gttgcgggta tacattaaaa     16380
     cataattatt ttttcagggt ttcgacgttc ttttacccag atagatctca gcaacaacca     16440
     tgggatgcag actataccta tagcattggc tatgtttcag gttatcaacc tggtgattta     16500
     tcaatttcat atagtaacta tagcggaaca cggtattttt ggcgaggtga tcggaatgct     16560
     aactttcgag atgggaccat tagtattact tgggctctcc cattctgaat aaatagtcac     16620
     taagtaacag ggccaccatc ggtggccttt tttatttatg gagtcaatat ggcacgcatt     16680
     accggcatcc taaaagatgg gatggggaaa cctattacca attgtgaaat tgcgttgaaa     16740
     gcgctacgaa cgagcgcaag cgtcattgtt catactgtcg catcacagag ccctggagag     16800
     gcagggctat atgacatggc agcggagcca gggcagtacc gcgtaacgct ctgtgtggat     16860
     ggatatccgc cggagtatgt cggggatatc caaatttacc acgactctcc tgatggcacc     16920
     ctgaactatt tcctagggct cccagtggat ggtgatttac gccctgatgt gatgaaagag     16980
     tttgagataa tggtggccaa agtttcagcc cagtctgctg aggttgaaaa aaataaggat     17040
     gccgccgcag agagcgctcg atcagcactg aatagccagc agtccgccca tagttcagag     17100
     tcggcagccg cggagagcgc cgctgcagca ctggccagcc agaacgccgc gaaagcgtcg     17160
     gagcaattag ctgctagtgg cgcccagtct gcgcaggcca gccagcaagc ggccaaagcc     17220
     tcggagtctg cggcagcaga cagcgctgct gctgcgctgg ccagtcagaa tgcagctaaa     17280
     gaatcagagc aggcagccgc cagtagcgcc ctggccgctc aggccagtca gcagtccgcc     17340
     catggttcag agtcggcagc cgcggagagc gcagctgcag cattggccag ccagaatgct     17400
     gcgaaagcgt cggagttggc cgcgacctcc tctgcggaaa ctgcggcaaa tgatgcagct     17460
     gcaaaagcgg cacaggcaac cgaggctact ctgaaggagg ctgtgcgtgc agatgcagat     17520
     cgtgccgcat ccagcgccac ggaagcgcat tcctctacag agcaggctgc tggatcggca     17580
     agtagtgctc ataattcgca aatggcagct gctcagtcag cgtcacaggc ggcgggattg     17640
     gccgataaag tgaaagcttc agaagctgca gcggcagaga gcgcatcatc tgctgcgcaa     17700
     tcagtgtcac aggcatcaag ctcagccagt gcggcagcag gtagtgctag cgccgcgaaa     17760
     tcctcggaaa cagccgccgc agggagtgcg ttggcggcgg aaggatctgc acagagtgcc     17820
     aaggtagagg ctgatcgtat ctctgggggg ttggatacca agcaggataa atcagaacta     17880
     ctgggcgcga ttgctgcgtt gcaggatgcg gcaaataaga tcgttgtgtt gacggggccc     17940
     agctctgtcg aggctgcgga cttgagtaca tttgctaaat cgctactgag taaaactgac     18000
     caagacagtg ctattgaatg cctagggtta aaagaaaccg taactttagc gggtaatgca     18060
     tggtcaaaaa aatatattgg acgtcttaac aatggcggag cttttgctgg atgtaaccag     18120
     ggaggcattt atgaggtctc aatagggacg ccatcatctg ttgccgactt tccaatgaaa     18180
     aatggaacat atatctatgg ttatggtgtt ttatatgtaa catcaaatag tggtacaata     18240
     tcgcagctgt atatatcaca caatggtcag attgcagcga gaattaagtg gggtgatcaa     18300
     ccaaatttta agtcgtgggc agtttatgac cctaactcca gttttgagta tggatgtccg     18360
     cttattggat cgctaatccc ttgggcactt gagagaatgc ctcaagaaat atggcctaat     18420
     tgtggtatgc actttatccc atacatgggc caatcttttg atccagagct attcccaaaa     18480
     ttacatgatg tgtatcctga caacaggctt cctacagata tgcgggggta taccgcaaga     18540
     gggtgggata atggtagggg gatcgatata ggtcgcgcat tactcagcta tcaagatgat     18600
     gcaatacaaa atataacagg acaatttgga tggatgccat ttaatggatc gtcccccgta     18660
     gcatctggtg ctttttcggt tgataaaatt ggtgctaatg tctggggtgg cggaactgaa     18720
     aggcgtgatt gtgcaattgg gtttaatgcc tctaatgtcg ttagaaccgc agaacagact     18780
     cgggttaagt ctgtagcatg gaattatatc actagggcaa aataattatg ttagataaga     18840
     atggtaatgc gataaacgat atcgtcatga ctgtatatgg tttctctcgt aatgatcatg     18900
     agtttattgg aggttatgat gtcagattat tatcagggac aggaatacca agcgactcca     18960
     ctattctgac gccgccaaag gaaatttcag gtaaaactcg tatttttaac gggagtgctt     19020
     gggaatatat agatgatcac aggggggata ctgtgtattc aacgtcaact ggtgagtcat     19080
     cgcaagtcac gtatcttggt gacataaagc caggatatac cctgataaag ccaagcacac     19140
     catacgatgc gtgggatggt acagcatggg ttaccgatct caatgctcag catgctgcta     19200
     atgtggaact tgctgaacag aaaaagagcc tcctactgag tgaagctcaa gagaaaattg     19260
     gcttgtggca gacggagctg caactcggca tgattaccga tagcgataaa gctgccctga     19320
     ttacctggat gacctacatc aaggcggttc aggctgttga tacctcggcg gctcctgata     19380
     tcgcatggcc gccaaagccg gctggttgag tgattggggt ggggcatgga tgccctaaaa     19440
     tcgcggggca gatcttgggc tacattcttt ttttcactag gcgttatatt gtgctttcgg     19500
     gcgacatatc gctgcaggtg agtcacggag aagagtggcg atcatctatg atgtggggct     19560
     gtccacgctg tacaaaaaat ctccggctat gatgcgataa cttctagaga tggttgccga     19620
     tgcttacgcc attggcggcc aagaccatcc gggatggtga gcaaggttgt atacgtatgc     19680
     tgacgatttc agcgctacag tgtaatatgc atgcctgtag ttgatggggt agttatcgtg     19740
     gagtgtccac cgctgtgtcc atcaaataaa atcaatccgc atagcgagta aataaactca     19800
     tatttatgaa gaatataaga aacttctcca ttatcgcgca catcgatagt taacacctcg     19860
     acaccctccg caaacctccg acaaaaccac ccaaagatcc ccgccaaatc agctatccgg     19920
     caatttatac tgtttgcatg tacagtcaac ctacgacatc ataagtcatg ttttttgtgt     19980
     ccatcagtgt gtccatattc tatgatggac atagtacctc tcgttccaat ggacacacgt     20040
     aggttaaaaa tatgtctatt tcagatagtt atctaaagtc gtgcctcggg cgcgagcgtg     20100
     aaagggttga ggaaaaatca gaccgtgatg gtctgtgggt gcgcatttcc aaaaaggggg     20160
     cggtcacctt tttttaccga ttccgattcc ttggcaagca ggacaagatg acgatcggta     20220
     gctatcctga gttcagttta aaggcagcgc gtgatgaggt tgcgaagtgg gctgcgattc     20280
     ttgctcgcgg cgaaaatcca cgaatcaggc aaagcctaga caaagcgaag attaacagtc     20340
     agtacacctt cgaggagctt tttcgggagt ggtactcaat ggtgtgcatt cagaaagaaa     20400
     cggctgggca gatcctgcgt acgtttgaat tgcacgtttt ccccaaaatt ggcaagtatc     20460
     cggcacatca gctcacacta cacaactggc tgaccgttct ggatcgacta gcgcaggggt     20520
     acaccgagat aacgcgacgc gtaatcagca acggccgaca gtgttattcc tgggcagtta     20580
     aacgccaatt gcttgatgtt aacccgcttt ctgaaatgac tggccgcgac ttcggcatcc     20640
     agaagaaaat gggcgagcga accctaaatc gcaaagagtt ggcgatggta tggcgggcca     20700
     tagaagactc ccgactcatt gaaagaaaca agatccttta taaattatct ctggtttggg     20760
     cgtgtagggt gggagaactc aggctggcag aaactgtgca tttcgatttt gaggagggca     20820
     tatggactgt gccatgggaa aaccacaaga ctggacgaaa gagtaagagg ccgatagttc     20880
     gcccgatcat tcctgagttg ctcccgctac ttaaacgagc tattgagctt gccccaggtc     20940
     gatttgtttt ctctaaatat gaggacaagc ctatgagtga atgctttcac atgagcatca     21000
     gcagtaatct ggttaagttt atgctgaagg cctataacga gcaggttcct cacttcacta     21060
     ttcatgatct gcgcaggacc gcgcgcacta acttttctga gctgactgaa ccacacattg     21120
     ctgagattat gctgggtcat aagcttcccg gcgtgtgggc ggtttatgac aagtacacct     21180
     atatcgatga aatgagagat gcatatagta agtggtgggc ccgactgatg agcatcatcg     21240
     agcccgatgt gttagagttt acgcctcgtc aggtcggatg agtctccctt tgctgtcgcg     21300
     cggaagattc aggtgcgaca tcgggcggcg gactggccgt gacatttccc gaatctgcca     21360
     ctcgtgaact ctcgttttga gccatctgtt tgaaccgccc atgtaagagc agtcaggctc     21420
     agggaatggg tttccgtcgt ctgggcgctt gcggtagcgc tctagggttc ttggcgaaat     21480
     gcttagctgg cagcagatat cgcgagtact catcagctca aagctatcgg tttttgtgct     21540
     catcattttt ccataggccc catccggggc cgttgttgat attcagtgtg tctatgcctg     21600
     cagttctatt tctgcatgta ttcgttgata atcttcatca cttcctcgcc gatcccatca     21660
     cgcaggacca gtgtgcgtcc gtcatcgtcc atctcggcat cgcttaacag ctcaaccagc     21720
     cggcgggcgc gcgtcgcgct aaactggccg ccggtgacgc tgcgcgtgac tttcttcctg     21780
     ccctgagcct ttgcccgttt cacatcctcc tgcagtacat cgccagcgct ttccccgtgt     21840
     tctttgacgc gatcgacggc tacgtccatg gccacctcgc ctgatttcac cagctgctgt     21900
     acgtcatgat tcgatgtact gaggatcagc agtttgtcta cggtggcgcg gctcttgtgg     21960
     atcagcttgg cgatctcgtc cggtgtcaga ttgaatgcgg acaactcctt cacaacgagg     22020
     ctctgttcaa actgcgtcag cggcagctgg ttgttgctgg tcatgatgcg cgccacgcgt     22080
     tctacatcgc tgccagtgaa tgggacgatg gcgatcagtt cgatgggttt gccagcctct     22140
     cttactcggc gatacgctcg aatacggcga tggccctcga cgacccatac gccgccttca     22200
     tcgcgcggac gtacctcaag tggaggcaca accccaccgg aaaacaggaa ctgaaataga     22260
     tcatcatcag cctgctgcgt cctctcatca tcaatacgct tgttaaaccc ttcctgtacg     22320
     tggatattat ccaggctgat gaacattccg ctgtcacggc gagagatagg gccacctttt     22380
     cgggacatct tcttgaatga gttagccatt gctgacctcc tttgtcctgc tgatgagaat     22440
     cagcatgtca cctttggttt tgactactat ggagcgccct ggctgaatag cctcaaggtt     22500
     gaacgcctcg caaaatgatt ctagggccag tgatttatcg tctttcctat tccaccaccg     22560
     ccagccttta cgcaaggcta tggcgaaaac ccattgccac gctttgatgc tcatccagag     22620
     ccagatgatt acaacctgaa gcatgatcat ccaatcggtg gctgagtatt tagcaaaggt     22680
     ttccattaac acgcctcctg atacgcgatg gccatctgtt ctgcgtcatt catagcgtca     22740
     tgaagcgcat ggtgcttaat catctggaag cacggctggt gcccctctaa atagccctta     22800
     cgcccgcggg ttgggacctt ggtatcgatg tatgtcctaa cgtcgcgctt gccgttgtaa     22860
     cgccatggac actccagacc gcacatgcgg taggcgttct ccagaatggc gccatcaaaa     22920
     tctggcccac gaaaaaacac cctggcaccg gggtgataat ccagccagcg agagaggccg     22980
     atcagggctt cgctgagggc tacgcgatcg ccggttagag cttcgtgtgc atcctcggcc     23040
     tggtctttcc accacatctg ggttttttgg ctgacggttc ggcccagcat cagctgatct     23100
     gtggcgtcga gccgggtata aaaagccagc acggagaagt cctgcagatc gatatcgcgg     23160
     gataccttca ggatgttggc ctgggtatcc tccagattgc tgacatctac tgcaaaagcc     23220
     ccgatagaga gcagcagggc gctcggcacg gtatccatgg tttcggtatc gataacgacg     23280
     tctttagtca tcgctggccg cctttgtagt ctgatggatg atttccagat tcagtttttt     23340
     agccagcgcg atacgcgcca gctctttgct ttccccgtgc ttcaggaagc catcttctac     23400
     aatctcctgc aggcgctctt ttgtgagttt cattattcat cacccagcaa ttcagcataa     23460
     ttaataaact caccaaaaca ctgcaactca gcgccagcca tgaaataacc caatgcctcg     23520
     ctgcgtgaat cgcttttgaa ggtgttcagc ggatagcgct cataaaattt gttaatcagg     23580
     tgcgccattt tcagttcagg tgctggctgg tttcccatct tggctcgttc ctgccatgct     23640
     aaccaggcag cgtttttcgc accaactcct gcaattggaa ggttgtcttc gttattccac     23700
     gcgtcgaaca atgctcgctc atctataact gccggcgctg gctgggcggt gtagagtggc     23760
     gctaccggca gcccggagcg ctccgcttca aacagccatg cgtcaacagg atttagtgag     23820
     tgctcgattg gcgagccgcc tgattggtac atcagcgact ttgcccgcaa aaacaaatca     23880
     tggacagagt tgtcgcttat tgcaggctcc aatacaggcg ctggctgggc ggtgtagagt     23940
     ggttgataca atccacgcaa gctcgcatct tctgaaaatg accagcgcgg tttaggattt     24000
     ccgttaatgt cagtggtgcg atatcgccac gccaccggct cagcctccag cgacgccagc     24060
     gcgatgcggg caagttcgcg ctcttcacat gctgtagggg catctccgat gccaagaaaa     24120
     atttgctttg ctcgttcttt ggtaatagtg gtcatgggtt agtggctcct gaatccattg     24180
     caaccgcgaa gaaattcgac gatatatccc ttcatttttt cctgacactg cccagaccat     24240
     ccattcggcg gcgtccaccg ttctacaaga tcggccatct ttttcgcctt ggctggcgtg     24300
     acattgaggg agtcattggt gtgcagctga ttaaccagct tttccatgcc tggtatatcc     24360
     agcacagcaa accatgtgcc attagccatg ccgagtccgg ggatgcgctg cccactacga     24420
     cgtttatctg tgagttctac agtcatgggt tagtccttta caaaaatgat ccagtgggtc     24480
     ttgtcgccct tcccggtgcg ctggccaatc gccggtttct cgtctgtaag cgctaaaatc     24540
     tggcttaccg gtatctgggt ttcattccat ttgaagataa gaacgccttg tggccgcagc     24600
     actcggaagg cttcgcgaaa tccggcgcgt aggtcatcgc gccaggtttc tttgttcagc     24660
     cgaccgtatt ttttacccat ccaggcgttt tcaccgacgc gctcaagatg cggcggatcg     24720
     aatacaacca cagggaaaga agcatcgccg aacggtagcg cgcggaagtc agcaatcacg     24780
     tcatggttta tgactaggct acgcccgtcg caaagggtgt gctgttcggc gcgaatatcg     24840
     ctaaaaacag cgcgctcgtt ctgcttgtcg aaccagaaca tgcggctacc gcagcacata     24900
     tctaaaactg cttgctctgc catctcactc ccccttactg gcgccagcgt ccagccattc     24960
     aaatacattc cagtatttcg accaatcttg ctgatcgtac tcatcagcat cttcattcca     25020
     ttccccagca aatgggtttt cgcaaacaga tgtgagccat aaaccaattg ctggtgattc     25080
     aggattgctc tcgaaaattt cagcaattcg aggccagtga ttgacgtatc tttcgtccac     25140
     ggggaaatca attagatact ggcgaatgca ttgcgcagcg cgggcatagt cttctcgaac     25200
     tacgatcatg ttgtcgtacg tcatcgccag cacagcgcga ttatgttcgg ggatatccat     25260
     gcgtttaggt aagggccaga ctttatcgat ctcccaggtg taagagtttc tggccatacc     25320
     gagatagcgc acagccatat cattccagat aactggggca cttccccaag cgttctgtag     25380
     ctcttccatt ttctcggatt tctcgcctgg ccatactgaa atcactgttg aataactcat     25440
     gcttttccct cccgcagctg ttttgcataa caaagcatga aatttacgtc atcttcgcac     25500
     caaacatttt cactgcattt ttttgccagc atctccacac cctgcgccat catctcgttg     25560
     atgaatgcgt cggtttccgc ggtggttatt ttcgatggca aatatgtgcg cggatgtttt     25620
     aagtcggcgt tctcggcagc cagcgactcg ttttcatcca gcagcgcgat agccgtaact     25680
     ggggtaagga gcttcgtgaa agcattcagt gcatcgatcc gcttatcgaa aggcataacc     25740
     ggagcctctc cggctatttt ggcgtttaac gccgcttcac gcagcgcctg tttgtctacc     25800
     tggctcatgc tgacgcctcc tcacctaatg cggtaaccag attagcgatc agtgctgaca     25860
     gctcgccaga tagcagaacg aaatcggcgt caaaccgctg cacggcatct tctggatcga     25920
     tatcgtcgtt ttggtcgagc agggtgttac tgaacttcag gcgcttaatg gttccgttat     25980
     catccagaac gaactggatg cggtcattcc agcccatagc cagcttggta accatcttgc     26040
     cggcttcgat gtgtacggtg atctcgtcgg tatcgacgtc ctgctgtttc gtgcggatga     26100
     tcccgccgtc ttctaggatg gcttttagct ctgcctcatc acccagggta aatcctgcgg     26160
     atgccttacc ggtgcgcacc cattgggtta gcgttagctc gataggggtt ttcattgtga     26220
     gcggtacaac gggcagggaa ccgaggcttt tacgcagcag agcgagaatg ccttcggcct     26280
     ttttagcgct ggctgcatcg accataacca gctttttggc ggaatcgatc cacagccagc     26340
     tttgatgcgt ccggctaaat gctcgcggca acagggagtg cagaacctca tcgcgcagcg     26400
     cgtctttctc ggtcttcttc agcttgcggc attgctcttg ctccagcttt gcgatgcgtt     26460
     cgcgtaagtg tttttggatc acctcagccg ggagtatttt ttgttcacgg cggtagcgca     26520
     tcaggaggta gccattagcg gcatgaatta ggctgtcagc cgtagcgatc ggagctgtcc     26580
     agccagagcg agacatatcc tggcttgcgc atggggtgaa aaccatagga gcaagggcgg     26640
     cctcgatggc ctttgtatct aagttaatgt ctttggtgag gcggtatatc agtacgtttt     26700
     tcacgttaaa ggttttcact tatttatctc cacacatttt ttaggtacga gtgttcccgg     26760
     cgctgattac ggataatcaa cacgattggc atataaggtg ttcacacaga gaagagctct     26820
     agccggatat actgaataac tcacttcata cttaagtttc aaggttagcg agaacctttc     26880
     tctgtgtgtg ctgcggtggc aggtacagac ctccggcttg gggggaggga gtcgtttttg     26940
     ttatctgttt ggagcagtca tctaaatgca taaaaaacat acaaatgtaa acctttgcgc     27000
     cttgtaaaat taatgattga tattatttta ttaatgtttt acattaattt ctccgttagc     27060
     agaacttgta tgaggtcagt atgtcaccac agaagctttc taggattagt caacacatgt     27120
     ctacagcatc tcttttcatt atcattttta tgttaggatt caatagccta ttttggatat     27180
     ttccttcact gttgtcagat agtggtggat atggccttac agcacagatg atgggcttaa     27240
     ctaattttga aatgctaccg tggtggaaaa tcactggcgg aattatccta tcaggcattc     27300
     cattagtctc attatcttat gggctatatc agttacgagt tctattccat acttattcta     27360
     aaggggatta tttttccact aacgcggcaa ggttattagg ctctgttggt aaatcaataa     27420
     ttatttggat tctattaaat atattgtgcg aacctttgct tagttattgg ttgacatttc     27480
     aagaacctat tgggaataga gttatttttg tcagcattga ttttcaatat attgccgctg     27540
     tttttttcgc attctgcgtc atattaatat ctgagatatt aaaaaaagcc agcgttatta     27600
     atgctgaaaa ccaacaaata atatgaggct atcacatcat gtctattatt gttagattag     27660
     atgtcttgtt agccgagcgc aaaattaaat caaaagacct tgcctctgca ataggtatca     27720
     cagagcagaa catatcaata ctaagacaag gaaaagttaa ggggattcgt ttctcaacat     27780
     tagaagcgat atgcagatac ttaaattgcc aacctggtga tttattaatc tttaatgacg     27840
     aagatgattc aaccataact ggttagaatt gtatcaataa tttattaata caaagtattt     27900
     cttagattag taaggcccat ttcatcttta agtgggcctt tgttggtagt aaagctctgt     27960
     aaaattgtgg ttttagctga accataacgc ccctcatcct cacctcgttg taggtagtgc     28020
     tacttgtcat ccatatagac actcacaaat gcctatgtgg atggctatca gactggtcac     28080
     acccatgctt ccacatgcgt ttcacccctc gcactcgtca catctgctga tatcagcctg     28140
     tgagtctaag cggtcatcga gttgcagtgt tccgtctcga tgagtaaact ttaagacaac     28200
     ttaaaatgca cgtcaagaca ttcataaaga aaacttaaat attttgtgtg attggttttg     28260
     cagggtgggg ttttatgttg atggcgcccc gcggggcgca gtgttatggg aggttggtaa     28320
     tcttggcatc aacgacaacg ccgatgatct ggcagttccc gttgatctct atcattgggt     28380
     attgtgggtt tagcggcttg aggaatctcc gccctgaatc gatgaccagt tttttgaacg     28440
     ttgcttcatt gtcattaact agttttgcca ctactaattt tccgttatcc ggggctgctt     28500
     ctggatcaac gagaatcgcc ataccctctg ggatgctcaa ccccacaggc gatgtcatgg     28560
     aatccccctt aacatctagc cagaacgatg atgcgtggca ttcctctgta gtcccatacc     28620
     acctgtctac agccattatt ggatacgcct ctattgcctc actccattgc ccagcactta     28680
     cccagctgat cactgggtac atccctttct gcgttctctc ctttctgaat tcaatgttgt     28740
     gatctacatc gccaccatta accaggtatt cggcgctgca ctgtaaggcc tcagccaagt     28800
     taagaagggc gtctccccgc ggggatgtct catcacgctc ccattgagag atggcaacgt     28860
     tagagacacc aaccgcctta cttaaagaca cctgacttag cttcagctct ttcctccgct     28920
     tatggatgcg gtaccccatg gtttcgcttt tcatagttaa gacatcttaa atcttgttga     28980
     cttaagaatc ctttatatcg ataattgaag aatacttaaa tatggaggta aacatgctca     29040
     agaaagcagt tattgagcac ttcggtagcc agcatgcagt agcgaaggct ttgcaggtca     29100
     gtgactctgc tgtctctcag tggaaagggg tgattcctga gcgtgctgcg cttctggttc     29160
     accagatcac caagggaaag cttaagtact caaaggattt ttataaaaaa atcacctaaa     29220
     caccaccgct ctttaacgga cagatataga acgtgatgac ttcagtttag ttgcaatcga     29280
     tagaacagca cacccaccaa gggacagaag agatggtaga catcaagaca acgatcaaag     29340
     agatgtgcaa ggcgtatcca ggaggtcaga aggcgatggc cgtacagctt ggcatgacct     29400
     atgacgcgtt ccgtaaccac ttggatcaga agtgcgctag tcggttcttc acgctggcag     29460
     agatagagct gatggaggac ttatccggga cgtcactgct ggctgagtac cacgccgcac     29520
     gccggggaaa actgctggtg gacattccgg tactggagca gatcgacaac gtagagctgt     29580
     atgagcattc catgagagag attgcagccg atggtgagct ggccaaagca aaggtagagg     29640
     ctgtggctga tggggtgatc tgtagtgatg agaagcagga gttgacgacg ttgttctgga     29700
     agaagatgcg caatcacgcg tatggcttct tcgcgttcat ggctctgaat ggggctgcga     29760
     ttgctgatga ctcagcggta tgggtggcgc accgggaatg ccgtcccagt gcgcctgcgc     29820
     ataaaactct gtgtggagat taaacgcatg aacattttaa acccaaaacg cccatcaacg     29880
     caatttcggt gccggattgt cggtggccgc ctgagctatg agcaaatcgt agcggcatcc     29940
     aataggccag gcaacaacca acctcgccga ggtttggtag tcggtcgagc tgccgttgat     30000
     gcggcctggg gtgagtttta cgggaacggg aggatccatg gctaagtttc cgagggttgg     30060
     ccatatgtac aaagatcgct atggccatac cgtgcgcgtg gtatccacat gcgctgatag     30120
     gcagcgggtg gcatatcagc tgaaggggta tgagtggacg attaacgcgg ccctgatcgt     30180
     gtttaacgcc cgtattcgga gggatgcggc gtgagtatga ctctgatggc aaaggccatg     30240
     gcgattaagg tcgggaatcc tgtccgtaag ctcgtactta tcaagctggc cgataatgcc     30300
     aatgacaacg gggagtgctg gccgtcatat cagcacatcg ccgatcactg tgaatgcagc     30360
     aagagcgcgg tgagaacgca cattgaagcg ctaataggta tgggcttatt ggtgaaagag     30420
     aaccgcatcg ggaataacaa cgggaagggt aataaatcga acgtttatta cctgaacttg     30480
     aatgccccta tgtcagcaga aagcacaccc cctgtgccgt caaaaagcat agcccctatg     30540
     tcgtcaaaaa gcacagctat gtcatcaggc gacaccccct gtgccgccac gtggcagacc     30600
     cctgtgccgt cagatgacac cagaacctat cagttagaac cagtcataga acctattggg     30660
     gaaaaacaaa catccgacag gaaaattaaa agggctacgc aactgcctga cgatttcaaa     30720
     ccgagtgatt ctcaccgagc tatggccagt gagtttggcg ttgatatcga tctggagctc     30780
     gcccagttct gtgattatca cctagccaaa gggaccacgt tcaaaagctg gcccgccgca     30840
     ttcaacacct ggctgcgcaa tgccaagaag ttcgccggca atcgcgggca acgagccaag     30900
     tccgaggcgg caggagatac cacgctgcgt gatgctgcgt tccgccggtt tatcggatcc     30960
     gctctcccac tgcgtgagcc gtcagcactg gagcaggcag cccgtaaggc ggccagcatg     31020
     gcgaacgtca gcaagatgtc accggagtgg gcgcagaagc gctggaacag catttggacc     31080
     gaagtcgagc agcgccaggg cgcagcaggg gaggcagcat gagcataaaa aaatcggcca     31140
     tggccacagc acactgcgag cgtgcggagg cgttggcatc gcgtgggttt taccgtaggg     31200
     cgatcactga gctgaccgcg gcggccatgt gcgccagtgc gtcacagatc ggtggcgttg     31260
     tggagcgccg taacgagcta tcgcgccgtg tgcgttgctc ccagcgtgtc agcggtgatc     31320
     cgcgtatgga ctatgacaac tgcgtagggg gcgtgctgtg agcattaaat ccaatacccc     31380
     ggcagaggct aaggactgct ggcagacccc gctatggtta ttcgatgcgt tagatctcga     31440
     gttcggcttc tggctggatg ctgcggcgtc agagagcaac gccctgtgcg ttaaatatct     31500
     gaccgaggta gacaacgccc tggggtgtga gtgggagagc gcgggagcta tctggtgtaa     31560
     tccgccatac agcaagatcg gcccctgggt agctaaagcg gcagagcaga gcgcgcggca     31620
     gatccagacg gtagtgatgc tagtcccgga agatatgagc gtgggctggt tcagtgaggc     31680
     gctgaaaacg gtcgatgagg tgagggtgat caccggtggc cgtgtcaact ttgtccacgc     31740
     tgtgacggga gcggagcaga aggggaatag caaggggtca atgctcctga tttggcgtcc     31800
     gttcaccacg ccactgcatc gtatcactac ggtctcgaaa tcgatgctgg aggctatagg     31860
     ccgtccagta aggagtgcgg cgtgaggctg taccccccat tcccacctag cgttaacact     31920
     tactggcgcg ccccctcgcg ggggccgctt gctggccgtc acctagtgag cgccagaggg     31980
     cgagcattcc acaccgaatg tcaggcccgc gttctggagc agctgcgccg ctatccgacg     32040
     ccgatggccg gcgatctgtc tgtgcatgtc gtcttgtacc cgccgacccg cgctcgccgt     32100
     gatctggata acttcttcaa ggctccactg gactctatga cgaagatcgg tatctggcat     32160
     gacgatagtc agatcaagcg catgacggcg gagttcggcg aggtggtgaa aggcggctgt     32220
     gttgagatcg tgatccagcc gtttacatcg atgcctaaaa aactgccgac gtaatagtga     32280
     tcgccgatca ataaggtagg attaatatcc tatattaatc aataaattaa gttcacattt     32340
     tgcgccattt ttttctgaaa actgtatgta aatccagtac aataaacaag ccgccagacc     32400
     atgccgggtt ggcggcaatt cccacagtgt ggaggtgccg atgtatccga ttttgcccgc     32460
     taatggcgct cttacgatgt ctaccagaga gatcgccgag ttgaccggta agcgtcatga     32520
     ccatgtttta cgcgacgccc gcaatttgct ggccgaactt caatctcccc aaagttgggg     32580
     agattaccaa gatggccagg ggcgcactta cccgatgatc ctgctggata agagtcagtc     32640
     gatctgcctt gtagccggtt atagcgctaa gtaccggatg gccattatca gccggtggca     32700
     ggagctggag cagtcagcca gaccgaaaag ccagttagag atgattgctc agatggccat     32760
     ggaggccgcg cgcattgagc gtcaggttga ggcagtgcag caacaggttg cgctggttga     32820
     tcagcaggtg aaggacatcg ccgccggcgc cattcctcca ggttggcaga ctatccgcaa     32880
     cctttctgcc gaaagcgggc tatccgagca gaagacacgc gatctgatca aggcgtttgg     32940
     cgtccgcagt aagaaggtcc cgttcatgac cccgggtggc attgtgacga acgcgaccgt     33000
     tgccgatgaa gaggacttcc tccgtgccgt tggcgttgtc atccatgagg ccaccaggcc     33060
     gatgcgtagc aagtactggt atcacccgaa gctggggcgg tttgaacgga gggaggtagc     33120
     ctgatgcgca tgctgtttac cgcatacccg cagcggagtg caggcgttgt cctgctgaaa     33180
     accggaaaac tgacgcgccg tttcaccgat ggccagcgcg tgatgctggc cgatgtaccc     33240
     gcggcatttc atgatagccc cgccggcgaa ttggtatctg accaactgat tgctgcggat     33300
     cctgtgtggc gccccttttt tgcacatgat cgcgtgcaga aggctgccag tctgtacatg     33360
     aacttttcgg aatatttgga aagttttcac tactgccagt ggaaaggtgt gcgtgatgga     33420
     taccatgaca tacagctgac caatacccat ggcgagcatg gcggcgccag gctgtgttgg     33480
     acctgcgaca acgccatgcg cgggactgag ggtgcgcttt ttacagcgct gtgcgagaag     33540
     aaccgcgcgg agtgggtaat cgagtctgcc cgccgtgggc tcaagctgcc ggaagggcat     33600
     cagctgactg agccggaatt gtgttggtgg gcgctggtat tcggtgtggc tgaccagatc     33660
     cccggcggca tcgcgcgtcg tattactggt gtcgagctgg aggagatcac tggcgtgatg     33720
     agtgagtcaa ccatcatccc ggatcggcca acggctcagg gcgtgctggc cgctgcggta     33780
     gaagcagcag aggccgtaat cccccaggag aaaatgaagc cggtgatcaa gctggcggct     33840
     gatgaagcgc ccgcggcagg ctttatgctg cgccccaagc tgcagcgctg ggagtgcccg     33900
     acatatttgc gctgggtgaa gactcagcag tgcagtgggt gcggtagttc tgctgacgat     33960
     ccgcatcaca tcatcaactc aggtctgggg ctgggcggtg tcggaaccaa gacccatgac     34020
     ctttatgtga tcccgctatg ccggcggtgt cacgacgagc tgcaccggga cgtaagcgcc     34080
     tgggagcggc agcacggcag ccagatagag ctgctagtgc aattcctcaa tagggcgcta     34140
     ggtatcggcg ccatcctgaa agcgtaatgt gtggagagcg ctgaacatga ctttgaaaaa     34200
     ttctcagaag ggatcggcct cgcgtgctaa taagcaaaac gcgtgggtga cggtagcggg     34260
     ggcgccgcgt cgctcttatt tagggaagta tcaccggcta acaccagctc aaagccgatg     34320
     ggtccgttcg cttttaaacc agtggggtgg gatgtatggc ggtagcggtg tagagcacct     34380
     ctctggcggt gggggattgt ggtcagtgat tttgacaggg tggacaggag agcagcagga     34440
     gcggatcgcc tctgtcctgt ctgacctgcg caggatggga tacagcggac aggcactgtt     34500
     tgaccatgcg aaggccatta tatggcctaa aaaatcactc tctagcttga tcggtaaggc     34560
     cgtggatgag gatgaggccg agtttatgga ggcggttatc ctgaagtcat tcgcgttatc     34620
     tagccctgtt tatgtgatcg gtaaggatta ctacacccgg cgcaacacga tgaacagtat     34680
     ggccaggtgg atgcagcagc attacgcccc tttcttaacg gagaagcagt gcattgatcg     34740
     ggttcggtgg tgtatcgagt tgttcaattc tgcagtctac ttcacgctta tgagcgagct     34800
     gtgcatcgaa aatgcagaaa cttgcaaaaa agacttgaaa acaagttttg aagctgcata     34860
     attaagttac gcttagcgaa gctgcgccgg ctcggcagcc agcaaaagcg aaacgaattt     34920
     gattaacccg ccattgagcg ggtttttcgt ttttgtccgt agcagtgctg gtatacgatt     34980
     aaaacgatgc cgatgggcgc gcatcgtggg tttggtttgt caataagcga taggtcatcg     35040
     ctcagtccag aaaacttttt ttatctttaa ccagaaatcc agaggatgtt ccttctggat     35100
     aatccattag cctgttaatg aatgtcttta aatcattacc gtgatgcaat gatgttagtg     35160
     aattgttgat gtcgctcttg agctccctta ccagatggcc tgatgggtcg atacgctcaa     35220
     ttgtttttac tatgttgtga aatataaggc taacggcctg ctctctgaca accatcatta     35280
     tttttatttg atctaactct gatttcgtct cgtaatccat gccgcctccc cgaccatgat     35340
     taaccagcca taccttaaat atctatttca aagtatagat taaccatggc tcgtcagcgg     35400
     ttgcgatgac caatatctac tttccaatga gtggccatta gtggcgcgct ctctgcttgc     35460
     ctgggtgagc aatcaactat cgcccagcgt tcgctgagcg cgaacaaaag gagctatcca     35520
     tgagtgatcc gctaaccggt acggggtcgg ctgccggggc gttggctggg gttacgtttg     35580
     tcgggatctt ttccggtgcg gacgctggcg tagtcattgc ggcgtttgcg ggggccgttg     35640
     tgtttgtcct atcggctgtg gagtttcccg cgtggaagcg catcgctttt ggctttgtgt     35700
     cgttcctcat gggggttatt gcggcagggt ttacggcgtc gatcatcgat tggtttcttc     35760
     ctgatcaggt cgtagtcgat aagccgattg gtgcgttggt ggccagtgcc tgcgttatct     35820
     gggtgctgat gttcatcatc tcgaaagcca agaacccgcc gcccctgaat tttaaagggg     35880
     gtggcaagtg acgatcgatc tgtttctgct tcacatcaat gcagctgtgt gcgggctaat     35940
     cgccatgcgg ctgctgctgt ttcgtcgtaa tggctcgcag cataagcgcc ggggcgctgc     36000
     tctggcctat gtgctgattg tggcgtcggc atcggtgacg ttccgggtgc tgatcggcgt     36060
     gtatcacgct gtcgacatat ccgagacgat catcaacgta tttctcatgg cgctggtgat     36120
     gagagctaag gggaatgtta tgcagttatt tcggggagct tcgcgatgac caaagatgaa     36180
     atttttgatg ggctactcaa gcgtgagggc ggatacgtta accatcctgc tgatcgtggt     36240
     ggcccgacga attggggtat tacagagaaa acggcgcgag caaacggcta taccggtgat     36300
     atcagcatgc tgtcacgcga tcaggcgctg cgcatctatc gcgcggatta ctgggaaagc     36360
     ccgcgctttg atctgatcga cgttgtttct cagcctatcg ctgtggagct gctcgacact     36420
     ggcgtcaaca tggggccatc ggtagcagcc aagatgttac agcgttgcct tactgctctg     36480
     aacgatggag gccgccttta tcctgacctg caggttgatg gggctatcgg taatcgcacg     36540
     gccaacgccc tgcgtgccta tctcgcaaag cgtggccatg acggtgagac ggtattgctc     36600
     aaggcgctga actgctgcca gggtgctcgc tacatcgaac tgtcagaggc gcgcccagct     36660
     aatgaggcgt ttctgtacgg ctggctacgt gagcgagtcg ctctgtctta accatatctg     36720
     aagtgtatcc aagagcctcg gctatgccgg ggctttgtcg tatctgcgcc atgcccggca     36780
     caaacaatca cacagagcct tatagaaaca ggcctcggag aaacgccgtt ataggtggcg     36840
     acctctctgt gggcgacgtt tctgggcaac gaggcttgtt tctataaggt aaccatcgat     36900
     atgaacacat ctgtagcatc ttcttatact gacgcatcaa gcaatcatca tgtcgttaat     36960
     gagttcgctg acattgttcc tgttgtcagt ggccggatcg gtgagcgtga aaccaacgtt     37020
     gtgagcggaa cgtcgttaca caaggcgctg ggagtggcaa cccgaatgac ggattggata     37080
     aagcgtcgta tcggggagta tggctttaag gaaggtttgg attacatcat tgttgaaaat     37140
     ttgcgctccc caaatttgag tagctcaaaa tctcgccagc agatcagcca tgaatacatg     37200
     accacgttgg atatggccaa agagctggca atggtcgagc gtagcgaaca agggcgcgcc     37260
     attcgtcgtt acttcatcca gtgtgaagag gcgttacagc tcaccgcccc agaggtcgcc     37320
     gcgcgttatc gtcgcaagtt aaaggctcgc atcggagtgg caaacctgtt taagccgatg     37380
     tgctctgcgt tggaatcggt aagggctgag cagggcaagg cgacgcagtc tcaccactac     37440
     agcaatgaaa gtaacatgat ctcccgcatc gtcctgggtg gccttactgc gaagcaatgg     37500
     gcaggcatga atggagtagt gggggatcct cgcgattcga tgaatgccga gcagttagag     37560
     catctgtctt atctagagag taccaatatc accctgctgg atatggggat ggattacccg     37620
     cagcggaagg ttgagttaac ccggctatct cagcgctgga tggcgcggcg cctgggttcg     37680
     tgacggcttt tgtttaacac cactacaaaa atagcggtgg cagtgttcag gccttgaatg     37740
     atgcgaagaa aatcgcatcg gtcatcacta tcaagggtgg gattacatgg ttggtgaacg     37800
     gttatggaag ccactggcgc taatcgcgtt ggtggctttg tcgtattggg ggctttcgtc     37860
     ctggcggtac gccgttggcc atgctgatgg aaagggtgag gctgatcgaa cgtggcaggt     37920
     taaatggtcg cagcgtgatg ctggggaagc ccaagcgatt acagacaacg tgatgctgac     37980
     gctcaacatc atgaatcagg cggtggaggc taatcgaaat gcaaagcacc agatcgcact     38040
     ggagtcacag agagccgcga gcgacatcaa ggctgctgtt gcggacgatg attgcgctcg     38100
     ccggcctgtg cctgctggcg ctgctcagcg gctgcgtcag tacgcggaca gtgtacgttc     38160
     cggcgccagt gccaccgatt agcactgagt taactgccga tacgccagtg ccagcagtac     38220
     ctgatccgct gacctggggg gccagcttgg atttgaatat taatcttcta tccgcgttag     38280
     ggcaatgcaa tgcggataag gcggggatcc ggcgcgtgga actgatgcgc gcctctcctg     38340
     caacaggcaa taaaaatcat atcgacaaca gaggtaatga gtgatggaga aagcagtgca     38400
     gattgcggta aacgccccgg cgtttaagtt cgacctgaat cagatggtca atgtacgcgt     38460
     tagtgatgag ttcggcgagg tgcgtgggcg cgctcagtat gccaatgctg agaaccaata     38520
     ttacatccac taccgcgccg ctgatggccg tgcaacttcg tcctggttcg atgaatccct     38580
     gttggttgct gcagaggatg atcgccaccc tggttgccct atctatggct gtgccgaaat     38640
     gccggaaggg gcgacggtag aagacgagta agcattacaa caggccttca gtggggggtc     38700
     tgtgataatg tagacttgtg ttttttctga gcgccccatg tatagaaaac tatcattgtg     38760
     gtaagtaccc aaaatggagg acttatgctt caagattatt tttcacattc tacatccgat     38820
     caagagcgtc gcttgctggc agtacaggca gctttagaga ttgtaaaagc ttctgttggc     38880
     tctcctactt cttatactgg tggtaaagct tttgctgatt ttaaggctgt aactgaaggg     38940
     gttggctcat tagctgatgc tatccaggat gcgctggaaa gcaatgatga tgaataattg     39000
     ttattcctaa ttaataaccc gctgcggcgg gttttttatt gttattacca cactcagagc     39060
     aattatcgtt acagccaggc cgccatgtgc ggcctttttc atgggggtat gtatgacgtc     39120
     atcaccgttt caattcacgc gaggacgccg ctgcagctat tgcggttcgt taacgcatat     39180
     cgttcaattc tgccccaaaa cgtatgcggg gcgctcgaat atagagagcc gtgagcgggt     39240
     taagcagctg gttaacagca cccgtaacca ataatcggtt tgcgccgcct gtcgccgtgt     39300
     cctcgcctta accgagacca tgccatcctt catgtgagtg ggtggggtca ttcaaaaaca     39360
     ggtaacgccg gggtggttcc cacatgctcg ccagctggag cgatggcgga agaatccagt     39420
     gcaccaatca acaaatgata accattatca aaaggtactc cctgagggtg gccctactgc     39480
     gggtcacgcg ccacgcggcg ggcggctagt ttttgcactt tgatcgccat catcagcacc     39540
     tgccgtaata tcatgattaa tatataaaaa atatagatcc atctggtgag tgtgttttgc     39600
     actgtcgcca ggtgcatttt tcttattcgt tgaattttaa tgcgaaattg tgttttaagg     39660
     tggtgaatcg gggtgtgaga tgggaactgt tgacgatctt ggcactgcct ttgcgtggag     39720
     tatctctaag atttcagagg ctttttctct tgatcgggcc acagtgcgca aacggctggc     39780
     cgaagctggt gtagagccag ccggagagag tagagggaat tccctatatg ctctccgtga     39840
     tgtcgggcca gcgctgtttt ctactaatag cgctcctgct gatatcgatg ccattcaaaa     39900
     ccccgcattg atgccaccaa aggaccgtaa ggactggtat cagtccgaga atgagcgcgt     39960
     gaagctggag gagagtacac ggcaactgat cccggagtct gaggttgtgt ctgtgttttc     40020
     cagtatgaca aaagccgttg ttcaggtgct tgaaaccgta ccagatcttc tagagcgcga     40080
     ttgcgcattg tctccgcagg ctgtctcgca tgtccaaaat gtcattgatg atctgcgttt     40140
     tacgctggct gaacgcacat accatgcctg cgcatcggat ttggccggca gtgaggaggg     40200
     gctaggggag gactgatgta cgcatccgca aaaatgatag ggcaggattt atcggctcga     40260
     ttaaagccgc cgcgtcgaat gagggtatcc gaggctgttg ggaagtatat gcgagtgcca     40320
     aagagtgcag gcaactctgt cgcttgggat ccgaatgtgt cgccgtatgt gctagagccg     40380
     ttggattgtc tgtcgtcgag agagtttgat gcggtgattt ttgtcggtcc cgcccgaacg     40440
     gggaagaccg tggcgctggt tgatggatgg attgtttata acatttgctg cgacccgtcc     40500
     gacatgctga ttgtgcagat ctctgaggag aaagccaggg agcattcgaa aaaacgcctt     40560
     gaccgtactt tccgctgtag cccagcagtg cgccgtcgga tgagcccgcg ccggaatgac     40620
     aataacgttc atgacaaaat tctacgtgat ggatcctatc taaaaattgg ttggccatcg     40680
     gtaaacatta tgtcgtcatc agactaccgc tttgtagcgc tgactgacta tgaccgtctg     40740
     ccggaggaca ttaatggtga gggtgatgct tttagcctgg catctaagcg caccacaacg     40800
     tttatgtcgg ctgggatgac tctggttgag agctcgccag ggcgagatat tgtagatacg     40860
     aagtggaagc ggacgacgcc acatgaggcg cctccctcga cggggatctt gtcactctac     40920
     aaccgaggcg atcgccggcg ctggtactgg ccatgtcccc actgtggtga gtttttccag     40980
     ccgattatgg agaacgttgt cggctataga gataacccgg atcccatgga ggccagcgag     41040
     gcggctcggg tacagtgccc acactgtatg gggctgattg aaccgcatca aaagcgtgag     41100
     cttaacgcgc gcggcatctg gctgcgcgat ggggaaatta gctatgccga tggtgagcgt     41160
     agcggaacgc cacgtcgatc tcgtatcgcg tctttttgga tggaggggcc ggcggcggcg     41220
     taccagacct gggcgcagct tatctataaa attttgaccg ctgaacagga gtatgaggcg     41280
     accggtagtg aggagacgct gaaaacggtc atcaatactg actgcgggca gccgtatatg     41340
     ccgcgccgtt cgctggaaag ccgcaagagc gatgtcctta tggcgcgtgc ggaagtgata     41400
     gagaagcgcg ttgtaccgga aggcgtgcgc ttcctgatcg cgacggtgga cgtacagggt     41460
     ggtaagaatc gtcgttttgt cgtgcagatt atcggttatg gcgccgatgg cgagcgctgg     41520
     gtagtcgatc gctacaacat ccgctattcc atgcggttca atgagaatgg ggaaagtcag     41580
     ccgattaatc cggcttcatt cgctgaggat tgggacctgt tgagaacgga tgttcttgat     41640
     aaaacctatc ctttggagtc atcgccggat attcgcatgc cgatattggc gatgggggtc     41700
     gattctgggg gtgaagatgg cgtcaccgat aacgcctaca ctttttggcg ccgttgccgc     41760
     cgtgacggtg agagtcggcg tgtctatttg ctgaaagggg atagcgtatc ccgcagcaag     41820
     ctgatctcgc gctcttaccc tgacaacaca gaccgctccg accgccgtgc aaaggcccga     41880
     ggtgacgttc ctatctatct gctgcaaacc gataagctca aggatcggat ctctggtgcg     41940
     ctatctcgcg atattcctgg accaaattat attcatttcc ccgactggct tggggagtgg     42000
     ttctatgagg aattgacgta tgaggagcgc gatatcagcg ggaaatggcg caagccaggg     42060
     catggcgcaa acgaggcgtt cgaccttttc tgttacgcgc atgccatcgc cattcttcgt     42120
     gggtatgaac gtattaattg ggagagccct cccgtgtggg cgcgtttacc tactgagcca     42180
     tcatcaaaac cagtaacgca gcccgcgtcc gaagaaaata aaccggttaa cacaatcaat     42240
     ttcgaggccg tcctcgcggc gccaactgtt gttcctgata aagagattaa gggagggtgg     42300
     atactgtgac gcgagaagaa ttggagcagc ggcgccaggc ttatttggag gctgagcgcg     42360
     ccgtgttaat ggggaagtcc atctcaatta acgggcagga aatgacgatg gaaagcctgt     42420
     cggtgatccg caaggggctg gaggatatcg acgcgcaact acgagctaaa acccgacccc     42480
     gcagtttgca ctcagtagcg aggttctaat gggtatcttg gggaagatgg tgacggctat     42540
     tgcgcctcac tggaagttgt cacgcctacg cgctcagcac actattcggg cgtatgaggc     42600
     ggtcatgcct acgcgtacgc atcgagcgca ccgagaaaat cgctcaccta atcaagccac     42660
     gcagtttggc ggcaagtcat tgcgcgagca agcgcggtgg ctagatgaaa accacgatct     42720
     ggttatcggc gctttggata aattggaaga gcggattatc ggctcacggg gaatcatcgt     42780
     tgagccacag cccctaacgc cggacggtgc gttaaataag gagctggccg aagatatccg     42840
     catggcgtgg gccgaatggt cggtagctcc agatgtatct ggtcagtata cgcggcccgt     42900
     gttggagcgc ttgctgttgc gtacctggtt acgtgatggc gaagtgtttg tgcataccat     42960
     ctgcggatcg gcggtggggt tatctaaggt tgccggtgtt ccttgctggc tggaggcgat     43020
     ggagccggat tacgtgccgt taggcatgag cgatcaagaa acgaatctgg ttcaggggat     43080
     ccagtttaat aactggatgc gtcctactgg ctatcaagtc tataagacgt atccggggtt     43140
     tggcgttggt ctcgctgata ccaaggtaat ctctgcagat aatatgctgc atctgaaatt     43200
     tacccgccgg ttaaatcagg ctcgcggggt gtcgctgtta tctggcgtca ttattcgttt     43260
     ggccgatctc aaaaattacg aggacagcga gcgtattgcg gcgcgacttg gcgcggcgtt     43320
     tggcgcctat atcaagcggg gtgacgcaca gacctttaat gacgacaact acgaaaaagg     43380
     caaagagcga gagctgaata ttacgcctgg gatgatcttt gacggccttg gtccgggtga     43440
     ggatatcggg atgattaagt cagatcgccc gaatccgaat cttgagacgt tccgcatggg     43500
     gcaattacga gccgtcgccg caggaacccg aagcagcttt tcctctatcg cccgtaacta     43560
     cgatggcaca tacagcgcgc aacgccagga gctggtcgag gcgcaagagg gttacgccat     43620
     cctgcaagat gcctttatcg ctgctattac tcgcccgatg tatcgccgct ggctgtccgc     43680
     tgcgattgca gctggccgta ttactgtccc gcgcggtatc gacaaagaaa cgctattcaa     43740
     cgccgtttac agcggccccg ttatgccgtg gattgaccca ctcaaagagg ccaacgcctg     43800
     gaaggtcatt cttcgtggcg gcgccggtac ggaaagtgac tggatccgtg cccgaggcgg     43860
     aaccccggca gatgtgaaac gtcgtcgtaa ggctgaaatc gacgaaaaca gagagctggg     43920
     gctggtgttt gataccgatc cggctaatga cacaggagga gatcccagtg gtgggaaaga     43980
     agaaccaaat catgagtcca aaggggatgg ccgcactcgg agccggacgc ggtagtaact     44040
     ggtacagcat gaaagccagt gcggaggata cggcggacat cagtatctat gaagaaattg     44100
     gcgggtgggg tatttcagcc cgccagtttg ctgaggagct gacagcgttg gggcaggtga     44160
     accacattaa tctgcacatc cactccccag gcgg                                 44194
//

If you have problems or comments...

PBIL Back to PBIL home page