(data stored in ACNUC8465 zone)

HOGENOMDNA: ENINT1_10

ID   ENINT1_10; SV 1; linear; genomic DNA; STD; FUN; 234890 BP.
XX
AC   CP001951;
XX
PR   Project:42703;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Encephalitozoon intestinalis ATCC 50506 chromosome X, complete sequence.
XX
KW   .
XX
OS   Encephalitozoon intestinalis ATCC 50506
OC   Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-234890
RA   Corradi N., Pombert J.F., Farinelli L., Didier E.S., Keeling P.J.;
RT   "The complete sequence of the smallest known nuclear genome from the
RT   microsporidian Encephalitozoon intestinalis";
RL   Nat Commun 1(6):10-10(2010).
XX
RN   [2]
RP   1-234890
RA   Corradi N., Pombert J.-F., Farinelli L., Didier E., Keeling P.J.;
RT   ;
RL   Submitted (22-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Botany, University of British Columbia, 3529-6270 University Boulevard,
RL   Vancouver, British Columbia V6T 1Z4, Canada
XX
DR   StrainInfo; 819376; 0.
XX
CC   Linear chromosome is missing portions of the telomeric regions.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..234890
FT                   /organism="Encephalitozoon intestinalis ATCC 50506"
FT                   /chromosome="X"
FT                   /host="Homo sapiens"
FT                   /strain="ATCC 50506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="nasal tissue"
FT                   /db_xref="taxon:876142"
FT                   /culture_collection="ATCC:50506"
FT   gene            complement(36..2475)
FT                   /locus_tag="Eint_100010"
FT   rRNA            complement(36..2475)
FT                   /locus_tag="Eint_100010"
FT                   /product="5.8S-23S ribosomal RNA"
FT   gene            complement(2516..3808)
FT                   /locus_tag="Eint_100020"
FT   rRNA            complement(2516..3808)
FT                   /locus_tag="Eint_100020"
FT                   /product="16S ribosomal RNA"
FT   gene            <4118..>4354
FT                   /locus_tag="Eint_100030"
FT   mRNA            <4118..>4354
FT                   /locus_tag="Eint_100030"
FT                   /product="hypothetical protein"
FT   CDS_pept        4118..4354
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0110"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E8"
FT                   /protein_id="ADM12333.1"
FT                   /translation="MSEQREEKPLYMLKSTGPGRKKRRRGDPFIDCYLKGDPSTRCTSD
FT                   SSEGRPDIGDAVIYRSDLDSGDEIIYLSELLQG"
FT   gene            complement(<4393..>5448)
FT                   /locus_tag="Eint_100040"
FT   mRNA            complement(<4393..>5448)
FT                   /locus_tag="Eint_100040"
FT                   /product="Cdc7-like cell cycle protein kinase"
FT   CDS_pept        complement(4393..5448)
FT                   /codon_start=1
FT                   /gene_family="HOG000193450" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100040"
FT                   /product="Cdc7-like cell cycle protein kinase"
FT                   /note="similar to ECU10_0120"
FT                   /db_xref="GOA:E0S9E9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E9"
FT                   /protein_id="ADM12334.1"
FT                   /translation="MEEEKIPESDLKHLSFIIPKYTPIEKIGEGSFSVVYKALDAEAGR
FT                   HVALKVITRTSSPARVLEELTFLKALEGKRNCMGLLGVFRNEDQVIAVFPYFKPIDFRE
FT                   FISNAGLNDIKQYLYNLLEAIDHVHGNGIIHRDLKPGNFLYNKETGRGMLIDFGLAQYE
FT                   DRREEHLPKDSSKPQTPLLFFNSIVSKTKPPGYYERDSRPQMKAPRAGTRGFRAPEVLF
FT                   RYPHQTRAIDMWSVGVIFLTILTAQYPFFYSSEDIDAIVEIATIFGHAEMRKAAKFYGR
FT                   LWRSNIDTIPEERIPFETIIESLNPWAEVGSEGYDLLYRMLDLCSSTRITAPDALNHPF
FT                   FDGLKTHRDPA"
FT   gene            <5557..>6720
FT                   /locus_tag="Eint_100050"
FT   mRNA            <5557..>6720
FT                   /locus_tag="Eint_100050"
FT                   /product="26S proteasome regulatory subunit 6"
FT   CDS_pept        5557..6720
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100050"
FT                   /product="26S proteasome regulatory subunit 6"
FT                   /note="similar to ECU10_0130"
FT                   /db_xref="GOA:E0S9F0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F0"
FT                   /protein_id="ADM12335.1"
FT                   /translation="MCGGLKADLFVRYKQMERKLKLLEIREAYVRKEVETLRREERHSK
FT                   EELDRVKSVPLIMGQFLEPIDNSTAIVGSTAGSNFVVRILSTVDRELLKPNTTVALHRH
FT                   SSAIVDVLPPEVDSTIPVMGESERPEVTYADVGGLDVQKQEIRETVELPLLQSELYRQI
FT                   GIDPPQGVLLYGPPGTGKTMLVKAVANHTKATFIKVNGSEFVQKYLGEGPRMVRDVFRL
FT                   AREKAPSIVFIDEVDSIATKRFDASTSADREVQRVLIELLNQMDGFDQTANVKVIMATN
FT                   RADTIDPALLRPGRLDRKIEFPLPDRRQKRLVFNAITSKMSLKDEVDIESLVCRPERIS
FT                   CADINSICQEAGMLAVRASRYMVTQKDFEEAYSKVVERSDTRPAFYN"
FT   gene            complement(<6788..>7423)
FT                   /locus_tag="Eint_100060"
FT   mRNA            complement(<6788..>7423)
FT                   /locus_tag="Eint_100060"
FT                   /product="vacuolar ATP synthase subunit D"
FT   CDS_pept        complement(6788..7423)
FT                   /codon_start=1
FT                   /gene_family="HOG000230791" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100060"
FT                   /product="vacuolar ATP synthase subunit D"
FT                   /note="similar to ECU10_0140"
FT                   /db_xref="GOA:E0S9F1"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F1"
FT                   /protein_id="ADM12336.1"
FT                   /translation="MTGQKIPVFPTRMNLKTMETKQKSAEKGYSLLKRKSDALKVKYRV
FT                   IEEEYKRKELGINQKIKDAFFKLTEAEFLGANLKMFLYECQKQNVYVKPRIEQVSGVSL
FT                   PFFTLQKENTQPILFLDRSGQSLNECREKFLEVLEMLVDLCALKNSFRVLNSILMSTNR
FT                   RVNALEFNIIPKLENTISYISSELDEQDRGDFFRLKKIQNLKTKDKSN"
FT   gene            complement(<7512..>8678)
FT                   /locus_tag="Eint_100070"
FT   mRNA            complement(<7512..>8678)
FT                   /locus_tag="Eint_100070"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(7512..8678)
FT                   /codon_start=1
FT                   /gene_family="HOG000155756" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100070"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0150"
FT                   /db_xref="GOA:E0S9F2"
FT                   /db_xref="InterPro:IPR007042"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F2"
FT                   /protein_id="ADM12337.1"
FT                   /translation="MDTKRTLVDKIDIFFLLKQQRLVTKRELEMVLPIQSYEDYSTNYY
FT                   RRRVPEVFDKSLGKEWFIYRYLDNSFFEQRRKTICNVHSFKIEGPCIIARNIPDSMPGS
FT                   VIYSIFSKCVNLERFWIQQQTSQNGFSRLCYIILQKEANTQDSIKFMKSILDKGLGVQL
FT                   EEFDISGVSEPEISFEDDDYQMSASIFTSLSRMFDVNEEEVLEKYASTLEDSSTERNTA
FT                   KFICGALKSIFLYCYTCAHQYDDPLEMMMGCRNHKATDTATRRREFLANYRGFGYLHPK
FT                   TKEEELNNMTTIVNENHYKCGFCGKSFESEKFIFNHFNNKHEDEIKRIEKSIEDFKKFL
FT                   QRIDCFMLGVIEGTDDDRIPRFILPNIKDDRIVYDMGCVFSGEIVINK"
FT   gene            complement(8731..8803)
FT                   /locus_tag="Eint_100080"
FT   tRNA            complement(8731..8803)
FT                   /locus_tag="Eint_100080"
FT                   /product="tRNA-Asn"
FT                   /note="tRNA Type: Asn, Anti Codon: GTT, Cove Score: 75.19;
FT                   similar to ECU10_0155"
FT   gene            <8884..>9201
FT                   /locus_tag="Eint_100090"
FT   mRNA            <8884..>9201
FT                   /locus_tag="Eint_100090"
FT                   /product="60S ribosomal protein L23A"
FT   CDS_pept        8884..9201
FT                   /codon_start=1
FT                   /gene_family="HOG000231364" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100090"
FT                   /product="60S ribosomal protein L23A"
FT                   /note="similar to ECU10_0160"
FT                   /db_xref="GOA:E0S9F3"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F3"
FT                   /protein_id="ADM12338.1"
FT                   /translation="MDTPKRNFKHPRNLVSKMPRNTPHDIILYALTTEKAARCMEQFNT
FT                   LVFYVEKTSTKPEIRDAVTQLYGCKVKKVNTLINKHGKKAYVRFDKEGDAIQIASKIGA
FT                   I"
FT   gene            complement(<9277..>10554)
FT                   /locus_tag="Eint_100100"
FT   mRNA            complement(<9277..>10554)
FT                   /locus_tag="Eint_100100"
FT                   /product="signal recognition particle GTPase"
FT   CDS_pept        complement(9277..10554)
FT                   /codon_start=1
FT                   /gene_family="HOG000036277" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100100"
FT                   /product="signal recognition particle GTPase"
FT                   /note="similar to ECU10_0170"
FT                   /db_xref="GOA:E0S9F4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F4"
FT                   /protein_id="ADM12339.1"
FT                   /translation="MGYFCVFNKRGLVIHEEGRMPEHFNQIVVSLDVSRPGGERKIRDE
FT                   VMEYEIRGAIVYLSLSRTPNLKIAIDNYLNKSKEKAGSENKKRAWKKNKERKWEDIGNE
FT                   EELNYSSPSSGVSNFVKVIKKATIQKAFGLFKDQIQVKELKDKMTTHLINKNVSYQITR
FT                   TLVENVMEELSGEGLDVVSEKKFKEKMSNVLGKLIPSVDHEKMLDGIRKHKGVFSICFV
FT                   GVNGVGKSTSLAKICYWLLKNKLKVYIAACDTFRAGAIEQLKTHVERFQLGGYSVGFYQ
FT                   KGYGKDDASVARCAIQEAQHEGYDVILIDTAGRMHNKKNLMMSLTKLMKINKPDHIIYV
FT                   GEALVGSDSLEHIKEFNRAIKDADQLRNIDSILLTKVDTVDNKIGQILNMAFSSNAPIL
FT                   FLGVGQTNSDLSNIGSEDIVNSLMSS"
FT   gene            complement(<10611..>11210)
FT                   /locus_tag="Eint_100110"
FT   mRNA            complement(<10611..>11210)
FT                   /locus_tag="Eint_100110"
FT                   /product="ribose 5-phosphate isomerase"
FT   CDS_pept        complement(10611..11210)
FT                   /codon_start=1
FT                   /gene_family="HOG000276368" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100110"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /note="similar to ECU10_0180"
FT                   /db_xref="GOA:E0S9F5"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F5"
FT                   /protein_id="ADM12340.1"
FT                   /translation="MEGYKKNVESRTVIGIGTGTTIERYIGVLDREVVYVPSSIQTALK
FT                   LREKGLIVSSPLGHESLDLYIDGADYFDKCGNLIKGGGGALTTEKLLYSMAKDIIIIVQ
FT                   RHKYRETFEGCLVPIEISSISLMKFLSILQEYKLKHFLRETTGKAGPLISDLGNCIVDV
FT                   EYNADFISECKSICGVIEHGLFEANGYTTIIEENLG"
FT   gene            complement(<11359..>12465)
FT                   /locus_tag="Eint_100120"
FT   mRNA            complement(<11359..>12465)
FT                   /locus_tag="Eint_100120"
FT                   /product="26S proteasome regulatory complex protein"
FT   CDS_pept        complement(11359..12465)
FT                   /codon_start=1
FT                   /gene_family="HOG000149839" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100120"
FT                   /product="26S proteasome regulatory complex protein"
FT                   /note="similar to ECU10_0190"
FT                   /db_xref="GOA:E0S9F6"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F6"
FT                   /protein_id="ADM12341.1"
FT                   /translation="MDFDFKEPTLLVHDLIHATKLGKSEAQEELEKLLSDKCMYDLYSF
FT                   LVEKGILQPNHERIDSLLNCKNQRIQELEELRKKETENETYAEEIERKTAEFYCQVMDT
FT                   QNGFEWMRKLMRDDMSLSLKMDISLCKIRMGLIVGNKRIVEESINVADDTYERGCDWDR
FT                   RNRYKVYKGVFKMMERKFKEAGILFSEVLPSFESSEVISYSRAVKYMIFCGLLGFERNE
FT                   IETRILKCSDVMGSSEKLGVQLATSLFECNYGSFMEDLYLFCKSLQEDVFVGRFVNLFC
FT                   REMRLRVYGQVLESYRSMLLENMAETFGVSVEYVEEDLGEFIVEGRLWSKIDRISGVVE
FT                   VTSREDQDASSIIGYGCDVVRRIKKCVK"
FT   gene            complement(12531..12603)
FT                   /locus_tag="Eint_100130"
FT   tRNA            complement(12531..12603)
FT                   /locus_tag="Eint_100130"
FT                   /product="tRNA-Val"
FT                   /note="tRNA Type: Val, Anti Codon: CAC, Cove Score: 62.15;
FT                   similar to ECU10_0195"
FT   gene            <12677..>13456
FT                   /locus_tag="Eint_100140"
FT   mRNA            <12677..>13456
FT                   /locus_tag="Eint_100140"
FT                   /product="hypothetical protein"
FT   CDS_pept        12677..13456
FT                   /codon_start=1
FT                   /gene_family="HOG000149837" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100140"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0200"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F7"
FT                   /protein_id="ADM12342.1"
FT                   /translation="MDDTIQRYKEKLNELEKIGSEIKDMLSLDYDLDCLSHSPSVCYIA
FT                   TSLEEGKAEELEENKYSIEVQMIITIGKSLDSTLKKDLISKIEKIKAINIGIEEYRDAI
FT                   ASRFKYLHNLLGNDLLFKLTIEVKSLLPLARAIPSEIMKYGIETYGFPLLSQHQLIMKA
FT                   SPQNQEKLLRKLCCKVTMAAKLDFCESSFEIDFYSQMEKIFNSLESKEKEEKSILKVPL
FT                   ARKETRRGGINARRKRQGSSPHKRRRLLKLEPDEADG"
FT   gene            <13483..>14190
FT                   /locus_tag="Eint_100150"
FT   mRNA            <13483..>14190
FT                   /locus_tag="Eint_100150"
FT                   /product="DNA-directed RNA polymerase III subunit C34"
FT   CDS_pept        13483..14190
FT                   /codon_start=1
FT                   /gene_family="HOG000149290" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100150"
FT                   /product="DNA-directed RNA polymerase III subunit C34"
FT                   /note="similar to ECU10_0210"
FT                   /db_xref="GOA:E0S9F8"
FT                   /db_xref="InterPro:IPR007832"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016049"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F8"
FT                   /protein_id="ADM12343.1"
FT                   /translation="MKSLLDFIKSRPEGVVEEELSLEFPDMSKADIAKELNNYLKCQEI
FT                   SLFRDKGVLYYKPSPVNVDDYELMIYNLVNQSGSEGVWLKVIKDKTNMPHNLVGKVLRN
FT                   METKRIIKSVKCLKNNRKVYVLYDQVPSEEITGGMWFQDNDVDVECVTKILEIILLFLE
FT                   KRLGDRLELPEYEENPKLEEIMNYVKDLGILSVPLRLEDLETLVDILVFDGRVEKLHSG
FT                   PIVRYRALRPYGK"
FT   gene            <14268..>15254
FT                   /locus_tag="Eint_100160"
FT   mRNA            <14268..>15254
FT                   /locus_tag="Eint_100160"
FT                   /product="translation initiation factor IF3 subunit 2"
FT   CDS_pept        14268..15254
FT                   /codon_start=1
FT                   /gene_family="HOG000231322" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100160"
FT                   /product="translation initiation factor IF3 subunit 2"
FT                   /note="similar to ECU10_0220"
FT                   /db_xref="GOA:E0S9F9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9F9"
FT                   /protein_id="ADM12344.1"
FT                   /translation="MDDGLSIGSEGYFLNIKCHERPITDVKFNYDGDLIFTSGKDSIAT
FT                   LLRSDGSVVGEYKGHRGSIFSIAVDNKSTSLVTGSADQSIILWDVSTGKMKAQTDVGVV
FT                   VKGLDFYKDGTLCLGCSDDSMGKTPSIGILDTRNKSFEKIFVPTSSPIKILMDISENFL
FT                   VYCDSRGGVSSVDLRNSQVIKSAKIHTSKINNIRPSRCRTFFITGSMDSQAKIIDFLDL
FT                   SVQKTFVCEEPVNCAAIFNTNDKVICVGGINARDVTTTKGKSSFDANFFDVVTCEKIGS
FT                   YSTHFGTINSVDVHPSGKLYCSGGEEGTITILAFGQDFFQANFTNFN"
FT   gene            complement(<15270..>15677)
FT                   /locus_tag="Eint_100170"
FT   mRNA            complement(<15270..>15677)
FT                   /locus_tag="Eint_100170"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(15270..15677)
FT                   /codon_start=1
FT                   /gene_family="HOG000149836" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100170"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0230"
FT                   /db_xref="InterPro:IPR009852"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G0"
FT                   /protein_id="ADM12345.1"
FT                   /translation="MTFMQENIKEKIETISTLMKRLEENKNISVVDVLKEEILKLKKLN
FT                   EEYKKSLEAKRVMHKDQLQNKTRYYLKDGSTYVVKSNQYRYLYDAKTKVITYEFSNGQI
FT                   EKTFPSGLKEVRYPDGSIAIKNGPKDHEYIK"
FT   gene            complement(<15797..>17356)
FT                   /locus_tag="Eint_100180"
FT   mRNA            complement(<15797..>17356)
FT                   /locus_tag="Eint_100180"
FT                   /product="T complex protein 1 subunit gamma"
FT   CDS_pept        complement(15797..17356)
FT                   /codon_start=1
FT                   /gene_family="HOG000226732" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100180"
FT                   /product="T complex protein 1 subunit gamma"
FT                   /note="similar to ECU10_0240"
FT                   /db_xref="GOA:E0S9G1"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012719"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G1"
FT                   /protein_id="ADM12346.1"
FT                   /translation="MQKPIPRKMYILVPDKPAQIQNESAIAAKTISSVIRTCLGPRAMQ
FT                   KMVLTKINSIELTNDGNAILRELDVAHPSARSLIELAKTQDDEVGDGTTSVVLLAAEIL
FT                   NEMTYILDKDVHPIKICNSLSKALEVCIKAIDGTAMSLDSSEETRIKIINGSVASKVCS
FT                   ILKVPIGKLALEAVKKIYIKEENRCDLKSNMKVEKILGGNFVESEVMDGILINKDIIHP
FT                   QMRRTIENPRIAIVESPLEYKKGESQTSYEFSKENDFTRALEIEEEQVREMCEKIIAAK
FT                   PDIVVCEKGISDLALSILFENNITGLRRLKKTDVSRLSKACGARPVNRPEDLEERHIGT
FT                   SCGLFEYVKYGEEYYCKFSKCVNPKACSVIIRGPTKDILDELERNFMDAVKVAKSIFIS
FT                   PKLCPGGGAVEMAMSHELMQNSGDNEIEAEVFSRVASALTIIPSILLENSGVFNPLEAI
FT                   TLLEKKHQEGSFYGVNGITGEIVDTRDLVLEPYAVKSQCIKSAIEAVSQLLRIDGIIES
FT                   KR"
FT   gene            <17545..>20967
FT                   /locus_tag="Eint_100190"
FT   mRNA            <17545..>20967
FT                   /locus_tag="Eint_100190"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT   CDS_pept        17545..20967
FT                   /codon_start=1
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100190"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /note="similar to ECU10_0250"
FT                   /db_xref="GOA:E0S9G2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G2"
FT                   /protein_id="ADM12347.1"
FT                   /translation="MDSMFTKEHSWLIISSFFEQKGLVRQQLDSFDQFVKTKMQEVIDE
FT                   SPAIIVQSAPTAGIETQKRITVRFGQIYVSKPPIYTESDGRTITVFPNEARIRDLTYAS
FT                   PLFIDVTKETISELGVVDKHKYSRVPFGSLPVMLRSSYCVLYGLSDKDLIDLGECPYDQ
FT                   GGYFIVNGSEKVIVAQERMASNTVYVFKKAQPATYTHYAEIRSVPEKSSRNPSTLSMKL
FT                   CRSPGVIRVSLPLVKQDIPLFVLYRALGFLSDKEIIDHILYEDDDEMFELLKESIEEGM
FT                   VVQDQNVALDYIGKRSAPVGTPQEKRIIIAKDLLAKEVLPHIGTQEFCETKKAYFIGYI
FT                   VQRLLLVALGRKNPDDRDHYGKKRMDLSGPLLASLFRTLFKKLCADTTRHMQKCIENGR
FT                   EFNIALGLKASIITQGFRYALATGNWGDQAKAMQTRAGVAQVLNRYNFVSTLSHLRRVN
FT                   TPIEKEGKLAAPRQLHNTHWGMVCPAETPEGQACGLVKNLSLMAYISVGSSSGPLVEFL
FT                   EECGVESLEEISTPQLNAATKIFVNGIWVGIHSDPVYLIKSLKLLRRSLEMDKEVSIVR
FT                   DIREKEIRIQSDAGRPCRPLLVVKNNELVITPEDIKRLKRGEIKWDNLISEGFIEFLDV
FT                   EEEEMSMIAMNTKALEESKKASDVKISYTHCEIHPALILGICASTIPFPDHNQSPRNTY
FT                   QSAMGKQAMGIYATNFLLRMDTLSNILFYPQKPLVTTKSMEYLRFKELPSGQNALVAIA
FT                   CYSGYNQEDSIIMNQSAIDRGLFRSFFYRTYTDQESMSRPGVNEEFCKPSRGTVLRMKN
FT                   LNYNKLDEDGLISPGTRVTGDDVLIGKITPILDPERSTKEAPVYVYKDSSTAMRRTETG
FT                   IVDTVIVTNKDGYKFSKIKVRSGRIPQMGDKFASRHAQKGTIGITLRQEDMPFTSDGIV
FT                   PDIIINPHAIPSRMTIGHLIECLLGKVSAMSGEEGDATPFSDMTVNEISAKLKSYGFQQ
FT                   RGLEVMYNGMTGRKLRAQVFFGPTYYQRLKHMVDDKIHARARGPLQILTRQPVEGRSRD
FT                   GGLRFGEMERDCIISHGASAFLKERLMDVSDAYSCFVCNFCGLLAMGGSKVNECKGCNN
FT                   TTNVSMIEIPYAFKLLVQELMGMNIAPRIRFEE"
FT   gene            <21117..>21473
FT                   /locus_tag="Eint_100200"
FT   mRNA            <21117..>21473
FT                   /locus_tag="Eint_100200"
FT                   /product="CCAAT binding transcription factor subunit A"
FT   CDS_pept        21117..21473
FT                   /codon_start=1
FT                   /gene_family="HOG000211832" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100200"
FT                   /product="CCAAT binding transcription factor subunit A"
FT                   /note="similar to ECU10_0260"
FT                   /db_xref="GOA:E0S9G3"
FT                   /db_xref="InterPro:IPR003957"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G3"
FT                   /protein_id="ADM12348.1"
FT                   /translation="MDEFSRGLRPTDRSLPIANISKIMKKPIPKEAKVAKDAKEIMQKS
FT                   AGEFIAIITCRAKEICESEARKTVTGEDLIRAMDELDMPYYAELARKYYIQYRELAKNE
FT                   RVRKYSRSFDYGKP"
FT   gene            <21569..>22135
FT                   /locus_tag="Eint_100210"
FT   mRNA            <21569..>22135
FT                   /locus_tag="Eint_100210"
FT                   /product="exosome RNAse PH-like protein"
FT   CDS_pept        21569..22135
FT                   /codon_start=1
FT                   /gene_family="HOG000149289" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100210"
FT                   /product="exosome RNAse PH-like protein"
FT                   /note="similar to ECU10_0270"
FT                   /db_xref="GOA:E0S9G4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G4"
FT                   /protein_id="ADM12349.1"
FT                   /translation="MSGIRSMMSVIPHCTGSSRFTYNNTTVFCIVHGPSDSISRQEDPE
FT                   MAILDVKWRDIILINGRIYDKYFSREIEKILSKRIILELDPCRSIQISFNVVGEVRNTL
FT                   FCAVNAALLALSDAGIPLISMFYASSSFTHEEEVIVFDGDENVLASHSFGSISKTGMER
FT                   AKSFLKYVKEVQTYTLKSKFPFCIS"
FT   gene            complement(<22253..>24733)
FT                   /locus_tag="Eint_100220"
FT   mRNA            complement(<22253..>24733)
FT                   /locus_tag="Eint_100220"
FT                   /product="putative P-loop ATPase/acetyltransferase fusion"
FT   CDS_pept        complement(22253..24733)
FT                   /codon_start=1
FT                   /gene_family="HOG000149835" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100220"
FT                   /product="putative P-loop ATPase/acetyltransferase fusion"
FT                   /note="similar to ECU10_0280"
FT                   /db_xref="GOA:E0S9G5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G5"
FT                   /protein_id="ADM12350.1"
FT                   /translation="MTLLCDRGIQNFFEENGRRNHRSFVILLGENGKAQIPAIHRILQG
FT                   HTNGSVESIVWCHKNEVTRKTGQRVSGKRQKKRIEEEESQDDLALFIRARDIEFIEYRE
FT                   SERILGRTVDMLILQDFEALSPNLIATSMETVRGGGAIVLLLDTAHSIETLISHKTDLH
FT                   EKIGEFEPRYNKRLFKSLISSNFALFLDDKLNVLDCMNSPKDKNLKVSKDKYEEQYDPD
FT                   SEVLKSLGKTRDQIYIIEEIFKALESRAGKTVFSITASRGRGKSAALGISIAKAISLGL
FT                   LSVYIASPAIENVKTVFLFLITGLEKLGYKKYIDFKIIYQFRGNKRFMQKIEFTGGRKH
FT                   IIEYFNPANELKYYPDLLVVDEAAAIPLVYLTKLIFPNFVIMATTVNGYEGTGRAFSVK
FT                   LSEMLRKSSAESSSFIYKELTMKESIRYGQNDPVENWLYKALLLDASVPKIQGCPRPSE
FT                   CSLFYVNKDVLFSGKPPAEKFLNDVFSLFISSHYKNSPNDLQVLADSPRHEIFALVTPA
FT                   EDDGKDIPKVICSLQISFEGKCTRTGHLREGNLIPWVISEEHIDASFLNVYGIRIVRIA
FT                   VHPEYAGMGYGTASLNLLIKHLSSHGEDICSMKVRDGEKDILLQNITDVLIPQVSWIGA
FT                   SFGMAETLCRFWLKNQFVPVGVKQAVTQETGEHSAVFIRSLSHTEEDRIYKYNQKFMSR
FT                   FVGQLSSSFKSLGPSLSLSLLKDPVPEKGRMMYFPYDDISRIRMASGGKIDLNLVTDII
FT                   PDISRMYFHGMFSQDLSVLRKSVLLMVGCQNRSIDEIAELLTLKPFQIVNILTKVLSIL
FT                   LEDLEKNHVMNQER"
FT   gene            complement(<24817..>25191)
FT                   /locus_tag="Eint_100230"
FT   mRNA            complement(<24817..>25191)
FT                   /locus_tag="Eint_100230"
FT                   /product="U1 snRNP-specific protein C"
FT   CDS_pept        complement(24817..25191)
FT                   /codon_start=1
FT                   /gene_family="HOG000149288" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100230"
FT                   /product="U1 snRNP-specific protein C"
FT                   /note="similar to ECU10_0290"
FT                   /db_xref="GOA:E0S9G6"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G6"
FT                   /protein_id="ADM12351.1"
FT                   /translation="MAKYFCEFCNKTLLNDKLKSRRIHFQGAKHRLMRKAYYMEMFEKK
FT                   EVIAEMASILKDMKTENKKAESENAEKKQNTCFSFPPGDFYLDLVVPEEPLGFKLPLGF
FT                   DFRDKRNFLGTITEAIRKYK"
FT   gene            25268..25349
FT                   /locus_tag="Eint_100240"
FT   tRNA            25268..25349
FT                   /locus_tag="Eint_100240"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA Type: Ser, Anti Codon: GCT, Cove Score: 57.03;
FT                   similar to ECU10_0295"
FT   gene            <25406..>26608
FT                   /locus_tag="Eint_100250"
FT   mRNA            <25406..>26608
FT                   /locus_tag="Eint_100250"
FT                   /product="sterol O-acyltransferase"
FT   CDS_pept        25406..26608
FT                   /codon_start=1
FT                   /gene_family="HOG000149287" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100250"
FT                   /product="sterol O-acyltransferase"
FT                   /note="similar to ECU10_0300"
FT                   /db_xref="GOA:E0S9G7"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G7"
FT                   /protein_id="ADM12352.1"
FT                   /translation="MRNNYVPQENASSHSLSVHTTKKIEKGKGEMYGLKNLAVIIAFLS
FT                   VGKFIIDNNREFGFLMSLPLQTLSLLECSCFLLAILMSFVRSLFGFYIEARKLGHLYIC
FT                   LNLGVFEAFIAYLNLNYIRHIYSSGWSMILNVVYTAKLISFHLVVKELRRDRKINIEEE
FT                   LSIRHFLYFLVVPTLCFQLQFPMRSGRNIKGMVLKTIQLLVGFLLFVLVMDQYAIPSIY
FT                   RIVNFEDLTTVIENIINLSISTIILFLIFFYTVFYCFLETVADITLFYDSCFYQEWWNA
FT                   SSAREFWALWNRPVYLWFKRHVYAPMVGRGISKERAGVIVFAMSGLIHEYVVSISIKKF
FT                   TGWFLITMLLQVPLIHVTESFRRKFPSLGNFFFWGAFCVIGQPSVILLYYRSLYLKECH
FT                   M"
FT   gene            <26703..>28061
FT                   /locus_tag="Eint_100260"
FT   mRNA            <26703..>28061
FT                   /locus_tag="Eint_100260"
FT                   /product="1-acyl-SN-glycerol-3-phosphate acyltransferase"
FT   CDS_pept        26703..28061
FT                   /codon_start=1
FT                   /gene_family="HOG000149286" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100260"
FT                   /product="1-acyl-SN-glycerol-3-phosphate acyltransferase"
FT                   /note="similar to ECU10_0310"
FT                   /db_xref="GOA:E0S9G8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G8"
FT                   /protein_id="ADM12353.1"
FT                   /translation="MKEMVLKKRTFLHDAIDMVSMGSHTLENDDFTRCFQPAAAIEMDS
FT                   SGIFYTFSFVIRYFILFPMRIAFLILSMAVFFLMILRAAFTKNNMHLESALIFGAKSLM
FT                   LAMNAKIKHRGIKKRQAEPHLYVSNHTSFVDFFLLCSHKFPHACVSEMHGGLFGFLFNS
FT                   ILIRNGSIGFKRSEKVDRQLVVEKIKEHVSSGGAPMLIFPEGTCVNNKFSVLFQKGAFE
FT                   LGVTIYPVAIRFRRGLFDPYWNRRNHGFAMHMFYLMTRWRLEAEVTWMKPHNIMKNESP
FT                   TQFSHRVKAAISKEAGLRNTLWNGFLKSSPAIKDREILRESYLITYGRIVSNSLDKSNA
FT                   VDVEKNRFYLYDNNIDFSSSRSHSYFESMISYKKFQNEVLKEYLRLKELPQKDLKFLLS
FT                   NHKSREDSLGDSERKGFCSCGTKKGSKGNNFKKKQSNPLMFCKYESFKSPSLG"
FT   gene            complement(<28113..>29609)
FT                   /locus_tag="Eint_100270"
FT   mRNA            complement(<28113..>29609)
FT                   /locus_tag="Eint_100270"
FT                   /product="kinesin A-like protein"
FT   CDS_pept        complement(28113..29609)
FT                   /codon_start=1
FT                   /gene_family="HOG000149834" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100270"
FT                   /product="kinesin A-like protein"
FT                   /note="similar to ECU10_0320"
FT                   /db_xref="GOA:E0S9G9"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9G9"
FT                   /protein_id="ADM12354.1"
FT                   /translation="MVTPGIRHRIDEIKEMFSEIKENINATIPNRVRKDSVLLEICTPG
FT                   TCGYNGCSKSTRNRESELLERIKELELIIENISKVTDFSTYKEELQAKDIAIAMEEKNH
FT                   EVKKMKEELSRIVSANECLRKDNLRIQSCLDEYKERASKLEETKKECLAYKEVISKLKS
FT                   EIMDLKGSVQVICRIRPNTAGRKGSRIEISDGALKISMGGKEHSFSFDKVLGPHTTQEC
FT                   VYGEMEMILRSVLEGYRVCVFTYGQTGSGKTYTMEGNDNNPGLIVRTLKDIYSIIEEMR
FT                   TDGWVFDITCSYVEIYNEDVVDLFSEDMRKVGIVHRGGDVNMVDCISISVSNASEAIGL
FT                   FQSGARRKKIGDTNCNMKSSRSHVIFILKIKMSNKTSKEEKEGVMALIDLAGSERLSVS
FT                   KAEGARLKETQNINKSLSALGDVFNSILRKDGHIPFRNSKLTHLLQSFLSGNSRAIMLV
FT                   NISPDAEHFNETVCSLRFADRVSQCKLGSVKRKITNFVSE"
FT   gene            <29837..>30496
FT                   /locus_tag="Eint_100280"
FT   mRNA            <29837..>30496
FT                   /locus_tag="Eint_100280"
FT                   /product="hypothetical protein"
FT   CDS_pept        29837..30496
FT                   /codon_start=1
FT                   /gene_family="HOG000149833" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100280"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0330"
FT                   /db_xref="GOA:E0S9H0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H0"
FT                   /protein_id="ADM12355.1"
FT                   /translation="MKCSACQVEIEENIKAHYASEVHKINVKRQIYNAPPITIEEINGE
FT                   QLSDDVSLEINGLETGEKCSSSKKYSRKRNSSKVVGCSPEAVCLFCEFPESNTHYRDHG
FT                   LSDEEVAYIDNKVCYMCYEAFSERESLRRHISSGNHRNAMTDGVNLILESGKVIQGRGR
FT                   NRSREEEPRRPESRERNMIVRSQAKEDRRAIIKNKNRLKISLSMNFQPRFKPDWMQ"
FT   gene            <30593..>31426
FT                   /locus_tag="Eint_100290"
FT   mRNA            <30593..>31426
FT                   /locus_tag="Eint_100290"
FT                   /product="inorganic pyrophosphatase"
FT   CDS_pept        30593..31426
FT                   /codon_start=1
FT                   /gene_family="HOG000195569" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100290"
FT                   /product="inorganic pyrophosphatase"
FT                   /note="similar to ECU10_0340"
FT                   /db_xref="GOA:E0S9H1"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H1"
FT                   /protein_id="ADM12356.1"
FT                   /translation="MTSYSTLKIGKKYSPGFKTYVTQNGKIVSPFHDIPLHMTENREVI
FT                   SVICEIPRFENGKFEINKKERFNPIKQDVKNGKPRFVKNVFPMKGYLWNYGAIPQTWES
FT                   PHEIDKHVGAKGDNDPLDVIEIGGRKKKIGEVYQAKVLGSIALVDEDECDWKVIVIDVC
FT                   DEKANEMNDIEDVQKMCGGLLEQTKFWFENYKVPDGKGKNSFALDGKYMNKEFTLKVIG
FT                   NAHESWCGMVNSKDSEDICKENSTLMDKIDPPAITGEDLSDSEIPDYVNQFEFIK"
FT   gene            complement(<31784..>32389)
FT                   /locus_tag="Eint_100300"
FT   mRNA            complement(<31784..>32389)
FT                   /locus_tag="Eint_100300"
FT                   /product="Rho1-like RAS GTP-binding protein"
FT   CDS_pept        complement(31784..32389)
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100300"
FT                   /product="Rho1-like RAS GTP-binding protein"
FT                   /note="similar to ECU10_0350"
FT                   /db_xref="GOA:E0S9H2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H2"
FT                   /protein_id="ADM12357.1"
FT                   /translation="MNNKTHKSGKVVVVGDGACGKTCLLEVFRRNQFPETYIPTVVDNF
FT                   VKEVKISDDKYVSLALWDTAGQEDYDTIRPLSYKETDLVLLCYTIENKKKIPNISRKWL
FT                   MEIKNYCPSSQFFLIGLKKDIRDLDDPTIDKSSMISESEGRKIADNINATRFFECSSRT
FT                   RENVNLVFLEAAKHIWDTKQATSDAESCSFLSCMKCCR"
FT   gene            <32953..>33420
FT                   /locus_tag="Eint_100310"
FT   mRNA            <32953..>33420
FT                   /locus_tag="Eint_100310"
FT                   /product="putative ADF actin-binding protein"
FT   CDS_pept        32953..33420
FT                   /codon_start=1
FT                   /gene_family="HOG000149285" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100310"
FT                   /product="putative ADF actin-binding protein"
FT                   /note="similar to ECU10_0360"
FT                   /db_xref="GOA:E0S9H3"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H3"
FT                   /protein_id="ADM12358.1"
FT                   /translation="MSLTIPGLDLIRNEIEEIKSGNLRYTIANLSIKEPISLSVLRNGG
FT                   RVKDFDYKRKYTIKELQGIFEEFSESVNEQDPCLVVYDFIHFDDDGIQKNTLCLISYIP
FT                   EHLVPLKKVAYSTNALNLKELLDISVHISIKKKSDLIFDNIAEKCAASRMK"
FT   gene            <33499..>33897
FT                   /locus_tag="Eint_100320"
FT   mRNA            <33499..>33897
FT                   /locus_tag="Eint_100320"
FT                   /product="hypothetical protein"
FT   CDS_pept        33499..33897
FT                   /codon_start=1
FT                   /gene_family="HOG000149832" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100320"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0370"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H4"
FT                   /protein_id="ADM12359.1"
FT                   /translation="MGLGINTKSVRGLRRFTRSKTQVIFFDNSRSPKTSKNTQKHQECR
FT                   EDQPAENIPQVSNVLKAEERMFPFEKLLETFTNLEKKKIQKTLRPCDGINPMKTLRKDS
FT                   FAERYFDSPSGTFLGKERHISSSSQERT"
FT   gene            <33979..>34839
FT                   /locus_tag="Eint_100330"
FT   mRNA            <33979..>34839
FT                   /locus_tag="Eint_100330"
FT                   /product="mRNA capping enzyme"
FT   CDS_pept        33979..34839
FT                   /codon_start=1
FT                   /gene_family="HOG000242614" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100330"
FT                   /product="mRNA capping enzyme"
FT                   /note="similar to ECU10_0380"
FT                   /db_xref="GOA:E0S9H5"
FT                   /db_xref="InterPro:IPR004971"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H5"
FT                   /protein_id="ADM12360.1"
FT                   /translation="MENKKEEIRRHYNNIREKGKEGRQKSKAINIRNTNNFIKSCLIRL
FT                   YTKKGDSVLDLGCGKGGDLLKYENANISEYYGIDIAEVSINDARIRAKNMKRRFKASFK
FT                   AQDAYGQEIDLGKQFDVVSSQFSFHYAFSSSETLSISVGNVARHLKPGGYFIMTIPSRD
FT                   VILRRYEQDRMSNEFYKIEIDRKESIPKEDIKEYRFTLVDSVNNCIEYFVDFPTMVSEF
FT                   KKLGVVLVERKGFIDFLEEESKKNLELFRRMKVKCLEKGELEVVGIYEVIVFQKLSPKE
FT                   ESSVQ"
FT   gene            complement(<34825..>36369)
FT                   /locus_tag="Eint_100340"
FT   mRNA            complement(<34825..>36369)
FT                   /locus_tag="Eint_100340"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(34825..36369)
FT                   /codon_start=1
FT                   /gene_family="HOG000149831" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100340"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0390"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H6"
FT                   /protein_id="ADM12361.1"
FT                   /translation="MAMDAESQEPGNPGKEFNAVDVINKTYANATEYDLNDALIFLTKV
FT                   INRTKVRNKQLVKQHFGKFVQCRTVLEEIWVDIKQKGYDKEFTTDLENNIKVVEEKFRK
FT                   MTSGISDDVEGKIEGGRREYYMKKYSLLFNVKFYLRRNLHNLERFVDIYKGAMEMYLEL
FT                   KNSVYIQKVWNSIHDERCEFLEIIYRNIQRPGCTFHEALYYFDLYFKVCEHKSEHKIMN
FT                   TLLVNFKENSTKSLELSYLDEEECLKEITRHYLKIMGRVDGKIQILATDHYFECIEKIL
FT                   YNKELLFIKVWIRKLKENTKVVELSSDAKMVYFSHLKRVKTKVIDDGFRKIPSVTVETF
FT                   KDAMAHMEDVFNLFIDVVSKEEKRHLKNKVLEYIDKCYESVELKKFSDLESVIKDIYET
FT                   KHLLGPPDSEDVKDLYKMINKYMEGHATKIIGIVKGMIEQKASDVQILMEIVRIIEEMP
FT                   MEHLRILRRIKPLVEGHSIVMYYLSNILAFEPPRLSNDLRKKVDEIGDQFGFLLNT"
FT   gene            <36427..>36849
FT                   /locus_tag="Eint_100350"
FT   mRNA            <36427..>36849
FT                   /locus_tag="Eint_100350"
FT                   /product="40S ribosomal protein S23"
FT   CDS_pept        36427..36849
FT                   /codon_start=1
FT                   /gene_family="HOG000040064" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100350"
FT                   /product="40S ribosomal protein S23"
FT                   /note="similar to ECU10_0400"
FT                   /db_xref="GOA:E0S9H7"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H7"
FT                   /protein_id="ADM12362.1"
FT                   /translation="MPGLFAANNLIKSRKAKRLADTTYRKRALGTKYKHSVLGRAPQAK
FT                   AIVLEKIGVEAKQPNSAIRKAVRCQLIATGKKITAFVPYDGSVTYIESNDEVTVEGFGK
FT                   KGRSFGDIPGIRFKVCKVQNVSLHAIFTGKKEKPSR"
FT   gene            complement(<36892..>37518)
FT                   /locus_tag="Eint_100360"
FT   mRNA            complement(<36892..>37518)
FT                   /locus_tag="Eint_100360"
FT                   /product="26S proteasome regulatory subunit S5A"
FT   CDS_pept        complement(36892..37518)
FT                   /codon_start=1
FT                   /gene_family="HOG000149284" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100360"
FT                   /product="26S proteasome regulatory subunit S5A"
FT                   /note="similar to ECU10_0410"
FT                   /db_xref="GOA:E0S9H8"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H8"
FT                   /protein_id="ADM12363.1"
FT                   /translation="MPETIVVLFDNGMASQNQDYLPSRFIVQKETVESLISRKFEDNQE
FT                   NTIGIIPLVQVQSNDIITPTKQRSHIKTFLNDIKLNKEGDIMRCLSQSLHIFNQRDSPG
FT                   CILVVFLASELQESEKDELFARIYQLLTFGIGIKMVFFGEAVEMVEAFKKIDFTNFSCI
FT                   EVKTNEEFIDRVLPFISGNDLVEEDDPELAEAIRLSLEEQKKQQK"
FT   gene            complement(<37646..>39256)
FT                   /locus_tag="Eint_100370"
FT   mRNA            complement(<37646..>39256)
FT                   /locus_tag="Eint_100370"
FT                   /product="ATP/ADP translocase"
FT   CDS_pept        complement(37646..39256)
FT                   /codon_start=1
FT                   /gene_family="HOG000149830" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100370"
FT                   /product="ATP/ADP translocase"
FT                   /note="similar to ECU10_0420"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9H9"
FT                   /protein_id="ADM12364.1"
FT                   /translation="MLENECTDLAGCEDKILGKERHCASIYSRTLQRINDISNDTKATL
FT                   LFSLLYALLSYIDAFLYILGDMVMMNTQIPSSILFIKSVLVLPVTFFFIVIVQKGLKFL
FT                   SQPRILEVVLIILSVFFLLFGLVIWPCSKKLQPDFFWSRDIFSDGKMKIRHLDFFFPIF
FT                   LVFNEWASTVLYLVAELWGSLIISFMFFSRAIHQSTEAQLKKFLPVVSLISGMVLLSSG
FT                   LLTRSLNSYRDTLPYSKKESLFSQVFVVTSILTAVSAITSYFTDKFTPKDDREYGSKKE
FT                   YKDHKMGFTKSLRIMRKSRFLMAMTESVIATSVCSNIFEATYRGGVVLGAVQASLSGSS
FT                   YINKLNAMAQIITSAFLIVMFFRPATHLIERKGWFLVAITAPAIAIITLVLFFPMVFFN
FT                   NISEDEVITPREGYLGSFVLENYTGMFLNTIIKISKYCFFDVAKEAASIRVPPSHRHSF
FT                   RGIHDGLGINIGKTIGSVYCTLITVVFDVRDVRNMVSISTVFVGIFCIMWVRSVLYINK
FT                   KYKESIEKNDFINVELTEC"
FT   gene            <39416..>39838
FT                   /locus_tag="Eint_100380"
FT   mRNA            <39416..>39838
FT                   /locus_tag="Eint_100380"
FT                   /product="hypothetical protein"
FT   CDS_pept        39416..39838
FT                   /codon_start=1
FT                   /gene_family="HOG000149829" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100380"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0430"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I0"
FT                   /protein_id="ADM12365.1"
FT                   /translation="MDDNWKAFNLKIEHGLGHKRTLEWERIVKHRIRQNSLNLASENEI
FT                   ERYSDKYFKSLLSEDMIKEIVSVELMPPEISRTFGEKKEKNMEDIEGIESSASEEYDGS
FT                   DETENSNDVENDYEENFYENEEDDELTEEKDEEGFF"
FT   gene            <39924..>41126
FT                   /locus_tag="Eint_100390"
FT   mRNA            <39924..>41126
FT                   /locus_tag="Eint_100390"
FT                   /product="ATP-dependent RNA helicase"
FT   CDS_pept        39924..41126
FT                   /codon_start=1
FT                   /gene_family="HOG000268802" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100390"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="similar to ECU10_0440"
FT                   /db_xref="GOA:E0S9I1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I1"
FT                   /protein_id="ADM12366.1"
FT                   /translation="MEFDELNIDDSLVQACQRNGITRPTEIQKQVIPMVLGGNDIIAVS
FT                   QTGSGKTLAFVLPIVSRLLLKNRSFFCLVVAPTRELSSQIAECFNMFGSTGLRVCLLVG
FT                   GTNFNLQANQLSKHPHIVVGTPGRIAEHILKTKSFKAERIRKLVLDEADRFFEQDFVED
FT                   LETIIRSLREKRQTLLFTATMSNEISKLSSSILIKPKTIRVVEGYETVSALKEYYFFTA
FT                   MKWKSSALVEFLEMNPGASTIVFVSMCITARVMSLALSKLGFHSEALYGELSQEKREET
FT                   MRMFKENKFSVLVCTDVGSRGLDISHVDLVINFDVPKSGKDYVHRVGRTARAGRAGTAI
FT                   TLVTQYDVEQLQRVEFVLKKSLEEFKPVKKNFESIREKVEETIQEAQEILKGERKRNRR
FT                   H"
FT   gene            <41681..>43225
FT                   /locus_tag="Eint_100400"
FT   mRNA            <41681..>43225
FT                   /locus_tag="Eint_100400"
FT                   /product="hypothetical protein"
FT   CDS_pept        41681..43225
FT                   /codon_start=1
FT                   /gene_family="HOG000149828" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100400"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0470"
FT                   /db_xref="GOA:E0S9I2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I2"
FT                   /protein_id="ADM12367.1"
FT                   /translation="MVFPLVLSFLEDGKEVLYLPKQVFQNTGQGPTYLFFRINLFISMC
FT                   YVIYVVVSLFASNILYIMVGVLNFFNYDLDEYTIEIIQVINSTSWCWKQSLIAALIFLA
FT                   ASITSQPYDFGKNDGSYKYKVVTMILMYSVFIFVVFLEKFFMCFMISEIRRKEYRNRIW
FT                   DINYKTFVFKKLAAISEVSSSERKELAETIQPDFDPGFYLKYNDLKLNSVEAAEMVAES
FT                   IFGFLEVQTIIYEDLEKFFPDNHKEVYTYLADNSEVKDKDNPPITFEDLKAKAIALYKE
FT                   RTDISRTLQSRDIIINKLDIILVGIAMYFGVILVMILLGINYEGMLAAIVPSIVTFSWI
FT                   FSDTVKEIYNCFIFLLVNHPYDCGDRVVIDGEELYVSSVDLLSSTFTGVNGRQVLIPTS
FT                   TLFRAKIHNIRRSGKQFSEVSILVSRKTSFDAALRLKDGIAKTFSESTKSFSGEIYIRD
FT                   FRTEGENVKIIFAIQHQSNFQDVKKKYSRRAEIVNILEKEMRSQGIEYLNSYRFSD"
FT   gene            43311..43381
FT                   /locus_tag="Eint_100410"
FT   tRNA            43311..43381
FT                   /locus_tag="Eint_100410"
FT                   /product="tRNA-Pro"
FT                   /note="tRNA Type: Pro, Anti Codon: CGG, Cove Score: 51.90;
FT                   similar to ECU10_1475"
FT   gene            <43471..>43938
FT                   /locus_tag="Eint_100420"
FT   mRNA            <43471..>43938
FT                   /locus_tag="Eint_100420"
FT                   /product="HIT bis 5'-adenosyl triphosphatase"
FT   CDS_pept        43471..43938
FT                   /codon_start=1
FT                   /gene_family="HOG000164170" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100420"
FT                   /product="HIT bis 5'-adenosyl triphosphatase"
FT                   /note="similar to ECU10_0480"
FT                   /db_xref="GOA:E0S9I3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I3"
FT                   /protein_id="ADM12368.1"
FT                   /translation="MEFGDKVIPYDHVIIKTMHSFIFTNLRPFLPLHILVSPISKKQRI
FT                   YELTNEETSDLFNTVRVAMLGLKDLCDGFTLGVQDGSCAGQTVFHVHVHIVPRVVKDLE
FT                   RNDDIYEKGALDSADRPAREYDEMKKEAAKLRKIIGRAFDSEGLYYQNSFE"
FT   gene            <43988..>44767
FT                   /locus_tag="Eint_100430"
FT   mRNA            <43988..>44767
FT                   /locus_tag="Eint_100430"
FT                   /product="putative metal-binding protein"
FT   CDS_pept        43988..44767
FT                   /codon_start=1
FT                   /gene_family="HOG000149826" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100430"
FT                   /product="putative metal-binding protein"
FT                   /note="similar to ECU10_0490"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I4"
FT                   /protein_id="ADM12369.1"
FT                   /translation="MLELPPDTRKGFLYLVDREVFSKFKGYVDLDFLYEEDHGEVKVAS
FT                   VSVLEDSFMWSEGNEEKSALPSEFRCSHGNEITHKSLNLLPQEGWEELIDCWSCHNCEF
FT                   RTMLDLKLRPREGGLLLSDFFFLVNDRDLPECCRKNDSSVRKLFYNEIEQEEFTHRALI
FT                   YSYMNLHFRNKNVLLLEVNEKKYEIRYFYKTMLVSANGKSLEKKEAMKVGIKETDKLLE
FT                   ENKNINNFYSKLIWDAVTLGAVGITALGYGISFVTEK"
FT   gene            complement(<44836..>48015)
FT                   /locus_tag="Eint_100440"
FT   mRNA            complement(<44836..>48015)
FT                   /locus_tag="Eint_100440"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(44836..48015)
FT                   /codon_start=1
FT                   /gene_family="HOG000149825" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100440"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0500"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I5"
FT                   /protein_id="ADM12370.1"
FT                   /translation="MSLKDQLLRLKKCRRAAHSEMKGRVRFGDTEDMDEETILELIPIQ
FT                   TPYTKTKSLFFDRQRQTEEEERKFNRGFSEFLKELVRYGNVKDIEYLFEYLVRRYMCDT
FT                   FNPKEMIFFLLPFKKYYGQVLCISQRSDFNYFSIQPTYSYQFIGNLCLREKHFFDFFVG
FT                   YFEHFKYIQDFCLDVTGYIVSGIKNTDKDFSMQFYEMISHLTKSGESDAAVKIFFEIRD
FT                   HVEGVLDEFVELLEPYFAKEYLMSRKLEEVSHKEDIPHEESALFRKIYDSGNDRQILRD
FT                   SSRYKDYVMWLHREELSLKSINEIEIGALKTLCGIEEKNLDGEIFDYINLFRELEDKKG
FT                   LVKLLSQRFPKNVSTLIPHMGDADKAYLSEQSPWLWESLITEGNYSIVVMNMPRKMVEN
FT                   DLMKIMKTCLKYVKYDGNVFVDYLDEKVLFSLMDECQENVFVKNIIDTAKLMNIDLATI
FT                   IIQKEFYTNPAYLNYLSEKARGFEVEMSRRLLKKAMEFSSKAHMDALCGYLQQVKDEEL
FT                   INDVFGWLIDKMWFYPAFYSGLRIHLEVVSKENCEKILSTKGFSKDNYDVVDRLYRYKE
FT                   EVIDECLVERHHDALLSLCRKYGFCKILGNRRNEHVVDFIETTSKQNLLPKDEEDFIRY
FT                   SSSLVEFGGERIVKALFQSKYIPHLIKCTTIREWNVIKVIVSELVLQYDKYRQFCFDYF
FT                   LGNFSDFKGDLDLFETIVEDEASIDYQKLMDVAKNSDYSFRSSLFDILLRKLPFDSLQF
FT                   VPMIAPCMIEHKKESVRILFEKHKNIMGPYVKDILQKFPELQDCMLEIDSRYLLTGAIK
FT                   AYVDAPDEHHLDFMHKVLDTSGLSVSPSVLIKVVKFLGSNVSKLKGKLLTKFFEVYLKV
FT                   NPEADEEIQSLLRIIYERNRCVFFQVSQASFSLCFKIFKPYADVMVKLVEEKDKDAISF
FT                   ITDYLYWDSEYGLPHRKMFEILFLFYCDDPDVLYARCIGSILRHNPKEIEDANDLILNS
FT                   MKGDKTVIILKLLQVLYQKVYHFKKCLVKSSPYFALVVDSTRKEISSAARKLLSIIERK
FT                   HNKSGYQLLQL"
FT   gene            complement(<48071..>49216)
FT                   /locus_tag="Eint_100450"
FT   mRNA            complement(<48071..>49216)
FT                   /locus_tag="Eint_100450"
FT                   /product="3-hydroxy-3-methylglutaryl-CoA synthase 2"
FT   CDS_pept        complement(48071..49216)
FT                   /codon_start=1
FT                   /gene_family="HOG000012351" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100450"
FT                   /product="3-hydroxy-3-methylglutaryl-CoA synthase 2"
FT                   /note="similar to ECU10_0510"
FT                   /db_xref="GOA:E0S9I6"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I6"
FT                   /protein_id="ADM12371.1"
FT                   /translation="MPAKNMFGIVGLEYQLPSLYIDQEEVANNIDFEVDKIKIGLGLEQ
FT                   MGVPSRREDSISLALNAVSKLMKKYKLSPQSVGRLEVGTESNPDGSKSIKSYLTDLFPG
FT                   NTSICGCDSVHACYSATNALLNAVSWMESSLWDGRLAIVVATDVAMYKDKRCQPTGGAG
FT                   AVAILVGPNSIYRIVPSSIIHYFTNQFDFMKPRKTHPFPVVKGKESIENYRTAFEVCYG
FT                   KFREKMGDETFDYIVLHSPYTRLPEKMCVANHIDRKKFLKSLEASRKNGNAYSASLYLS
FT                   LISLLDGHDGKIGEKILMFSYGSGTCSSMFCLERISQGCIVTGFEKRLLERRKILYPEF
FT                   VKLVEEPVPQDNYEPREGVSLPGYYLKRISSFERHYECLME"
FT   gene            complement(<49434..>51065)
FT                   /locus_tag="Eint_100460"
FT   mRNA            complement(<49434..>51065)
FT                   /locus_tag="Eint_100460"
FT                   /product="ATP/ADP translocase"
FT   CDS_pept        complement(49434..51065)
FT                   /codon_start=1
FT                   /gene_family="HOG000149299" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100460"
FT                   /product="ATP/ADP translocase"
FT                   /note="similar to ECU10_0520"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I7"
FT                   /protein_id="ADM12372.1"
FT                   /translation="MSYIQPSTSPKNSCLFRTEEELEEEVYKKTGFFKHIRIARNEWPR
FT                   VLYLSLLFGVITMVHTIMGNLREMVLMGRQDPMSMFFIKSIFLPPCSLIFVWAIHFGLN
FT                   FFNPSKMFDITLILFSGCYFFFGLVMWPFKAYIQKDFYWSRDIFGDGKMESLRIHFLYP
FT                   VFLVFNEWTSSFLFLCSEMWGALVVSYFFNVFTNEISTRRQSQRYITVYNISNAISIFL
FT                   SAVFTLIFNRWRDSVVFETKELGFEILILLLAFGVIGVLVLKKYIEKKILPVPVFLIKE
FT                   IKETPVKQKELKLKEAGKSLSKSKLLVAISLNVLLYGVSSTLIEATFKSGLAAGAKYTN
FT                   NSKETFSNFYNGSEQIIIAMTLLIVINTPYSALIKMGYWKYVASIPIAVVVFSFFSVFL
FT                   IAFYNVGVYSGKSGLFKSFFKGKQPVFFLENTLGLITNASLKIGKYLGADVSKEAISMQ
FT                   IDPLYRAKYKAIYDGLCGKLGKSLGSVMCTVMTGIWDITDIRIVSGVLGLLVGIIIVIW
FT                   CFIVKYLNGKFQTSVEKNTYIELDEF"
FT   gene            <51538..>52296
FT                   /locus_tag="Eint_100470"
FT   mRNA            <51538..>52296
FT                   /locus_tag="Eint_100470"
FT                   /product="uracyl-DNA glycosylase"
FT   CDS_pept        51538..52296
FT                   /codon_start=1
FT                   /gene_family="HOG000229528" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100470"
FT                   /product="uracyl-DNA glycosylase"
FT                   /note="similar to ECU10_0530"
FT                   /db_xref="GOA:E0S9I8"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I8"
FT                   /protein_id="ADM12373.1"
FT                   /translation="MFSKRKTTASEISSGRKVDWVCEGCINPCEYCKLEEKIDPKWRVY
FT                   LKSEFGKDYFRGIKRFLHKNKNHLPPIDKIFTFSKFFPLENTKVVIMGQDPYHNDQQAM
FT                   GLSFSVPLGVSIPPSLRNIYLEASTDIEGFEIPSHGDLTKWAENGVLLLNDVLTVTKNQ
FT                   ANSHAGIGWREFTSRILQIINEKCTNVVFMLWGRHAQAKGKFINKNKHLVLCCGHPSPL
FT                   SSNHFFGCKHFSKANKYLREHGKSPIKWQI"
FT   gene            complement(<52400..>54058)
FT                   /locus_tag="Eint_100480"
FT   mRNA            complement(<52400..>54058)
FT                   /locus_tag="Eint_100480"
FT                   /product="ATP/ADP translocase"
FT   CDS_pept        complement(52400..54058)
FT                   /codon_start=1
FT                   /gene_family="HOG000149299" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100480"
FT                   /product="ATP/ADP translocase"
FT                   /note="similar to ECU10_0540"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9I9"
FT                   /protein_id="ADM12374.1"
FT                   /translation="MSEIGFSAPVDEHRPLLTEDEVEAQALSSTTWPLSRIRIARCEWK
FT                   LWSTLAFIFGSAAYIYSFSRVMKDSFVLSRQLPVAISFLKTCFVLPMSVIATGVVQKLL
FT                   VTRTISKVFDYTLIAFAFLYTLIGTVLLPFASKIQPGFYLSRDIFADDKMLYKGFEFLF
FT                   AIFLIFNEWTTSFVYVCAELFGSLIVQFMFLSFANEALTIRQSTRMMPLFYVVSNILLL
FT                   LSSESTALYSRRVKMWDYKTTCLVTNSFFVIFGVLIAITYLMKKYAENRILKKQLFIRT
FT                   EGIKKKGRKPTTSFSESIKLMAQSKFLVAMVLNALFYYAGTNLIESSWKNGISVAADAK
FT                   NMEKRAYSASIVSGEQRVVGALVAIILLTPISTLVQTHGWITMAIVPPLVTLVSSMVIF
FT                   GSAYFNYPNYPSGREGVILSSLVKGYQPNFFLECNMGIYCVSGMKIAKYAFYDISKEAI
FT                   SLQIDPIYRPKLKAVYDGLCGKLGKSIGSLYAMFWSLMGYNDVRAAAPITLGIWLIISP
FT                   VWVYSVLYLNRKYNQSIQTSSPIDLDLFSGKKDLE"
FT   gene            complement(<54327..>55031)
FT                   /locus_tag="Eint_100490"
FT   mRNA            complement(<54327..>55031)
FT                   /locus_tag="Eint_100490"
FT                   /product="proteasome alpha subunit C6"
FT   CDS_pept        complement(54327..55031)
FT                   /codon_start=1
FT                   /gene_family="HOG000149283" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100490"
FT                   /product="proteasome alpha subunit C6"
FT                   /note="similar to ECU10_0550"
FT                   /db_xref="GOA:E0S9J0"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J0"
FT                   /protein_id="ADM12375.1"
FT                   /translation="MTTQEEISNIFNSDGKLLQIEYGLEAVNNSLPIVTAKSKSMIVCA
FT                   SKKIPRDKLEESESSSFFRVSGKCYVGITGLSGDVDYVIKRIKMVANQKTFSFGMEVTP
FT                   DILCRCFADKIQQLIQSSEERSPAFNASIFGFDGKKPMIYQTDMSGISYPCYATAAGEK
FT                   HGKMTKFIEKNHHGDMEDKELFELAIGALLESIGTDSGYSEIEVAYLRAGQDLCHLSGK
FT                   DIDKILQDIAEK"
FT   gene            <55075..>55785
FT                   /locus_tag="Eint_100500"
FT   mRNA            <55075..>55785
FT                   /locus_tag="Eint_100500"
FT                   /product="putative short chain oxidoreductase"
FT   CDS_pept        55075..55785
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100500"
FT                   /product="putative short chain oxidoreductase"
FT                   /note="similar to ECU10_0560"
FT                   /db_xref="GOA:E0S9J1"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J1"
FT                   /protein_id="ADM12376.1"
FT                   /translation="MGKINLEGKTVCVTGGSRGLGLEITKELAKKGCYVHVFGRSPQPF
FT                   SHKNVKYYQMDLLKERPAIAIPFDIVISNLGTSVGNKGFDEMEYKEVTDMLKLNVELHL
FT                   WLLKNISYKKFVFVNSILSQQGLPGYSMYCASKSFIHTLNQSLRREGKDTIIIYPYKIN
FT                   TSLFSEIKDIWTLDANYVAQRLLRDIENGTREDFILWIFKPITLLSKMIPMFLQDILSR
FT                   FLERVFYITKRKSE"
FT   gene            complement(<55840..>56850)
FT                   /locus_tag="Eint_100510"
FT   mRNA            complement(<55840..>56850)
FT                   /locus_tag="Eint_100510"
FT                   /product="ribosomal protein S6 kinase"
FT   CDS_pept        complement(55840..56850)
FT                   /codon_start=1
FT                   /gene_family="HOG000149282" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100510"
FT                   /product="ribosomal protein S6 kinase"
FT                   /note="similar to ECU10_0570"
FT                   /db_xref="GOA:E0S9J2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J2"
FT                   /protein_id="ADM12377.1"
FT                   /translation="MIGKKDIMCIEKTGLGPFWEEFLVFIDVGEVVGGLYGLRVMKKKK
FT                   IIGYGEQEMVQDEYYVRSRIRHPFLINTICGFQDYEHLFLLSEQSQNYLVNLISSEERL
FT                   SPKVSRFYMAEILLAVQYLHSKGLSYGFLSPRSMMIGDDGHVKLKYDFLNRIDCGIGDL
FT                   EQNVEYASLDYVESGEIGPVSDYWSMGMVLYHMLSGTTPFAAPDMASTVERIRKNRIKF
FT                   PEFFDKNARDLVSKLLVVSPKDRLGYRERDCMAIRKHPFFEGIEWQEVFQKKSKPPFLF
FT                   NIARKECFSRPANLRILYTTDYLPDQKNGYGQTFRGYGTIYSSEVYRKIWRYGYI"
FT   gene            complement(<56943..>57872)
FT                   /locus_tag="Eint_100520"
FT   mRNA            complement(<56943..>57872)
FT                   /locus_tag="Eint_100520"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(56943..57872)
FT                   /codon_start=1
FT                   /gene_family="HOG000149824" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0580"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J3"
FT                   /protein_id="ADM12378.1"
FT                   /translation="MDLEKLLGAFRSRMEEKRFPFITSSMLSLGVGIAILGRPNGAKDK
FT                   SIMGYIKRAKEKACRFLQDPEPKTPVLPPQERPKPTVIFDCKDFLIKKRFSFFNLDFLV
FT                   TKRAFTDLFLFHSAHIYELVHVSESSVGFSRFLLNRIDPYGCISYKVYCKDKKMFGSEH
FT                   LNRPLEKVVVISTKENEYHKDFDENLLRLEKWRGGPEYGLLDLLNFLHNLHFTGISDFR
FT                   GTLKSYLGKNFYSAFERVQKGIFVQRNLFSWDVEKRYRSRIKEINEKRMKDFEKAKKTM
FT                   DADLQKRGVEEQSSVLGNLFDLVIKLLI"
FT   gene            complement(<57901..>59232)
FT                   /locus_tag="Eint_100530"
FT   mRNA            complement(<57901..>59232)
FT                   /locus_tag="Eint_100530"
FT                   /product="phosphatidyl inositol-3-kinase"
FT                   /note="C-terminal region"
FT   CDS_pept        complement(57901..59232)
FT                   /codon_start=1
FT                   /gene_family="HOG000149280" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100530"
FT                   /product="phosphatidyl inositol-3-kinase"
FT                   /note="C-terminal region; similar to ECU10_0590"
FT                   /db_xref="GOA:E0S9J4"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J4"
FT                   /protein_id="ADM12379.1"
FT                   /translation="MDQLSGSAFECKIEKEDISELARSVSRLLSRSEDAEKMIAEYLCV
FT                   QKVGSLYIYFPSLGGKDPGDNLSAEHQINRFWKIRFELHEECNESKYRDAVNSFLALDS
FT                   KYGILEKLEGQMALINEVRGIYSITCQGSPRKTKIREYKLHGALCLHPRMGSIRHCTSL
FT                   FNPDTVVKEMILREIKIFPSSTFPILVPLNTDKGISRIIYKKGDDLTKDLFVLETIRYI
FT                   SELVEMDLVAYKVIPLSREEGIVEVVDGVDFTQIKGREDLERYIEGENDPRWMQNAQKK
FT                   RTFVDTLCGYSVACYMMGVGDRNPGNMMVSRDGRFFHVDFSYVFGNDPKLISPRITIAR
FT                   PICDYLVNDELIYQDFIIKSGEVFLQIRRSCQKIFVLWCVLLQNKIFRFDLEEIITFAR
FT                   GRLKMEVTEQRALELFEREVKDAVGSFKTSIMHLVNRVGMFLRR"
FT   gene            <59330..>61048
FT                   /locus_tag="Eint_100540"
FT   mRNA            <59330..>61048
FT                   /locus_tag="Eint_100540"
FT                   /product="DNA replication factor A protein 1"
FT   CDS_pept        59330..61048
FT                   /codon_start=1
FT                   /gene_family="HOG000149279" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100540"
FT                   /product="DNA replication factor A protein 1"
FT                   /note="similar to ECU10_0600"
FT                   /db_xref="GOA:E0S9J5"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR007199"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J5"
FT                   /protein_id="ADM12380.1"
FT                   /translation="MKLEPGTVEALYNSQTTNPLYKNPILQITSLGKLSVAIGDKQRYR
FT                   VNLSDGVHYMKGIFSSELTAHFEKGLVSRYSLIRPGRFSVRSKDGSVYIYIQEIQEYED
FT                   CNVEIGKPVNISTGNASFNDNQLSPGIQKRVDGGNQHGKALDEEDKKRVKKDIKDEGEF
FT                   TAINMLNPFHNKWMIKGRVVLKGDIRRFSNQKGEGKVFNFEISDGTAQVKIICFSDCVD
FT                   IFFPIVEVGKVYSVSKGTVKMANKQYSTNPFDYEIILDKNSEVRCTVDDGSPRYFFNFI
FT                   KLSDLSLGNAYCDVIGVVREVYAPSTVMVRSTQNELLKRDIILVDESGSVRLTLWGPKA
FT                   ELDIEGGVVLGLKSVKVSEFNGISISTTGGSQVVINPDIPEAHELAGWYQSTGKDMQVA
FT                   LPRKEEKRRLIQEVKENELAYSTIQGTVMFLKEDALWYTSCKGEGCNKKVVMEDSGNYR
FT                   CERCNMTYEDCNYRYMVTMHLGDFTGQVWLSLFDEAAASFFGIPAQEMKRMSEESPAEL
FT                   QALIKGMYFKEYLFRIKSKQDSYNDEIRMRYSGLSSSPLDIRKESKRLLDAIEKA"
FT   gene            <61099..>61593
FT                   /locus_tag="Eint_100550"
FT   mRNA            <61099..>61593
FT                   /locus_tag="Eint_100550"
FT                   /product="hypothetical protein"
FT   CDS_pept        61099..61593
FT                   /codon_start=1
FT                   /gene_family="HOG000149823" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100550"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0610"
FT                   /db_xref="InterPro:IPR005037"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J6"
FT                   /protein_id="ADM12381.1"
FT                   /translation="MQYKGINRMTREKILASEEFKKMRSLTQSDVIRSIQSLDSIGGLV
FT                   RDTPHRFLCLVQKMGAISLDEDVIAANLGDFRPEEPLLSNSSMEMFRGNVCFIAASLLY
FT                   LRLSKRFHKYESLVRSFLMDFRKVPMVDGENNKTFIYLDVLADDLLNRTRVFNVHLKKT
FT                   F"
FT   gene            complement(<61653..>64472)
FT                   /locus_tag="Eint_100560"
FT   mRNA            complement(<61653..>64472)
FT                   /locus_tag="Eint_100560"
FT                   /product="nonsense-mediated mRNA decay protein 5"
FT   CDS_pept        complement(61653..64472)
FT                   /codon_start=1
FT                   /gene_family="HOG000149278" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100560"
FT                   /product="nonsense-mediated mRNA decay protein 5"
FT                   /note="similar to ECU10_0620"
FT                   /db_xref="GOA:E0S9J7"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J7"
FT                   /protein_id="ADM12382.1"
FT                   /translation="MREETRQIFLQTIDPDSGKRSAAESMLMNLEKQPSFVMSLPDTCM
FT                   KDSDATIKRVATIYFKNAIIKQWGSDEYSEVRKYLVENVLDLFLYGDEITRMAYDAILV
FT                   NIFNNEKLNDLNGLFQKASSFMKSSDTNHMFTALNMYEKIFDAEKIKYNLEQVLGLLFD
FT                   TAGKDVLEKVYGFLESGNYSMVKTGMIVLTKSYGYYSIPDFLSAISTFSYVFNLSLRIL
FT                   NLRGTDENLLESKKWAAYFMYKACSKGVKKFYKNNELSEYVTDVNRFQMVYGTFLKIIQ
FT                   ERSEHTVDIELYAIDFFVLLTSDSEFFRYMEPNLSYFISGYILPLYSLSDSEEDDFEND
FT                   PDKYLREKYNFFGNDLRNSLNTLFCEIVAKIKQKQEAFQGIVNYLVSILGAYKESPSRE
FT                   NIRMAYGSFFLLANIKSTLMKKARSALEYIIANHVIPALQGSSLVLKSQACYFLSTIEE
FT                   DLPMGDLVFEAMTNVHKLMKSNHKVLEVEGTLAMSFFLFNETASEKFKELIPETVESIL
FT                   NLSNTYDLEPLTILLDSIIEYYPEEISKYAPELVGSISRITLSHLMNENDSGDNKLMVV
FT                   SGFLRSMENLILSLNQRSPALRHSYINSYDVISFILKEEKADFYQEALDILNGYVFMIK
FT                   EIEGSMWGLFQMILNLPIDEITVYSSEIADLIDNFITYGKATIMDANILGSIYSVVSKL
FT                   CLCNEENFFDDDFIGGCRIIESIILNIGNEVLCKDPSRLPFFISVAVSGEKMIDENGPA
FT                   MVYVLELIMNCFILRPRETIQILREQKYLQEFFEKLFSQKSKFKRVHDKKICILFIGTI
FT                   CRLQSGDLPELDVRNLGKALVATVTSLPAAIRLRNQMKDDEDAVASSVDSEDEEDLDAS
FT                   DISGMDILEEDIYFETALDHFEPFGYISSILSSPVVGSYAEKVIAEMTSHQKESISAVL
FT                   NGERVVQKI"
FT   gene            complement(<64565..>66100)
FT                   /locus_tag="Eint_100570"
FT   mRNA            complement(<64565..>66100)
FT                   /locus_tag="Eint_100570"
FT                   /product="T complex protein 1 subunit eta"
FT   CDS_pept        complement(64565..66100)
FT                   /codon_start=1
FT                   /gene_family="HOG000226730" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100570"
FT                   /product="T complex protein 1 subunit eta"
FT                   /note="similar to ECU10_0630"
FT                   /db_xref="GOA:E0S9J8"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J8"
FT                   /protein_id="ADM12383.1"
FT                   /translation="MNQLFVQTEKIADPREGKLQVISNIDVCMKMAEFLESTLGPYGMD
FT                   KLFAGKEIVVTNDGATILKHMKVNHPVGKLLVALSESQDNEVGDGTTSVIILTTEILSC
FT                   LKPLIKDNFDLESIRECLSELRMVCIEHLEKMSMDLNDEMLYKLAETCVTSKNIRHEKK
FT                   HFSQMVVDAIRQASIDDVDSIGVKKVQGGSIGDSTVVNGVAFEKCFTYAGYEQQPKKIL
FT                   NPKILCLNVELEWKSERDNAEIRVGGVEEYQKVVDAEWEIIRRKLDEIIDSGAKVVLSS
FT                   LSIGDYATQYFAKHGIFCAGRVSKEDLNRVIGSCGGRILGSTDYLEESLGSCGLFEERQ
FT                   LGKFRYNYFEGGGMNACTMILRGPGQEVLEEIGRAVHDAMCVVRSALKTGKVVTGGGSM
FT                   EMELSKVIREKSMEYGNKKVFVAKAIGQAFEKIPLLLARNFGFDTISTIQDLRKRHASG
FT                   SLYEGVSIKGVQDMKALGIYEALEVKKNMIKASFNGVASIIMIDSTIMAEKSQ"
FT   gene            complement(<66349..>74292)
FT                   /locus_tag="Eint_100580"
FT   mRNA            complement(<66349..>74292)
FT                   /locus_tag="Eint_100580"
FT                   /product="dynein heavy chain"
FT   CDS_pept        complement(66349..74292)
FT                   /codon_start=1
FT                   /gene_family="HOG000149277" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100580"
FT                   /product="dynein heavy chain"
FT                   /note="similar to ECU10_0640"
FT                   /db_xref="GOA:E0S9J9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9J9"
FT                   /protein_id="ADM12384.1"
FT                   /translation="MKMFSIFNLFEIFARKTVNNRMMIVRYLDSIVKSCPPSLDDNFCN
FT                   KLSRLFMFHDMFGEVWKILDLFFGQDYDGIVQLWEIRRMKKSIERQVSDTIYEWENSVL
FT                   SDGFSWGRIVSISREADGNRKFKVSPEPTILKRLDEYMTIVSLEGVRSRISQPIHETMA
FT                   LALEARSIYTRIDDGCRRINRILEDVREDLDLFHKEIDLVFGSMEKILMLRWKDAKDFQ
FT                   DIEEIDDRVRELENRVYTYRFLLKKIAKEEMKAIFSKQIQKQMLFSLDSETYLEFFKFY
FT                   EKSIVVRGINRSMSRVFLQYLESVLEALEAGDSSLFSSKHRLKKEIVKIEGCGNGVEHC
FT                   FEPPLSEYFKILEKIFPSEGEGYFFEKVLQRLRPGQEIRSKVEKIIGMVVANYETCTRI
FT                   LELIPTWDLPLGLYERFLRVRDSQRSVEMFVKNTIPFFTFEHTMDASEQARLFETVCDE
FT                   VCRFVSAENSRVYDMLAARKDMVGGMGDSGSQESSMERRDLLEGISNSILVDEYLRSEE
FT                   FRILEELNGAVIEYGLERPSVAIETVRSERDSALEANREALNLFLNDIPFGIIKSRREA
FT                   LVSEIRDFGEKIDNAAKERDGLMFWPMFKSLKTRYEELEEKIKRFNKILGIVDYPLICS
FT                   SLQERIGGLDAEWATFSRFETILKKYESQKVCDVDVEQLSSFLKSIDVSLFHAEYYKEF
FT                   QSKIKYYISGLDCLQHTKSPYVKKKYFDTEMETKEFFLLQDKDEVEKRLADSRMEYEVE
FT                   RYIERARAEIFLVSLKVRHLRKEEVVIPDLSQVEERVNKLLVEHDSISRFNEKNFFIEE
FT                   LNGIKERMDDCLSFLACLEEVQRGIREFANVFSTDGLDFEAKKYSMIKKRFLDVLNRFS
FT                   TPSSSSGWEVKLGALLPHKDEFLGMKKDFDDISKGLKVFLRRCRERTPRLYLVSDIDLI
FT                   RGLNSRSYYVEMLGMMFNIDGVIVENGSILGFEGNGETVMLRQKVQIDQDIGGFMDTFE
FT                   EEVKRTLKSWFHDGLESLKEGCPSIISDLISEFKYFNKRDFEMTPKLRVLEREIEKHPN
FT                   GVIRLYPKPVLKSGELFMDSTEEIEYGFEYYPPVDIVFTPLVCRVLSSIAISLKSLCGV
FT                   ILYGRSGTGKTESVKYYCRLIGKPVFVFCCNEGCELETLRNVISGAVLTGSYLCFDEFN
FT                   RLSEEIMSGATELILLNKNKTKFFLTMNIGYKGRYRMPRSLRAILGETRIDAPDIKDII
FT                   DYYCKESSEKIYRLMREVESKASKQDHYDFGLRAVRTITKGREEAEIMRSAIYFYMACL
FT                   GREDKAIFVKEFEKIFERKVEQNLAHKDMLLYGLENRRGALVIGGNGAGKSTLIKLARE
FT                   SRGAMCFYYNPRNIGKIFGFQDKVTGEWKDSKFVRDLRRNMDSSKECWFVFDGIAESFW
FT                   IEDFNSILDENKLLCLSSGERIRIPDHYRFVFESTSMENITPATLTRVFLVHMEEDDLY
FT                   QIGNLQNTVGTGMDIRYDGRKVPVFPFRGLVVTEEQSFYARAMEALVKDGSKVFFMRGE
FT                   VGVGKRSLVEEVFKEKVVVIEGNGFETSMIAQSLGEDKIKRVGEEKIYDLRSVVYIEGF
FT                   DCRNVSLVEAVREYNECGRIGEIEVKNMVLICGINEKKGNDAIRNTAAERLRRKIKSIF
FT                   VEEPRDTELLFESEIRKRFEATKHFQDYKRVLQVVEFIYKNFKVNLKEITSFIRTLGDL
FT                   CMEEGDLVDLMYFEAKIYFGESKDLEEEMQRAFGRRPEEIEFNLETRRFRRAKRCSDIS
FT                   YVGSIFHRGYNLVIEGGRMSGKHWVVRECMRQMKENVRIVSNEDEKKIDGQTAFLVEDV
FT                   SSLRKDISNQCMIFKLKRTAYYSLDLLKIYNMVRSKDISDLDMVKECFTTNVGINIDLE
FT                   NEGIPSETSSLAMGVEEDGHPWECQHPNVVTTGFLCKAIGFGMSFARIAREFKEKESRR
FT                   RKFLIGGLQKIEDFGKEALALGLESSRKKKDLEKLTDRLDGQLEKIINTQKQLEREKGA
FT                   IGNRKREIEGALMMNQKKQEVIDKRLRVAKTLLSESRRSIEELPKSSLSEIRVMINPPE
FT                   IVRNTVEAVYWIVEGETKGGSIEWKQLIQFMKREDFVSKVLNCRSTKVPDVLENMISNP
FT                   LFSYEKAQKASSACGPLFMWVMARYKYAKTMEEISPLDQEIAVLGKEVEKSRKEIEEEE
FT                   KKLLQIEKKIEAMKDEYNASVLKLESIKKEIKSADERALLMDKIVRELSDEVEKWRRMK
FT                   YLCPIKYILSSTDWVLHCKRNGFVHSSGISALTRARRFISTSLEDKNYKQVLSNCSYYG
FT                   NDVIVYGCDRFDKDVYRALKRQMDNPQYSIILVSSTKTNPYKEYTYNCSFVERFETEES
FT                   GNLERLEERLLELIVEHAPLNEVYEHKKKLEKERSISKQHSKKREVYEILNLVFGRKSK
FT                   IFFEAYGVHLSFRIYREYVENVIYPILESRLCRDNFENMWAGMVDADMNLVRDVISRSV
FT                   DSFYSSTFPDTKDEYEGLIHEMSRHPFDYTLIIACDIATHIIEEKMAITAVISAGPKEN
FT                   NEKIYRMLEEESQEDRTYLIKNIHFLGSCKKSGNSRLILTIEEGKKHSLMEDTKVVYCK
FT                   GYGTQEGTAIASFSGGDEDLVKFHVEMSNRNSQFGLKDLMLCAENMGHCDREYLKTIVY
FT                   GSRLDV"
FT   gene            complement(<74315..>75781)
FT                   /locus_tag="Eint_100590"
FT   mRNA            complement(<74315..>75781)
FT                   /locus_tag="Eint_100590"
FT                   /product="dynein heavy chain"
FT   CDS_pept        complement(74315..75781)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100590"
FT                   /product="dynein heavy chain"
FT                   /note="similar to ECU10_0640"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K0"
FT                   /protein_id="ADM12385.1"
FT                   /translation="MDTNNTLCDEIDRIVDKLKSTTDFHKCISDSNGHSYECKEKSQVG
FT                   ADCIVNHRKDGLLILKGSCEFMVDAMSNFVIPATMSRIKKKGVSVAVEKALRLLEHHAL
FT                   HLSKAVSEEDKKEKIYLSMETQEMDRLYRKHGEELQNGLDPERFLSSGELELIHRNVEQ
FT                   WTSCIRGLHESVGFKRSGFHEEKTFWSKFYMEMCYIREFGKSEVFGFVHDVLKRSKRFV
FT                   SAATLESLMLSNKYFELGRGLHGFYEGMDFKGVYFPRSLDEFKDSTVSAIKEIGRRIGR
FT                   QSKMARKLILSQMDRLVWLIIDKVHENLSIGWLKCCEELLLCSIESMCSLTVSREGEES
FT                   EAMSLESSLFYEFRGGEELAKFHSEFKDIKKILLFSWSFKGLGAVVPKLLKSSPEKAAH
FT                   EIRYRSLLQEMISEIGDPDLRPVVGWMKKDLFNIKARLEVVFDQQEGFVSDVFNEAFER
FT                   ICDIDSDILEEGEKERNRSSGGIIATGGWR"
FT   gene            <75805..>76725
FT                   /locus_tag="Eint_100600"
FT   mRNA            <75805..>76725
FT                   /locus_tag="Eint_100600"
FT                   /product="hypothetical protein"
FT   CDS_pept        75805..76725
FT                   /codon_start=1
FT                   /gene_family="HOG000149822" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100600"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0650"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K1"
FT                   /protein_id="ADM12386.1"
FT                   /translation="MRTLTIDGRALVMDIHMLRKERENCINERDRLISEMDSFIVGSMG
FT                   EIREALTIPETTVWEISQEDLLLFVSWRISKLISLTRDKKIEILSKLVWEKVNYKDLEN
FT                   ILVAEYCYKKVLANDFSESSAWDTDVYIDIGNGDVDIKSDSVERITTGSDGVFYRSLNG
FT                   LFSKRFHVRVSKELMRSYALNIKVEMGLEIFKSLYEKDEEDLKRLSSYKHYKEKGLPTL
FT                   VMSGEMTSNLMEDIRARVSQEVTGIIAAEMPDRKKALLITYLLVMFGGIGSDLDLSYFN
FT                   GKKELYMLEWTKSKENIFIKIQLES"
FT   gene            complement(<76730..>77863)
FT                   /locus_tag="Eint_100610"
FT   mRNA            complement(<76730..>77863)
FT                   /locus_tag="Eint_100610"
FT                   /product="histone acetyltransferase"
FT                   /note="MYST family"
FT   CDS_pept        complement(76730..77863)
FT                   /codon_start=1
FT                   /gene_family="HOG000182457" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100610"
FT                   /product="histone acetyltransferase"
FT                   /note="MYST family; similar to ECU10_0660"
FT                   /db_xref="GOA:E0S9K2"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K2"
FT                   /protein_id="ADM12387.1"
FT                   /translation="MKLEDVCIGFKVPVKKIVDGAEEVFKAEVLGTRTTNSRLEFYVHY
FT                   VELNRRLDEWIDSSMVDLSDPSQVEIPKKKKSEKTKTEKSRRDSEKEDGGGDEEPKLEK
FT                   PPQDEEFKMKNVKKIMLRNYLVDAWYFSPYPKAIAENDVVYICEFCLYYFGTMDSLTQH
FT                   ARQCKLRHPPGREIYRDGDLSFFECDGHIQKNYCRNLSLLSKLFLDHKSLYYDIDVFMF
FT                   YVLCRLEDNGYQIVGYFSKEKVSEQGYNLACILTLPFEQRKGYGRVLIDFSYLLSKREN
FT                   VISGPEKPLSDLGLLSYRAYWMEVVVEYLSRHDKASINEISKETHISEDDIVGTLSAYK
FT                   MLRISGNEFIFTYSEKQLQKAQRSRDRCVKGSLLKLY"
FT   gene            <77914..>78444
FT                   /locus_tag="Eint_100620"
FT   mRNA            <77914..>78444
FT                   /locus_tag="Eint_100620"
FT                   /product="putative ribosomal biogenesis-like protein"
FT   CDS_pept        77914..78444
FT                   /codon_start=1
FT                   /gene_family="HOG000168475" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100620"
FT                   /product="putative ribosomal biogenesis-like protein"
FT                   /note="similar to ECU10_0670"
FT                   /db_xref="GOA:E0S9K3"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016686"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K3"
FT                   /protein_id="ADM12388.1"
FT                   /translation="MRDLKQEEEEKVLKKLKFFIGDNVNRILSGEEKLFLHNQRVMLLS
FT                   EKMKAATSMISRKNLIMAGTVIGKFTKNGNFRLGISSLNLLSKWAIHKVWIKSSAEMNY
FT                   VYGNNSLKSHIFRSSEGIPINAGVFVFNQHDVPLGFGITSLTPQAYSAAKGHALVLLRQ
FT                   SDTGEYVRNEEKI"
FT   gene            <78539..>80923
FT                   /locus_tag="Eint_100630"
FT   mRNA            <78539..>80923
FT                   /locus_tag="Eint_100630"
FT                   /product="HrpA-like helicase"
FT   CDS_pept        78539..80923
FT                   /codon_start=1
FT                   /gene_family="HOG000149276" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100630"
FT                   /product="HrpA-like helicase"
FT                   /note="similar to ECU10_0680"
FT                   /db_xref="GOA:E0S9K4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K4"
FT                   /protein_id="ADM12389.1"
FT                   /translation="MSGKKERLLKKYLEKKKRQRNRDELYAQIAALCRPEEDRKEQEKS
FT                   EKRKLEEVRSDSEDISLSVSEDSPSSSENEVGHSLQTKAMDVGCETMKDSNEEEAMDMY
FT                   LWDTHARNIQEEAKNAMVFSEDKESSECEDGTGDSVSEDRNTYISEETGKDVSKEYETK
FT                   TLENRREDIEEYRKTLPIYYEKAEIIFTVRNSSIVFITGATGCGKTTQIPQFLYEGGLG
FT                   TYGMIGVTQPRRISAVSISGRINEEANEDICGYKIRYESSVTSETKIKVMTDGVLLREI
FT                   QEDFLLSKYSVIIIDEVHERSTNIDLLVSMIPRIMKIRKERGNELKLVLMSATGDVDEF
FT                   KAFLGDITVFRCPEKGFQVNTFYEERTEMDYLNAAYERIRKIILSGSDSGKRRKMNGER
FT                   SDVIGSAVSNDKSASILVFLSSKQEIYQLKSRLEGSGMDLTALPLHSSLSRAEQELVFK
FT                   KTPNRKVILATNVAETSITIPDIVFVVDSGKVKNRMVDSEGITRYSVDFITKSSATQRM
FT                   GRAGRTGPGICYRLYSGKAYEKFFECMEPQILREPLDGVVLGLLSLGIGNVYGFPFLSR
FT                   PEKKSIASATMRLQALGAIDGNLRLTELGKKMSMYPVEPRLARLLCAQGFEDIFTEILV
FT                   LVSLISLGIEVRRNHSNGKYFEGSKSDLLVLLGIYNDFLKSRNRKSFCTEMGLGYTTAV
FT                   EAMKMITHLAKITGGTVDKVGSLNLTPDTCSRIRNIIYRGFADHLAMPLSGTHFFQKEE
FT                   VSPSRDSVSVESGDFVVFGSLVSSKGKLYMKNITIVEESWF"
FT   gene            complement(<80958..>82331)
FT                   /locus_tag="Eint_100640"
FT   mRNA            complement(<80958..>82331)
FT                   /locus_tag="Eint_100640"
FT                   /product="DEAD box ATP-dependent RNA helicase"
FT   CDS_pept        complement(80958..82331)
FT                   /codon_start=1
FT                   /gene_family="HOG000268803" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100640"
FT                   /product="DEAD box ATP-dependent RNA helicase"
FT                   /note="similar to ECU10_0690"
FT                   /db_xref="GOA:E0S9K5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K5"
FT                   /protein_id="ADM12390.1"
FT                   /translation="MRPRGIEDIPINSILKKEIEANGFGKMTDVQQMCVPEMLKGKDVV
FT                   VQSPTGTGKTMAFLAPILSAIYDRREEKGIVAMIITPTRELALQIKDVADLFGVGCECF
FT                   IGGMNIEDDYERMKKEFPIVVGTPGRLLEIVGRDTKKFSRVRHAILDEADKLLGFGFEE
FT                   KLLQLLAKLPKNRVTGLFSATINDSVSKLSMSSLRNPVSINVGNNAMPVALEYIVLSPM
FT                   DKLFALVDIVPGRRCIVFFATCNEVDFFSSLLSRAGLQNICKIHGKIPQDERNRVYREF
FT                   FKGNSLLFCTDVAARGIDFQDVDLVVHFDIPKEYSSIVHRSGRTARNGCKGESILFVMP
FT                   NEKAYTEFLKLKGIPVAESSYKIKPSTSYSDIKSKIDSDLLNLSVKAFVSYIRSYKEHF
FT                   VSYILDYKGLDFNSLAELFFLEKIPGMAELKNVKFEKFVKPEKTERKGTKPKKRIRKK"
FT   gene            complement(<82409..>84076)
FT                   /locus_tag="Eint_100650"
FT   mRNA            complement(<82409..>84076)
FT                   /locus_tag="Eint_100650"
FT                   /product="translation initiation factor eIF-2B subunit
FT                   epsilon"
FT   CDS_pept        complement(82409..84076)
FT                   /codon_start=1
FT                   /gene_family="HOG000149275" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100650"
FT                   /product="translation initiation factor eIF-2B subunit
FT                   epsilon"
FT                   /note="similar to ECU10_0700"
FT                   /db_xref="GOA:E0S9K6"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K6"
FT                   /protein_id="ADM12391.1"
FT                   /translation="MEIRDIKNFIRENREIILLICDFYETKQIPAEMTSLRKNLSLFPV
FT                   ANIPMIEYILSSLCDQKFFNVVLAGSDCEEVIKHVKKTELGGRMNIISLGCDGKSLGDL
FT                   MRHIDDNGLEFDDLLVIYANHYTNYPLRSIINRHREDKSFVMTLFLHPNESNSRVSHLY
FT                   GFRDNEVIFYNKCINEKCNSEKVREAVESDGTIEFTANLSSPTIAVVSSAIFPLFTENF
FT                   DFKTLGDLVGGILGFNAYNFKIMCCRQGDMMDVNGNIEQLSIERRNRFYSREIVTLYDY
FT                   FKFNEDVREGKAVDLLRFKCHNSGDFRSFVQVESNFFFDIPDVEFHEPISNTVIGCDLK
FT                   FKMNHFIKNSVVGHGCFIGGNIDRCIIWDDISVKEDFMDHIVFSEGRVIHYNYLEDEAE
FT                   EAVFEEKEPRRGTSFFDDVVLYLLSVVEREDLDRVDMDDVVKQITLLRIVRNASSLDLI
FT                   EAFSMFLVEMIDFNDIDGSTIKASMFFSILDGHMREIEKQEMLMDLIIQGLGECPPDIK
FT                   MNVVFKYGYLLVEDGIISRSVFKRYNSILKTWVLPSGS"
FT   gene            complement(<84262..>87039)
FT                   /locus_tag="Eint_100660"
FT   mRNA            complement(<84262..>87039)
FT                   /locus_tag="Eint_100660"
FT                   /product="MutS-like DNA mismatch repair protein"
FT   CDS_pept        complement(84262..87039)
FT                   /codon_start=1
FT                   /gene_family="HOG000149274" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100660"
FT                   /product="MutS-like DNA mismatch repair protein"
FT                   /note="similar to ECU10_0710"
FT                   /db_xref="GOA:E0S9K7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR015536"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K7"
FT                   /protein_id="ADM12392.1"
FT                   /translation="MKERKTLFDYFKAPKKKEDSGETLDRMVDLENSRNSTGILDLKEH
FT                   KRICKAPSPEEREEAADGSKPIVPSDVEPSYRSNKGLGKEEKEEKKTEERYKFLEDIRD
FT                   RNGRRVGEEGYDPSTLLIPKSEYNRFTPFEKQFWDIKKDHFDTIVFFKKGKFYELYEND
FT                   ALIGAKLFDLRITDRVNMKMSGFPESSLDYWTRKFLENGYKIARVDQSENMIGKQIRER
FT                   DELSKGVEGRMAKDKIIRRELKEIITQGTIYNIDYMKSSIPMYLMSVATDEICYAEKCN
FT                   GEIHTSVLLYDASIGEVYFSSFCDDRARHGIKTILSQHDVREMIADFTIPGIPRVVPDK
FT                   TGYVSSKKYEFSNSREYVCFQYLAKYMEKLRRSDALKNVKISKLQDEARTMVVDDATLR
FT                   NMEIFKNNYNGTGEKTLFKAIDFSSTPFGQRLLRRWIAAPLVRREDIAKRQETARMFKE
FT                   VEVSNLKNALARIGDGERLLTRLFNGNPGTKDLNKFIRCLDACREAGDVLVQTLKGQKS
FT                   DSAESMVAKAEEFSREISKVLEWHRKIYDVSETEISPGEEDGDELCQLMKERREIEEGL
FT                   NEYLREQKARLKCQSIKFKDVGKDIFQMEVAKETKVPSDYFIMSSTKGTNRYYTRDLKN
FT                   LVERYVECEEKIFQSKGSLLRRAIDVLLPHVVFFRQMFWELANVDCYLSFTTFSQRNRA
FT                   TTPTFSEGLRICGMSNPIYPTFVANDYNAQKRILVLTGANMGGKSTLLRTLCFNVILSQ
FT                   AGMDVCCEKMETPLFDRIFTRIGARDDLVKGESTFMVELGETASILKHSTRNSLVMMDE
FT                   LGRGTSTRDGECIARAVLDYLKERGCHVLFSTHYHRIIREVEGVSNGYMNSTVKGKDIV
FT                   FLYKLMDGTSWDSHGLYVARMAGVPEEIVERAERIKETLQRSAGRGEASNIYEN"
FT   gene            complement(<87065..>88165)
FT                   /locus_tag="Eint_100670"
FT   mRNA            complement(<87065..>88165)
FT                   /locus_tag="Eint_100670"
FT                   /product="ankyrin repeat-containing protein"
FT   CDS_pept        complement(87065..88165)
FT                   /codon_start=1
FT                   /gene_family="HOG000149273" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100670"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="similar to ECU10_0720"
FT                   /db_xref="GOA:E0S9K8"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K8"
FT                   /protein_id="ADM12393.1"
FT                   /translation="MDDEEIKAALMANSSVFLDSVPNSYSFSDGTGLIHWASMYNNLDV
FT                   CHRLVKDPGIVNSVGGALDSSPLYYALYNSNYKVMKLLIENGADITYVNKSGMGLLHTC
FT                   ARFDDVLGMVLLLSYGADAGVEDFKGRTLRVYARGKRARNVERFLEANRVTDRYKIWMI
FT                   EGISIGMHWGSFFLGKAWQVGVVAVFLIFWGRVARTRLPVYLNLFYSFYISYKVLGEDF
FT                   EHTTHTLEYFFNLVCLFLTRPRFGPVGTYQEARELVSTMIEQDEYTMEHFCYTCLVRKA
FT                   GGTKHCSICERCVLGFDHHCPCINKCVSKDSMKLFQRHLLSTLTVTMGVLLSGRTPDVS
FT                   LELMSVAAFVVLVLVASASVKSPRPV"
FT   gene            <88269..>89069
FT                   /locus_tag="Eint_100680"
FT   mRNA            <88269..>89069
FT                   /locus_tag="Eint_100680"
FT                   /product="hypothetical protein"
FT   CDS_pept        88269..89069
FT                   /codon_start=1
FT                   /gene_family="HOG000149821" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100680"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0730"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9K9"
FT                   /protein_id="ADM12394.1"
FT                   /translation="MIHDEKMLLKSLEHKNIEEKEIFPSICSVLGLQYFSEENGALAHT
FT                   LASPSFIIDISGLSAKLTFVDESFSRYFKYVEFYLCQHLEKRNMRDFYFYLRMFVRMET
FT                   GNEGLEEKDSGDICQCVFNGGYCINPSFRDVAKSSTDGIYDIYRHRFEYHMYTKRFIFP
FT                   IPVNDPVEDEDSGFLVAEGVNGKQMNAKVSLNLSRYFGPKAFDREVLRILPHIGFYWKG
FT                   MVDHEEVVVRKDLGVYVNGELRRDAAFLMKLGKNLHLSLNFLRD"
FT   gene            <89142..>89645
FT                   /locus_tag="Eint_100690"
FT   mRNA            <89142..>89645
FT                   /locus_tag="Eint_100690"
FT                   /product="hypothetical protein"
FT   CDS_pept        89142..89645
FT                   /codon_start=1
FT                   /gene_family="HOG000149820" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100690"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0740"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L0"
FT                   /protein_id="ADM12395.1"
FT                   /translation="MLVVNGTGLRRNSIIELCVFPDMNVHRMMVELSKQTDNPVFFDTV
FT                   GNLRVVADASFILSYRKLVKALLSLKSRRGFVLFIDSISFLADKSVANLQRFYNILWML
FT                   IYENDATIVVSNHYRIVRNRGALDFALELGQRWKMMVSYRIMYKYVGDKVVAKIYSDEL
FT                   FEKV"
FT   gene            complement(<89890..>90966)
FT                   /locus_tag="Eint_100700"
FT   mRNA            complement(<89890..>90966)
FT                   /locus_tag="Eint_100700"
FT                   /product="methionine aminopeptidase 2"
FT   CDS_pept        complement(89890..90966)
FT                   /codon_start=1
FT                   /gene_family="HOG000226278" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100700"
FT                   /product="methionine aminopeptidase 2"
FT                   /note="similar to ECU10_0750"
FT                   /db_xref="GOA:E0S9L1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L1"
FT                   /protein_id="ADM12396.1"
FT                   /translation="MKFILIDQAPELPIEFLPKGDCYRKGRLFGPKGEEIENTTDCDLL
FT                   QDARRAAEAHRRARYKVQSIIRPGITLLEIVRSIEDSTRTLLEGERNNGIGFPAGMSMN
FT                   SCAAHYTVNPGEEDIVLKEDDVLKVDFGTHSNGRIMDSAFTVAFQENLQPLLMAAREGT
FT                   ETGIRSLGIDARVCDIGRDINEVITSYEVEIEGKTWPIRPVSDLHGHSISQFKIHGGIS
FT                   IPAVNNRDTTRIKGDTFYAVETFATTGKGFINDRSPCSHFMLNVHKSRKLFNKDLIKVY
FT                   EFVKSSFGTLPFSPRHLDHYNLVEGGSLKSVNLLTMMGLFTPYPPLNDIDGSKVAQFEH
FT                   TVYLSENGKEILTRGDDY"
FT   gene            complement(<91111..>93759)
FT                   /locus_tag="Eint_100710"
FT   mRNA            complement(<91111..>93759)
FT                   /locus_tag="Eint_100710"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF1"
FT   CDS_pept        complement(91111..93759)
FT                   /codon_start=1
FT                   /gene_family="HOG000149272" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100710"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF1"
FT                   /note="similar to ECU10_0760"
FT                   /db_xref="GOA:E0S9L2"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR022591"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L2"
FT                   /protein_id="ADM12397.1"
FT                   /translation="MQTEFDNCSRKVAQGGERRTTEDGDETLETRPANVGFLDLLVIEK
FT                   SYEYKLRKYKGRKVPNESMSYEVDDQGKFRNSMTYARDSNTTLQALSGSTRSTGLKQYL
FT                   KRKQLEKEILKRKVSKDVLERVEEIKYPFDLVEWENDVVYDTDKIGSLGTSDTVTMELV
FT                   DSILEEDWEKYVVVDENDMKNYKSFLTLYLEDPNLIFEKVDEKKQGKPKKKQKEVFSVD
FT                   KPLKGKYNISLDKYYGQESRTKNSLGTFGVQHSLPALRLDPMFYKNNHTREELRNFHRP
FT                   RFMVNGSGIRFKAVEGNRGKGQSIIKKAGELTIKDGGPFSLFEYSEEEPFFLVNPGMVS
FT                   LLNIYYRKSNVRDEYAPDQSQYTILDPEDPSPFSGFGDVMPGTSIQAITNNLFIAPVFK
FT                   HSSRDYLCIVESSADGEFLTYRNIDNLYCVGQQFPLEEVYAPHSRKLNIFCKNRLKVAA
FT                   FRLFNSKVGGSKELRISQLDEMFPYFSEGSKRKWLKEYADCVKKGRDNVWVLRPSSALL
FT                   GEEDLRKLVTPENICQYESMLAGERKLQDSGYKMVVESDDEENEEEMVPPPWCLSRNFV
FT                   NACNGRGLLELSGPGDPTGIGEGFSFRKIRLKRGNEVENRKIINEHQLRYKEEIDRIWN
FT                   KQLASLSSVEEIPFNDSFLARRHKEGRRNTDVASETTVLSEETFLTIRRTYGEGESSYV
FT                   ETERISDPRVIKAYLKARKKKISEERKGVLTCGSCGQVGHMKTNKACPKFASAAKMTKK
FT                   KIEAEKRKARVYLQEIMLDLLAQFFQIPYSIAFHRPVSIKKFPDYPLIVDNPIDLTTIK
FT                   TKARHNKYRKFNEFLDDLELMRSNCRKYNGEDHSLTRIADSIVEAGRRRYNEKMEEILE
FT                   TERVLNGFFDE"
FT   gene            <93837..>94382
FT                   /locus_tag="Eint_100720"
FT   mRNA            <93837..>94382
FT                   /locus_tag="Eint_100720"
FT                   /product="hypothetical protein"
FT   CDS_pept        93837..94382
FT                   /codon_start=1
FT                   /gene_family="HOG000149819" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100720"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0770"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L3"
FT                   /protein_id="ADM12398.1"
FT                   /translation="MSISGPQDIPQEYINNENPFAYMKEYFENPFLDPEIKLRLNALQQ
FT                   MQPRFVPLGINGSVLKAEQAAKTKAIVESQIERLLQEGMSLINSTDPEREAVLKSNAND
FT                   PRILDILISIGRLKLLSNQEKLREKVYCALKSTIPSDVVESVDYSSPLKEDYLLGAMEY
FT                   GELEEKSNKTEPLPSPNY"
FT   gene            complement(<94387..>95451)
FT                   /locus_tag="Eint_100730"
FT   mRNA            complement(<94387..>95451)
FT                   /locus_tag="Eint_100730"
FT                   /product="DNA replication factor C small subunit"
FT   CDS_pept        complement(94387..95451)
FT                   /codon_start=1
FT                   /gene_family="HOG000224153" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100730"
FT                   /product="DNA replication factor C small subunit"
FT                   /note="similar to ECU10_0780i"
FT                   /db_xref="GOA:E0S9L4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR019483"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L4"
FT                   /protein_id="ADM12399.1"
FT                   /translation="MIWIEKYRPTSFDKVVGRDKISSLLKSYTLETIPHMILHGKSGHG
FT                   KKTTLLCLINHLYGGNSEPKIRTVEVLSGTKKIEVSYMESDEYVEISPSQYGHHDKAVI
FT                   QNIIKEMGQTKPILSMLSRAKRTPIKLIVITSAEELSLEAQAALRRTIEMYSNVLRVVL
FT                   MCNELSRLIEPIRSRCFFLRIPGFSDEDIMSNMRRILEKENYTVPEETLEEICRESEGN
FT                   MRRALCILELFCFNMNEKEAKRPKNNCKAMKLDWEIEVGSMAGVIKRNPTSEGLVEIRK
FT                   SLYALLNTCISPRTILIGLLRNLVLGEDFKTFLLLSRHALKYEERIRLGMKSIYHLEGF
FT                   VAASMCVLNEKRYI"
FT   gene            <95588..>96358
FT                   /locus_tag="Eint_100740"
FT   mRNA            <95588..>96358
FT                   /locus_tag="Eint_100740"
FT                   /product="hypothetical protein"
FT   CDS_pept        95588..96358
FT                   /codon_start=1
FT                   /gene_family="HOG000149818" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100740"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0790"
FT                   /db_xref="InterPro:IPR019340"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L5"
FT                   /protein_id="ADM12400.1"
FT                   /translation="MDFESKDRRYGDLPGRQTKIFMKNEISDGDSAAIENTSRQIPHSE
FT                   FEAFLKDYFAEADEKKFNQTVLRTPLDEEWLEEIVGKETECAREAMIKGLMGCLIDEGD
FT                   ILNGFSEVLEEEGSAEMEVEDCIEVEKTLRSFSLENIRDLVRLYKEQVSINNKRKDLLR
FT                   KKLKERLAYYGYWMVLRAIDSEIEDLVSREKGRKKGIEEERAREVLEKRSEFMELFKDF
FT                   SVLEEDYRNYEDLFDPKENVDASRHGVFPYDYFS"
FT   gene            <96409..>97041
FT                   /locus_tag="Eint_100750"
FT   mRNA            <96409..>97041
FT                   /locus_tag="Eint_100750"
FT                   /product="putative methyltransferase"
FT   CDS_pept        96409..97041
FT                   /codon_start=1
FT                   /gene_family="HOG000164004" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100750"
FT                   /product="putative methyltransferase"
FT                   /note="similar to ECU10_0800"
FT                   /db_xref="GOA:E0S9L6"
FT                   /db_xref="InterPro:IPR007823"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L6"
FT                   /protein_id="ADM12401.1"
FT                   /translation="MSLEEKLMKRLEGGMFRILNDKMYHGKGLKKRDLKLYHELYDQQV
FT                   KRWPVNPLDVIIEKIKKKGNGMAIADIGCGDARISREFENVMSLDLNPSRKDIIRCDMR
FT                   QRIPLDDKSVDIAVCCLSMMAENISVPMKEVNRILRESGYWYIAEVKSRIPNIKHLEKK
FT                   FESFGFEVEHTDMSNAQFILFVLKKNLDKNPKKLPPVRLIPWVYKKR"
FT   gene            <97669..>99303
FT                   /locus_tag="Eint_100760"
FT   mRNA            <97669..>99303
FT                   /locus_tag="Eint_100760"
FT                   /product="chromosome segregation protein"
FT   CDS_pept        97669..99303
FT                   /codon_start=1
FT                   /gene_family="HOG000113750" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100760"
FT                   /product="chromosome segregation protein"
FT                   /note="similar to ECU10_0810"
FT                   /db_xref="InterPro:IPR005550"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L7"
FT                   /protein_id="ADM12402.1"
FT                   /translation="MTRRFTMTPNSRNSIKTPISGAKVALFPRHSVAAEEIKRRDMRLV
FT                   REKGYKQQCVDTILGFLMENGYDGQISQKIMHNPSSKDFQSIFKFLYGFVDDFVFSSRF
FT                   EDEVVNVMKNLRYPYCGEITKSQLSAITPHTWPVILSMCSWLVELIRHGATLLEQEEEK
FT                   SVESCFFEYVCDGYMRFMEGDEDDAALEEEFERKVTEIYTGIFKEIDRKKEELSRIEEM
FT                   IGKSRRMSESLGELERKKRELTDDLNMLIASEKQLEGKKKKYLGAIERLCEDIARVEEE
FT                   IESQRVQEEGLRVQITKQKINPEDVREMNTEKMELFKELERMKPEKEGLMREVGEQERE
FT                   AQEKVEEVEKLFFDLKGLRDEISLRIVKDTKGGVQVVNEVSNEVFDNGIASVIVRLEEE
FT                   LNGRSDVLVAGEMNKGMLEEARAEKEGMSSELSNRLKYCSDKLLMAGKLYLEKKEISEN
FT                   EQRKSKTEMELLENELLKLNLESNTSLLMSEQKLQKAKILLDRTLNTINYEREEISKMV
FT                   FNFYNTVVDVHTLIQSQVGDLRTLLNR"
FT   gene            <99397..>100251
FT                   /locus_tag="Eint_100770"
FT   mRNA            <99397..>100251
FT                   /locus_tag="Eint_100770"
FT                   /product="fibrillarin"
FT   CDS_pept        99397..100251
FT                   /codon_start=1
FT                   /gene_family="HOG000106741" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100770"
FT                   /product="fibrillarin"
FT                   /note="similar to ECU10_0820"
FT                   /db_xref="GOA:E0S9L8"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L8"
FT                   /protein_id="ADM12403.1"
FT                   /translation="MKKTNKKPNGGKFRKESRMARPDKRGGRERMNNKKKGSVRAGLDK
FT                   KVLVEPHRRFPGVYVSRGKEDLLLTKSLAPGISVYGERRITVDVEQERIEYRVWNVYRS
FT                   KLAAGIVCGVENIHMGPGSKVLYLGASSGTTVSHVSDIVGKDGVVYAVEFSERSGRDLI
FT                   NMSMKRPNIVPIIEDARHPSRYRMLVPMVDCIFSDVSQPDQTRIVALNAQYFLKEGGGV
FT                   DVSIKANCVNSSVPAETVFAEEVNILRKHNIKPKEQVTLEPFEKDHAMIVGKFRLSKSG
FT                   EKK"
FT   gene            complement(<100346..>101053)
FT                   /locus_tag="Eint_100780"
FT   mRNA            complement(<100346..>101053)
FT                   /locus_tag="Eint_100780"
FT                   /product="glutathione-S-transferase-like protein"
FT   CDS_pept        complement(100346..101053)
FT                   /codon_start=1
FT                   /gene_family="HOG000149271" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100780"
FT                   /product="glutathione-S-transferase-like protein"
FT                   /note="similar to ECU10_0830"
FT                   /db_xref="GOA:E0S9L9"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9L9"
FT                   /protein_id="ADM12404.1"
FT                   /translation="MSDESIWRNIGGEGYCSFKMKTEENALCRNKNNVTGLCDRFSCPL
FT                   ANSKYATVREMGEELFLFIKEPERVHVPRDVYEEIKLSSNYEEALRQIEENLEFWDEKI
FT                   IHKCKQKLSKLTQYLRRLERFKEHGKTKYMVRRKKMNRREKLRALKTLNKINFEKNIGD
FT                   ELMLRLESGIYGTELKDRFHLANKAAVEREKKQNRKKRYVAELEESDGILEEESCGVEK
FT                   KADKKTKKTAMKW"
FT   gene            complement(<101115..>101849)
FT                   /locus_tag="Eint_100790"
FT   mRNA            complement(<101115..>101849)
FT                   /locus_tag="Eint_100790"
FT                   /product="U1 snRNP protein"
FT   CDS_pept        complement(101115..101849)
FT                   /codon_start=1
FT                   /gene_family="HOG000149817" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100790"
FT                   /product="U1 snRNP protein"
FT                   /note="similar to ECU10_0840"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M0"
FT                   /protein_id="ADM12405.1"
FT                   /translation="MTDRAREVLDMLLGRERDIYNPDKLSSERRDTCIYMLASFCPFEL
FT                   FRNTRRSIGKCRYGNHEEYYRAEYNKNGRKRAEEYEWELLRLLVEIVLDVRNVAKKCTA
FT                   SDTSDLPLLERIKEKEELFKKLYESIEQLGMEGKVEEACHAFDECEKVKWELERIKEAY
FT                   YAKNNGEGMGRCTVCGAGIVLSDTKVKIDRHIKGRLHKGHLLVRSKLADLLEKFGITSV
FT                   AEIFPDGFLFKHLRSHPFSSSL"
FT   gene            complement(<101995..>103089)
FT                   /locus_tag="Eint_100800"
FT   mRNA            complement(<101995..>103089)
FT                   /locus_tag="Eint_100800"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(101995..103089)
FT                   /codon_start=1
FT                   /gene_family="HOG000149815" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100800"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0850"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M1"
FT                   /protein_id="ADM12406.1"
FT                   /translation="MRRIADLKIGNKKRLIPRETCKPEFQIPRDLVYLIGKYDRRLKAL
FT                   CKSVPPREVPILSPWRKPYERKVYYEARPAFDVDLHPFINLRVLRVCDSCSFDLASINN
FT                   TCIRKLSILKVANVKMRSNIDTVLQEIVMRDTTVAYEDLMNILGVGSLVSVSLVNVDVL
FT                   GCHEWREGLMKKLQEMPKLKKIELVNMGIDFQSFVDLCISRELVWFKIIDEGVCLDVRL
FT                   CSFVNAVRCMGFLKCLTNLGLEMAEIMYVGGRDLKCMRESLPNLRLLHVTEAEIDSRMF
FT                   KTVYLRYPNLVGLGFVGCTFDGASFYEVIMHFKGSLRYLDLTSSRLPHDYVSFLKKTLS
FT                   FCSIKLKSGEFIMIGGRSSVSLPG"
FT   gene            <103149..>103499
FT                   /locus_tag="Eint_100810"
FT   mRNA            <103149..>103499
FT                   /locus_tag="Eint_100810"
FT                   /product="hypothetical protein"
FT   CDS_pept        103149..103499
FT                   /codon_start=1
FT                   /gene_family="HOG000149814" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100810"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0860"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M2"
FT                   /protein_id="ADM12407.1"
FT                   /translation="MSLKESGVMVMTIGVTVFLAGAILLMDRALMISGNLLIIIGIALL
FT                   ARSRMFSFLRPEKMQAMVIFGMGILFQVYKLLVFGFFLEVLGLFLLLKDSIPTFRTVLT
FT                   TLLFGKLQKLIK"
FT   gene            complement(<103579..>105327)
FT                   /locus_tag="Eint_100820"
FT   mRNA            complement(<103579..>105327)
FT                   /locus_tag="Eint_100820"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT   CDS_pept        complement(103579..105327)
FT                   /codon_start=1
FT                   /gene_family="HOG000004813" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100820"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /note="similar to ECU10_0870"
FT                   /db_xref="GOA:E0S9M3"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M3"
FT                   /protein_id="ADM12408.1"
FT                   /translation="MAFRYLYKKIFVMGRLKCIRKPCKNWEVPTREAMMERLRSEVFDL
FT                   IIVGAGSSGAGCALDGATRGLKVALVDAGDFGSGTSSKSTKLVHGGVRYLASAVSNLDW
FT                   SQYKLVWQALEERSTMFRISPYLTNSIKIMVPVYSRILIPYYYIGLKLYDWISGLKSLG
FT                   GSYFIGRKEAIDVFPHVNKKNLCGAMVYFDGQQDDVRNNVMLVMTAVYHGAVATNYLSV
FT                   KSLISSGGKITGVRCKDGITGSEMEIKGLGVINSTGSFADDLRKKSDSSTGEIISQSSG
FT                   THIVIPKEYAPKEMGFLDPLTGDNRIAFFMPWMGKTLVGATDIKAKNELSPSPTKEDLK
FT                   FLMHEVRAYTSQGLKLVKDEVSAIWTGIRPLVKDDEVSETSSIVRKHFVKIEKNGLLTV
FT                   TGGKWTIYRKIAEDAIDLAIREFSLKPKGPCVTKYVQILGSDGYSEDTYVSIQRKLGVG
FT                   KDTAERLTRFYGTMALKLAKYRRRGKKKDHLSEKYTYLVEEVEYCIDNEMAVRICDVLC
FT                   NRLMIGLIDVKEAYRCLGKVLEIFKRKHRWDADRCNREEVDAIRMLNTYGLKILRGELQ
FT                   SSSSLE"
FT   gene            <105541..>106464
FT                   /locus_tag="Eint_100830"
FT   mRNA            <105541..>106464
FT                   /locus_tag="Eint_100830"
FT                   /product="hypothetical protein"
FT   CDS_pept        105541..106464
FT                   /codon_start=1
FT                   /gene_family="HOG000149813" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100830"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0880"
FT                   /db_xref="GOA:E0S9M4"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M4"
FT                   /protein_id="ADM12409.1"
FT                   /translation="MEGIRFADVLQSFEKKTEDGEYVSVERDYNERKVIENDVKRTELL
FT                   GVDKRNQEAIKILKRLLFVELDKIPVKYTQGMSEVASVFVLYYFQEIVEEEVAKGMFIA
FT                   EREEKPEGEASTAEGFSEHFIELPEEETTELKKFLSRHKDIIAKLGVVLTNVFKRKLEP
FT                   LVANDFKLYKENMKIFVEMMKKRGVKIPELESYKFMGSILTFFLRNLTKMEDVHKVFEI
FT                   ILSCPNTCPFLLLVLFYGQISSGKAIESINNKLFPKVVKLEEEFIETRKRIESKEVCPS
FT                   KRKIMLIGGVISIITAVVVYKITRKE"
FT   gene            complement(<106561..>108651)
FT                   /locus_tag="Eint_100840"
FT   mRNA            complement(<106561..>108651)
FT                   /locus_tag="Eint_100840"
FT                   /product="putative beta-lactamase fold-containing
FT                   exonuclease"
FT   CDS_pept        complement(106561..108651)
FT                   /codon_start=1
FT                   /gene_family="HOG000203394" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100840"
FT                   /product="putative beta-lactamase fold-containing
FT                   exonuclease"
FT                   /note="similar to ECU10_0900"
FT                   /db_xref="GOA:E0S9M5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR021718"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M5"
FT                   /protein_id="ADM12410.1"
FT                   /translation="MFSSEKIKVMPLGAGNEVGRSCVIVECGGRTIMLDCGVHPAYTGV
FT                   ASLPFLDLVDLSKIDAIFVTHFHLDHAAALPFLTEKTSFKGKVYMTHPTKAILKWLLND
FT                   YIRLINAASDADFYTETDLVKCYDRIIPIDYHQEVNVKGIKVKALNAGHVLGAAMFLVE
FT                   IEKSKILYTGDFSREEDRHLKAAESPGCKIDALITESTYGVQCHLPRSEREGRFTSIVQ
FT                   NVVQRGGRCLLPVFALGRAQELLLILEEHWSSNASLQKIPIYYASALAKRCMGVYQTYI
FT                   GMMNERIQKLSLVRNPFAFKYVKNLKGIDSFDDEGPCVIMASPGMLQSGLSRDLFERWC
FT                   SDSKNAVIIPGYCVDGTLAKEILSEPKEIEALNGKRLRLNMSVEYISFSAHVDFTQNSQ
FT                   FIEECQPRHLFFVHGEMNEMQRLRNVIQQRNEKKGIEMELYTLRNGEEAGFDLVKDNEA
FT                   KIFTNAEGEFEGIIVGTENDIRIYKRDDLMESKYKEMSIYERQRIPYNSTGVLLKQVLM
FT                   DGFEELVEVESGLMIGNIHVKLSGQEVILEWKSSYADDILAISISKVISGIGHLKDGFK
FT                   TAQGEYIDPEKLETLYIDGDIIQDVFIPRRSESERIIAIVVCPDEKRSEKEIMEHLREV
FT                   GEKLVKQRRITRLEIPSKVVVLRRGFESFEGADLLTPTAKKKRALVEKYFAEEIDKTLG
FT                   IK"
FT   gene            <108799..>110868
FT                   /locus_tag="Eint_100850"
FT   mRNA            <108799..>110868
FT                   /locus_tag="Eint_100850"
FT                   /product="long chain fatty acid CoA ligase"
FT   CDS_pept        108799..110868
FT                   /codon_start=1
FT                   /gene_family="HOG000149269" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100850"
FT                   /product="long chain fatty acid CoA ligase"
FT                   /note="similar to ECU10_0910"
FT                   /db_xref="GOA:E0S9M6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M6"
FT                   /protein_id="ADM12411.1"
FT                   /translation="MGTIRFISIISFLSDMMIWCIDGPGKEAKDNLKAPLLTSDNKPND
FT                   FKASPIPCSESTVRMSRFKDMMNRIRIMEDGSVQHVNFQRDVVCTPDGSKTILELLLSR
FT                   CATMGNEPFLGTIVGNKVKYKTANDIRREAEGLASFLAQTTSPGDMVGIYSVNRYEWIV
FT                   AEMATYMCGCTNVPLYSMFSPENVQMILKETGMKVCVASREKAEQLVETVLEGRETMLE
FT                   HIVLMDKAPELVARLENAGLRGHYLKEVISHRGGITKERYSKGEDLATICYTSGTSGCP
FT                   KGVMLTHRNFISGVSGIFRGSRKEEMVSLDKEDVYLSYLPLAHVMERICVNISMAYGCK
FT                   IVFYRGNMKEIKEDYLVAKPTFIISVPRVLNLFKDKIEEKVRQKNFVLRWIFRGALRYK
FT                   MWRVGRGELKSKFADWLVFNRIAKEFGGRISRILCGSAPLRKEVLVYMQAVLSCRIIQG
FT                   YGQTENVGSGIVQPLDTNLYDNVGIPFPSNEVKLGEIPAELGSEYGRRYPGRKFGEILL
FT                   RGDNVTQGYFKRPEETAELFTKDGWLRTGDIGMFDVSTGMFSVIGRLKDGFKTAQGEYI
FT                   DPEKLETLYIDGDIIQDVFIPRRSESERIIAIVVCPDEKKSEKEIMEHLREVGEKLVKQ
FT                   RRITRLEIPSKVIVLRRGFESFEGADLLTPTAKKKRALVEKYFAEEIDKTLGIK"
FT   gene            <110942..>113248
FT                   /locus_tag="Eint_100860"
FT   mRNA            <110942..>113248
FT                   /locus_tag="Eint_100860"
FT                   /product="ribonucleoside diphosphate reductase"
FT   CDS_pept        110942..113248
FT                   /codon_start=1
FT                   /gene_family="HOG000057035" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100860"
FT                   /product="ribonucleoside diphosphate reductase"
FT                   /note="similar to ECU10_0920"
FT                   /db_xref="GOA:E0S9M7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M7"
FT                   /protein_id="ADM12412.1"
FT                   /translation="MENSLNSKRVKSEKLKIDMVRGQIEEYTNLLKLQHVNVDELMEKI
FT                   ASGWCEDMTRKEIVDYCSETAASMITKHPEYGWISSRIIVSYIHDITMDSFVEKIKYIQ
FT                   KYQGTISEEMYKIIVENAEIIDSIIDYEKDFLFNYFGILTLMKSYLIKVGEEIVERPQD
FT                   VFMRTALQVHKSDFGKVKETYEMLSRHYFTHATPTLYNSCLKEAQLASCFLITPREDSI
FT                   EGVYHMINQTAIITKYSGGIGLNLHGIRSKGSPLKRTGGKSNGIIPLIQVLNATKRYIN
FT                   QGAERRPGSIAIYLEPWHMEIFDFLDLRKNTGPEEFRARDIFIALWINDLFMERVKNNE
FT                   EWSLFCPSQAVGLNETWGEEFNALYCKYEKTISRTVVPAQKLWKAIIEAQIETGTPYMC
FT                   YKDACNRLSNQQHLGTIKSSNLCAEIVEYSSGEETSVCNLGSISLPMFVKNKKFDFESL
FT                   KDVVRILTINLNKVIDFNYYPVEESKRSNMKHRPIGIGVQGLADLFAILRLPFDSDEAR
FT                   NLNKDIFETMYYSALETSCKLAEKEGPFESYEGSPISKGIFHFELAGKKASNNWDWEGL
FT                   RERIKKYGTRNSLLIALMPTAGTSQIFGNNETFEPFISNIYTRRTHAGEFQIVNKHLIN
FT                   DLSELGLWSYEMKNLIIENEGSIQNITTIPKKIRDIYKTAWEIKMKAVIDLAADRQVFV
FT                   DQSQSLNVFVAKPTYSQLTSMHFYGYHCGLKTGMYYLRTRPITSAIKFTVDKKLAEKTL
FT                   SSMNDTDEPCSMCSS"
FT   gene            <113338..>114921
FT                   /locus_tag="Eint_100870"
FT   mRNA            <113338..>114921
FT                   /locus_tag="Eint_100870"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF12"
FT   CDS_pept        113338..114921
FT                   /codon_start=1
FT                   /gene_family="HOG000149812" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100870"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF12"
FT                   /note="similar to ECU10_0930"
FT                   /db_xref="GOA:E0S9M8"
FT                   /db_xref="InterPro:IPR003228"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M8"
FT                   /protein_id="ADM12413.1"
FT                   /translation="MNFFKEGERLKAIFDDLVKQHKKSKRKVVDNKNVSKEMLQTYEEN
FT                   RMKLMHFFEMHSRFIRPRKNSIGIFSVDDFVKVKTSESMMFPKKEDFRREGRPGMPFSV
FT                   GRPMQWGGMNGREPFYIQDRIPTQGWKGCGRDGKPMWMGFGGYPGAPGQESILRGWGPM
FT                   NFLHQNSRGFFGAGSYEMEGGSFEGEHGSYGYGIRMAPGPGVRRRFDIGGGGPSDGYGM
FT                   FPKRRPPDMDSKTAEVSKMGFPHEREEIGRNGVPPSMSWTGSRRPYIPTERREEMIRPP
FT                   FYYPILGGYGYPVHGNGTFPGVPVEETFATACSIYPETSRKEQHFVKYPQSFPGSDVID
FT                   WMPEKKSSKTKTPKETKVPTSPKENESSISGKEDPWRLDITTDLEKRKLCDEDQGRDEN
FT                   KEKASFADFPDGKNNSHGELSTNHGKDLNIMTIEDLIGDKTIDKDAKEFIYELCDGFVD
FT                   HIIHMSCALAYHRKKNTVEVCDVKLALKTEVGIELPSDGDSEEESSLSPGREVKVVRNE
FT                   EKQPRMAKKD"
FT   gene            <114994..>115470
FT                   /locus_tag="Eint_100880"
FT   mRNA            <114994..>115470
FT                   /locus_tag="Eint_100880"
FT                   /product="ubiquitin-conjugating enzyme E2"
FT   CDS_pept        114994..115470
FT                   /codon_start=1
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100880"
FT                   /product="ubiquitin-conjugating enzyme E2"
FT                   /note="similar to ECU10_0940"
FT                   /db_xref="GOA:E0S9M9"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9M9"
FT                   /protein_id="ADM12414.1"
FT                   /translation="MATTKGKNSRLAIEMESMSRDPPPGCSASPISPNELDKWIAVITG
FT                   PPGSVYEDGIFELLIVFPPFYPFSPPKVTFKTRIFHCNIFEKNICLDILKDQWSPALTI
FT                   DKILLSIVSLLQDPNPDDPLNKEAADLYRNNRMEYNRKAKEWVRLHASKHKSEE"
FT   gene            <115587..>116135
FT                   /locus_tag="Eint_100890"
FT   mRNA            <115587..>116135
FT                   /locus_tag="Eint_100890"
FT                   /product="hypothetical protein"
FT   CDS_pept        115587..116135
FT                   /codon_start=1
FT                   /gene_family="HOG000149811" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100890"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0950"
FT                   /db_xref="InterPro:IPR005339"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N0"
FT                   /protein_id="ADM12415.1"
FT                   /translation="MIFGEAGTWLLEDLKSSVLKPYRHAEIKAIQGENGDLDKKMEEIR
FT                   RAAGSGISEELSVNYVMMKHFKERNERIVRSYKFHRILGLFDCFFGRKETSGILSPEEE
FT                   ECAEEYYATLKEYLEPFADMDFTTETPPTQFFVQVITLEDCGVVMDEGDLIELKKDRIY
FT                   FIKKSSIAHLISDGLVRII"
FT   gene            complement(<116145..>116657)
FT                   /locus_tag="Eint_100900"
FT   mRNA            complement(<116145..>116657)
FT                   /locus_tag="Eint_100900"
FT                   /product="putative nucleotide kinase"
FT   CDS_pept        complement(116145..116657)
FT                   /codon_start=1
FT                   /gene_family="HOG000224471" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100900"
FT                   /product="putative nucleotide kinase"
FT                   /note="similar to ECU10_0960"
FT                   /db_xref="GOA:E0S9N1"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N1"
FT                   /protein_id="ADM12416.1"
FT                   /translation="MKILVTGTPGVGKTTFSLDISKRFGIPHVEMSRYIEENNLYEEYS
FT                   ETYKSLLFDDEVVRKSLEGYLLGKESYIIDTHSCGMAANIAFDLVFLMKAPVEVLYKRL
FT                   KERGYDEDKIKENIECEIFGVVEEEVEGLFGDNYHTIGEEEGGLTSEEAMCIISKKIGP
FT                   ESSVDIP"
FT   gene            complement(<116688..>117935)
FT                   /locus_tag="Eint_100910"
FT   mRNA            complement(<116688..>117935)
FT                   /locus_tag="Eint_100910"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(116688..117935)
FT                   /codon_start=1
FT                   /gene_family="HOG000149810" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100910"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0970"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N2"
FT                   /protein_id="ADM12417.1"
FT                   /translation="MSRFFESIDEEREESSRVKIKEKTYEASEKQGKKEKRLHDLQCRV
FT                   MELEEEENQKIFDKQLKKILVDIRKMEGYLSRGLPPFLKKFLESPRVYTKTHKKTIDEL
FT                   LAHHEPKEDENGQQEDRRDEERLSRDLSKILVIKDTEERRKELEEFKDSAKDKEMKAKA
FT                   LRTLLSIHMKSKDGVEIMKTINELLDCFGDREKNTLLENIDFYLETLYEILDSPKISTY
FT                   NGLLKRLLEIDPKLVERRVLQFEFFKLGRPAKTEDRLFRLLYIDRTQGYGESRKYYESI
FT                   KDTIGEGKIEQEVLGEFGLSSFRSGDFETSFEVLSKCSEVQPPNHGLVMKLLCVILNDR
FT                   IRGSPVHKKFLEDFKSFGKNRFCLPSGDSAFEVYRSFYLLNMLDKKGAGEIVKRFCEGF
FT                   EESIWFKDFVESRIKG"
FT   gene            complement(<118002..>118877)
FT                   /locus_tag="Eint_100920"
FT   mRNA            complement(<118002..>118877)
FT                   /locus_tag="Eint_100920"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(118002..118877)
FT                   /codon_start=1
FT                   /gene_family="HOG000149809" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100920"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_0980"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N3"
FT                   /protein_id="ADM12418.1"
FT                   /translation="MEEIERDREIVRRMKKFDRESMEDACNESLKSKRISYIPNLVAMN
FT                   STEATKKSARPGMLSLKIRNMSTRNILFAVSESFRNINKKIIKKLERIKEELTKRDDLF
FT                   ECILDQVESMEVIEDELFSWYPGLKTSDVLSFFLELMPDLLERYKEYFVRSLVLQQAPK
FT                   KKILKALRDRLHKNLQCFDIIEKDLELFEEFSGCIPEGGRIITSSYWCEDEEKCEDAME
FT                   FFPQLKDKMRLSSEVCAELFHPLSHADVQINGRDLVVSFTQLNDLLTKNSRSLEFWMKE
FT                   GIVDSDWRYL"
FT   gene            complement(<119009..>119480)
FT                   /locus_tag="Eint_100930"
FT   mRNA            complement(join(<119009..119449,119478..>119480))
FT                   /locus_tag="Eint_100930"
FT                   /product="60S ribosomal protein L27A"
FT   CDS_pept        complement(join(119009..119449,119478..119480))
FT                   /codon_start=1
FT                   /gene_family="HOG000231263" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100930"
FT                   /product="60S ribosomal protein L27A"
FT                   /note="similar to ECU10_0990"
FT                   /db_xref="GOA:E0S9N4"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N4"
FT                   /protein_id="ADM12419.1"
FT                   /translation="MAEKVKKTRKMRGHVSHGHGRVGKHRKHSGGRGLAGGFSHMKTLF
FT                   TRFHPDYHGKRGMRVYHRKENSNYARPISSARLWGMIPKEQRYEFLDNVEKVPVIDVRE
FT                   FGYHIVIGGKLPLERPIVVKARYFTPSAKEEITRVGGKWIITY"
FT   exon            complement(<119009..119449)
FT                   /locus_tag="Eint_100930"
FT                   /number=2
FT   exon            complement(119478..>119480)
FT                   /locus_tag="Eint_100930"
FT                   /number=1
FT   gene            <119636..>121009
FT                   /locus_tag="Eint_100940"
FT   mRNA            <119636..>121009
FT                   /locus_tag="Eint_100940"
FT                   /product="kinesin-like protein"
FT   CDS_pept        119636..121009
FT                   /codon_start=1
FT                   /gene_family="HOG000149268" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100940"
FT                   /product="kinesin-like protein"
FT                   /note="similar to ECU10_1000"
FT                   /db_xref="GOA:E0S9N5"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N5"
FT                   /protein_id="ADM12420.1"
FT                   /translation="MHSTHKKIKVSIRLRPSTGNREIWKTSEDGLWHIRGERRVKYSGF
FT                   QSILSNMTNEEVYKLCVQEEVWKFLNEENCTVFAYGQTGSGKTYTMLGGDEEGIIKLAI
FT                   RDVLKKRSVGISYLEIYNEKLFDLSNNNEVQMFSVGNKNVISNLWVEHVDKWEDVVPFI
FT                   EKCEKNRRFGTTEFNTKSSRSHTVVQVTYSSNNRVRTLNMIDLAGSERASRSNDRRKEG
FT                   SFINRSLLALCTVVNNIGNGKYLGFRNSKLTRVLQPSLDGLTNLIAICTLSPYEDCVEE
FT                   SVSTLKFAARLCNLELKTEEMQISSDGDGRCGGDGLEGSSRCEVKHRCCRKFHPEVSKE
FT                   TSDVLEKTESMTFEKYFEGYGFSEAPGLEEHREHDKVCSEKDSVAGILRTFGRVIMENL
FT                   EWKVKLMEELNIINNDRIHLLERMVGELLGKNPSRRMNEIFILEKYRFNLRRKMVGRK"
FT   gene            <121041..>121466
FT                   /locus_tag="Eint_100950"
FT   mRNA            <121041..>121466
FT                   /locus_tag="Eint_100950"
FT                   /product="hypothetical protein"
FT   CDS_pept        121041..121466
FT                   /codon_start=1
FT                   /gene_family="HOG000149808" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100950"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1010"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N6"
FT                   /protein_id="ADM12421.1"
FT                   /translation="MGPKIKTLVFLKVMVLVILLHFLPVVLKEIGLKKRVEMMKRDFNR
FT                   RLLEGSESLERLRMLKTLINNARYCKDGDIPLDGSMAETKRAYEGLRVWSDPVFLRLSN
FT                   IYNISIFFPVFAPVVIQSIKILRYRDSWGSRGEKVEP"
FT   gene            <121552..>122205
FT                   /locus_tag="Eint_100960"
FT   mRNA            <121552..>122205
FT                   /locus_tag="Eint_100960"
FT                   /product="hypothetical protein"
FT   CDS_pept        121552..122205
FT                   /codon_start=1
FT                   /gene_family="HOG000149807" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100960"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1020"
FT                   /db_xref="GOA:E0S9N7"
FT                   /db_xref="InterPro:IPR003888"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N7"
FT                   /protein_id="ADM12422.1"
FT                   /translation="MNEESGKECSKQQKRLAEALRRRDGLKEEMEKVRQDLQKLEIHRR
FT                   VLLDMVRIGNGGMEIDVNRYRPIYKAEVEGAKGLIHVPGERYHLAIYNLGRIPMASMKP
FT                   FYNQKNIYPIDYMCKRAYYKSRGSPGGDGYALYTCTIRNVCSKPLFEISERDLCIRGKA
FT                   GEVFNAFKSLFSWEIEFGSITEFFGLNNLYVRRLISEQEGFRGLGIGDRWERKA"
FT   gene            <122280..>124085
FT                   /locus_tag="Eint_100970"
FT   mRNA            <122280..>124085
FT                   /locus_tag="Eint_100970"
FT                   /product="hypothetical protein"
FT   CDS_pept        122280..124085
FT                   /codon_start=1
FT                   /gene_family="HOG000149806" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100970"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1030"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N8"
FT                   /protein_id="ADM12423.1"
FT                   /translation="MILDEIVKEAAALQLRKEDENTWSRVNDVLMRLSGAVVGPEDVRR
FT                   VLESVSDLIVRSMQSDRSRLAGTALGFLKNCICILGNEFGMAGQYLVPLAKVCGKSSKV
FT                   FYSRGEEVLVELCKRVNIKGHARFFSEYCGSANKNVRLAIFRGIEAWGSESGKIEGLEN
FT                   LVIKGREDAFSEVREVCKRMMEKFSIGERKEGCFRRQRLEESLESGVKKGPVRMARMPV
FT                   RGGYGGMEGIGAREMEKKELAPKFSPARKQTKTGDKDYDKIRELSRQVKDIAEDIRPNV
FT                   GAEKSSSGRIRTKIKEMFSRGSDKAGTVYPESKVEIPKEVMNHEDLTPVRLDKYLSRYR
FT                   EEYGRLIPKNITGVSNGFEVEDTELGEEFLEAKEVSDEDKARIGETKEEDKLNGSCEEK
FT                   KERIVVGNESFDEEMGHDLEGGDEVCAELEIGELSKSLANISINEGDVEDKPHSDGDGM
FT                   LSEASGNPYENLVEGQEMESSLKEYTIMDSGKLEEHKENNRDESRLCRGSGASIGESTI
FT                   SIDSEVENQRKERKKGCRNALEMMKGNRFAGFLELSESSEEETVFSRRQGERKEGVEKQ
FT                   DADNTGDFTAMDSLVEVRRGVFRKK"
FT   gene            <124461..>125894
FT                   /locus_tag="Eint_100980"
FT   mRNA            <124461..>125894
FT                   /locus_tag="Eint_100980"
FT                   /product="vacuolar ATP synthase subunit B"
FT   CDS_pept        124461..125894
FT                   /codon_start=1
FT                   /gene_family="HOG000165320" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100980"
FT                   /product="vacuolar ATP synthase subunit B"
FT                   /note="similar to ECU10_1040"
FT                   /db_xref="GOA:E0S9N9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005723"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9N9"
FT                   /protein_id="ADM12424.1"
FT                   /translation="MLENIRIEPKMSYRKIVGVNGPLVIMDNIGFLKYAEIVSLTLPDG
FT                   SVRQGQVLEVCGKKAVVQVFEGTSGIDIKETQVTFTGETLKMGISEDVLGRIFNGSGKV
FT                   IDGGPNIIAEDYFDIQGQPLNPYSRIYPEEMIQTGISSIDVMNSIARGQKIPIFSASGL
FT                   PHNEIAAQICRQAGLVKRKDSIDSSDDNFAIVFAAMGVNVETANFFRNSFEASGSIGRT
FT                   ALFLNLANDPTIERIITPRLALTAAEYLAYEKEKHVLVIMTDMSSYADALREVSAAREE
FT                   VPGRRGYPGYMYTDLSTIYERAGRLEGRNGSITQIPILTMPNDDITHPIPDLTGYITEG
FT                   QIYVDRQMHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYAKYAIGKDAQA
FT                   MKAVVGEDSLSLEDKISIEFLERFEKEFISQRHNELRTVNQSLDIAWDLLRTFPREMLN
FT                   RIPSDILDEFHSVAPSRSE"
FT   gene            <126205..>126564
FT                   /locus_tag="Eint_100990"
FT   mRNA            <126205..>126564
FT                   /locus_tag="Eint_100990"
FT                   /product="hypothetical protein"
FT   CDS_pept        126205..126564
FT                   /codon_start=1
FT                   /gene_family="HOG000149804" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_100990"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P0"
FT                   /protein_id="ADM12425.1"
FT                   /translation="MEEGRKRKAKDQLSPYSNPVEESDQHSGVVEPLPLIHKKRAKARV
FT                   GDSSMIANSESLKGVLSSVNILKPRGGGNDRISGLNRCFVNAVQKVVEKESNKSLLYLF
FT                   RQYEKYYRELTESND"
FT   gene            <126623..>128134
FT                   /locus_tag="Eint_101000"
FT   mRNA            <126623..>128134
FT                   /locus_tag="Eint_101000"
FT                   /product="phosphoglyceromutase"
FT   CDS_pept        126623..128134
FT                   /codon_start=1
FT                   /gene_family="HOG000223664" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101000"
FT                   /product="phosphoglyceromutase"
FT                   /note="similar to ECU10_1060"
FT                   /db_xref="GOA:E0S9P1"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P1"
FT                   /protein_id="ADM12426.1"
FT                   /translation="MRNVCLVVIDGWGHLESRTQGNAVSESECRWMRALSWGRCSLLLH
FT                   AHGRYVGLPDGLMGNSEVGHLTIGSGRIIEQDILRIDRAIEEGRLKKIVDEVLQGGRGR
FT                   IHVVGMVSDGGVHSHIRHLKGILESLKGRNEEVFIHCISDGRDTEPQVFLKYLEEIKNF
FT                   CRDIGTGKIASVAGRFYSMDRANNEERTELSFKTMTSGKEIGEDAEDYVLGMYKEGLGD
FT                   ETLRPFLVDKAGRISREDTIIFFNFRADRMRQIASRFAKNGNNIVTMTEYKKNLKSKVL
FT                   FGKVCAKNTLAEVLSDRGIRHTHIAEKEKEAHVTYFFNGGREQPFLWQKTIILPSPDVE
FT                   SFDTVPSMASKEVTEYVIAEIRDGVPMVIANLAPPDMVGHTGNLEATKMAVEAVDGCIG
FT                   TIYRACIENKYTLIVTADHGNAERMTDGRGNCCKTHTTSKVPLIVCGEEVGEFSSSWGY
FT                   TDTDYSLRDIAPTVLEIMGIPKPDEMTGRSVLGAFGHTLPARDNQ"
FT   gene            complement(<128166..>128471)
FT                   /locus_tag="Eint_101010"
FT   mRNA            complement(<128166..>128471)
FT                   /locus_tag="Eint_101010"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(128166..128471)
FT                   /codon_start=1
FT                   /gene_family="HOG000149803" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101010"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1070"
FT                   /db_xref="GOA:E0S9P2"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P2"
FT                   /protein_id="ADM12427.1"
FT                   /translation="MTQENMINDMYPLAALLIYATNQQVTKEKIDSVFKFFGLESHPKI
FT                   SEFFEMDALEIKTLLMSSTQEAAAPVEAKASADVPGDAGKKEEPEEEEVEIDFGMF"
FT   gene            <128616..>129875
FT                   /locus_tag="Eint_101020"
FT   mRNA            <128616..>129875
FT                   /locus_tag="Eint_101020"
FT                   /product="DNA polymerase alpha-primase complex subunit B"
FT   CDS_pept        128616..129875
FT                   /codon_start=1
FT                   /gene_family="HOG000149267" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101020"
FT                   /product="DNA polymerase alpha-primase complex subunit B"
FT                   /note="similar to ECU10_1080"
FT                   /db_xref="GOA:E0S9P3"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR016722"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P3"
FT                   /protein_id="ADM12428.1"
FT                   /translation="MDFDSQIFRKLSRRYSTKSDIRMVRRPRISNFYLKKGDKYEYVAY
FT                   RLTSMKPYFLELLGIEDFSPVNSISSTSFYTYGIIMNPFGHKLDSQNTFIASNIDGSND
FT                   VVVKLNLSHLRRYSVFPGQIVAVKGKNITGGEITVETLHCIPVVDINEEKDGKEEKHNQ
FT                   PSIVAFSGPYGFASEFDVLDRILMEEADVLILVGPFISSAHGSEDHSPASMMEKEFVPR
FT                   IRRWLNERPGSKVVLVPSVNDITCLGVFPQGPIDIDEERIVCTSNPCEFFLNEFLVCVS
FT                   SLDTPLEISSEECFHDSGLESEDDACGNLLFGGDRLKRIAYHLIFQRTFLPVFPSRNVV
FT                   SYSVPENMSMDTAPDIYIVVSRLKHFSRDVGPSVVVNLGLQTGKTEKVACHIRLPEAEE
FT                   PKKFSVEFVDLEISMPRENK"
FT   gene            <129895..>130446
FT                   /locus_tag="Eint_101030"
FT   mRNA            <129895..>130446
FT                   /locus_tag="Eint_101030"
FT                   /product="chromatin remodeling protein"
FT   CDS_pept        129895..130446
FT                   /codon_start=1
FT                   /gene_family="HOG000149802" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101030"
FT                   /product="chromatin remodeling protein"
FT                   /note="similar to ECU10_1090"
FT                   /db_xref="GOA:E0S9P4"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P4"
FT                   /protein_id="ADM12429.1"
FT                   /translation="MQTHFEVFDKMLEEIQQLRLDAIYFTKSTSRTEGKIEKLRGKCKR
FT                   YKEKFVRKPSERYFKKIEKFYRAIKKHLVNNRRCEDAFQEVIHELKKKCEDLCSRSGVS
FT                   FDLECPEIPDVNCVVNLGEMGSNEQLYCKCKRPAFKNMIACDSLDCKGRWFHFECVGIS
FT                   TVPKTLWICPECRKAGTLTR"
FT   gene            complement(<130499..>131131)
FT                   /locus_tag="Eint_101040"
FT   mRNA            complement(<130499..>131131)
FT                   /locus_tag="Eint_101040"
FT                   /product="DnaJ-like protein"
FT   CDS_pept        complement(130499..131131)
FT                   /codon_start=1
FT                   /gene_family="HOG000149266" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101040"
FT                   /product="DnaJ-like protein"
FT                   /note="similar to ECU10_1100"
FT                   /db_xref="GOA:E0S9P5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P5"
FT                   /protein_id="ADM12430.1"
FT                   /translation="MDYSEAARSCLSRKDYSGYLENAKKQYELTGSPEDKREMEKATRT
FT                   LSLHKDIEAFLKKKSEDYYDILGVPKNATQAEIKRAFNTLIMKFHPDKTGMDESSAVSG
FT                   IIQNAYSTLGNPEKRRKYDMAREAPTFRASPRFSTPEDVMPNVFFNAFHSQGYQESFVY
FT                   SNDFYEYLYSQMYRRFDHRRRPPTANDPDTQKILTFLVIIMLVLMAM"
FT   gene            <131565..>132797
FT                   /locus_tag="Eint_101050"
FT   mRNA            <131565..>132797
FT                   /locus_tag="Eint_101050"
FT                   /product="polyadenylate-binding protein 2"
FT   CDS_pept        131565..132797
FT                   /codon_start=1
FT                   /gene_family="HOG000115421" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101050"
FT                   /product="polyadenylate-binding protein 2"
FT                   /note="similar to ECU10_1110"
FT                   /db_xref="GOA:E0S9P6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P6"
FT                   /protein_id="ADM12431.1"
FT                   /translation="MRKDERPPETGNIFVKNLPENFTSKDLDDAFSMFGEITSCKVATT
FT                   SHGKSKGYGFVQFKEKKAAKKVIKNFNNLNGLMLGENKIVVELYNPEMKKGENKKTPTM
FT                   FTNCFIKNFPVDVEEENLRELLEKYGKVTSLFFPTKEDGKPKGFAFANFESHECALNAI
FT                   KNLHETFPFGDGESGEPFYIQKGQRKEERAEELRKTFEQLSMQGQSYKKNLYITNIPEG
FT                   FGAEELNNIFREFGNITSMSVGTDGANSQKQYAYVCYSTPEEASIAVERGNEIYLDGNR
FT                   LQVAYFKNKLERMKEKEFGSIGYKPNIPYMYNQGVNFVPNGFKRERNRGGSAKGYSSEL
FT                   EKLHGLVLAEAPSFKSQWKSFGVNNEAEFTSKVTRAFRNKSEEEIKDMIDLDFVLAKSI
FT                   AAVIENDNSSD"
FT   gene            132884..132954
FT                   /locus_tag="Eint_101060"
FT   tRNA            132884..132954
FT                   /locus_tag="Eint_101060"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA Type: Ala, Anti Codon: CGC, Cove Score: 54.74;
FT                   similar to ECU10_1115"
FT   gene            <133005..>134075
FT                   /locus_tag="Eint_101070"
FT   mRNA            <133005..>134075
FT                   /locus_tag="Eint_101070"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF6"
FT   CDS_pept        133005..134075
FT                   /codon_start=1
FT                   /gene_family="HOG000149265" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101070"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF6"
FT                   /note="similar to ECU10_1120"
FT                   /db_xref="GOA:E0S9P7"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR011442"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P7"
FT                   /protein_id="ADM12432.1"
FT                   /translation="MLFSKETLKSFAQSKGISNIDDDALRVLSQDLEYRIKEVCQEGSK
FT                   FMVGSKRTKLSIDDINYALISRNVDPLFGYDPQESLVFRGLPSNVYYVPDEEIDLEEYL
FT                   DRPLPKIPLRPSIQSHWLAIEGVQPQIPYNPILLEKPVAKKDTLGTYQEEAELKSQNRH
FT                   MLTKELSMYFDKVIQAMETDEEIAMECLHNESGIQQLVPYFIHHFNEQIVKNIKNKEKL
FT                   MTVMMVYNSLLRNKYIFIDPYLHQILPSLITCVIGKSVDDEVRRVAADVVKYVFSNFSS
FT                   SYKTLAPRIINTLSKAWLDKEKTESTQYGALLCLSLLSKHVVETVVKPKADYYVKEINN
FT                   PRVTELLDDILKKNDI"
FT   gene            complement(<134100..>134867)
FT                   /locus_tag="Eint_101080"
FT   mRNA            complement(<134100..>134867)
FT                   /locus_tag="Eint_101080"
FT                   /product="origin recognition complex subunit 2"
FT   CDS_pept        complement(134100..134867)
FT                   /codon_start=1
FT                   /gene_family="HOG000149264" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101080"
FT                   /product="origin recognition complex subunit 2"
FT                   /note="similar to ECU10_1130"
FT                   /db_xref="GOA:E0S9P8"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P8"
FT                   /protein_id="ADM12433.1"
FT                   /translation="MSSDLSDFHFNCKKELNALAKSFNILFYGYGSKMPLLRKMFPSAI
FT                   HLNCRAMSRHEILLEIMDAVRRRSRSAAQSISKVSTIKDIDEAIGFRKEKYKIVMANFD
FT                   FSMTDFSGLRNFAILGTIEEINIKFSFEDAEKFNFIFRDLTTFEPYEEEIAGIHFRETR
FT                   AEASSKVVRNVPRNSRLVLKEILLYNSDVVGLGELFERIKRKLFLTSKTSVLSMISEFI
FT                   DHGLLKVRNGSEITVCMSSAEKKEVAKELGSLD"
FT   gene            <134962..>138138
FT                   /locus_tag="Eint_101090"
FT   mRNA            <134962..>138138
FT                   /locus_tag="Eint_101090"
FT                   /product="ARF guanine nucleotide exchange factor"
FT   CDS_pept        134962..138138
FT                   /codon_start=1
FT                   /gene_family="HOG000149263" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101090"
FT                   /product="ARF guanine nucleotide exchange factor"
FT                   /note="similar to ECU10_1140"
FT                   /db_xref="GOA:E0S9P9"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9P9"
FT                   /protein_id="ADM12434.1"
FT                   /translation="MDESKQKLEEVQILLNRLAASSNKEIRRILDGLPSCPTSKSILDT
FT                   FCLLFSLGRYSNKELLCFLDAFQRFIPICRADLSEVGDKIVELKFTPSEKDTDLVILKY
FT                   FEITNTIAESIQSESSRSVFSRYMFVLSNSVVSRGAQVEVLGRFREFLKKKKGLLKLFA
FT                   ARRMYRNIGCTEDLIINFSELLSDEEMVEVALECTTLRGFIIAKTRSRYLFQMYHNELP
FT                   WWYVMGMHESLIPYLYYTFDGVGLYKNVSKEVYGRLDEQDIIRAMDEDMKSKISPDECD
FT                   VLGNVSEHKNMADDEGMVGVKRDIRRFNETGCLKEMLEKYGEQMSFEFLRYFEETDLRR
FT                   LGEFLCKLKNEPLLRMFAETFDFLDMDILDGLRIFLLSFHLSPEGQVIHRVVEAYADKY
FT                   YLDNAGICTFMDMAKDKKTKEFVFNLSFSFLVLNTKFHNPNIKVKPTFKDYMKDFTPEE
FT                   IPPSFGEEYLESMYQSIKKKPLEFPAKNQPGKEHYKVFKKVCKNLQEMESRESKLRIRL
FT                   LEPELPEGLRICTACRMEAHRKLFSTDFKRFLFLDPKVFYQICSRLRMTHIFEEYLNAH
FT                   KEDTQKFIESFVYYLGMEGKASLYATLLDVLARTDKQRSSGMLSDLGISFLKSSPGKDR
FT                   VQQQYRDAYKELLNSEIPNVGLLCEGLCLFLSRDVSGGVSGEEEMASQKRRQRSIGFVK
FT                   GVVVDILKRNISKVEDLSMLDDENIGVLLRECVETGNRKKFCHISKFVSEERLLFYFRQ
FT                   VLEESPGFLDDEILEVFKRISIYNENGFHCILLLQSNGVDMFDFVVTVKYESIVCRAIN
FT                   AHEGEDGDQSEQSRLEFSGKDTLNCYTVEEKYGESLSVPSNLFHFYVSSNSVLNQSKAR
FT                   SIHKSGCPLKEKLFNREEMDKRLIYMIKKADSMNSKDITNYALWIVNLLSSSLPLLSKF
FT                   FVRNFGLLLTLKDQTMTNNFIKIFYSRICKVINGSELCCRCGYSYLDDVEKLIEMLLKY
FT                   DLASEKDFEFYFKGKSEMIKSGRVKVGERGVQLVNSKEKNDGSENNSGEPGEVAVVGEP
FT                   NIKTNPDFNL"
FT   gene            <138262..>140904
FT                   /locus_tag="Eint_101100"
FT   mRNA            <138262..>140904
FT                   /locus_tag="Eint_101100"
FT                   /product="hypothetical protein"
FT   CDS_pept        138262..140904
FT                   /codon_start=1
FT                   /gene_family="HOG000149801" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1150"
FT                   /db_xref="GOA:E0S9Q0"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q0"
FT                   /protein_id="ADM12435.1"
FT                   /translation="MEIFANDPFLEEGMCNAPIGTFDKHYRLSRNFIADLVHLGPILVS
FT                   VAVEKDFSRALVRSVLGFKEYRFYSKHIEECPYFFTVRNSLSRYFVDTIDNWRHVEIAP
FT                   EQRESSLMGILGSIFSFGAWPLRDESGGGRKKMYDAISSGMMGCPERYSAKEIMNKMAE
FT                   VRVEYARGVDNEFYTKPIYVDLVCESSKRIPREMLGKRFIDPEDTLSVSSDDLEDIKSP
FT                   THSGEKRLRQALLGFLFNEVEYFCQVNGFYLDIVSKARKSEINFEDVFKGFYKVHSFEA
FT                   GFIESMRDIVEEAGFKMDRILSDPQYFADTMRDNGVGEIKMDDEEILEKVLDSFERHLN
FT                   GFRCYEDMMLFHEEYIETLEKVRSYDWAPDYRVVNDCFCNCLQRIVRYPILIDDILQNL
FT                   TFSLHEKRVKKIYAKMTKLINIIDKKKERHDNIRCEQLIREKVEEIPGEVAERKANFLF
FT                   QLNCEDSNGDPIALFLFREMVIIADREGPSLPIQDPRCGRYFFRHSLRLEDIEIVSFGT
FT                   TGIKIIGKGSLKGNEMYEMKEVYSDVSIGVMYFSKGSPHSVKWFIEEYHKAGTDSGNGL
FT                   YASGNVFFRVLKDSEEGGQERKRDLIIYVGDVGLDISSDSNSAHLDLENGAFTTKGQSI
FT                   QHSINYGKDEIKQKFGEIVGNGVRARKAWMASKDTPGKCPELFAMYRIKLREIVEECGD
FT                   SSVVEFNGRFSKCNSSTITRKIRVAEGIIRYLSRSLPYVGCRSSGGKYLFSSAGLDRSR
FT                   LKEEEMVNFLEKALSTEELEDYAFSEYNAEDILYLLMYFIRTSMYTFFRIEDIETLHRT
FT                   LFVDKIHFLGAVVPKMSNPSFVSSLFETIVTARDKLCIVPTLDMFLVMFSPFQVSEQEM
FT                   AEIVTKICW"
FT   gene            complement(<141270..>144392)
FT                   /locus_tag="Eint_101110"
FT   mRNA            complement(<141270..>144392)
FT                   /locus_tag="Eint_101110"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(141270..144392)
FT                   /codon_start=1
FT                   /gene_family="HOG000149800" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101110"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1160"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q1"
FT                   /protein_id="ADM12436.1"
FT                   /translation="MVVKWRSTELVFKGKKLRFREEIISVGNFKKWVVVCTQSRIHFFG
FT                   DEDMTLSRPIKAAIVKEEGVYYHHKENNHVMFISHPFEPEEFVFFHHGFVLREVISGEM
FT                   ILEGRGRYLLRNTGRKEIGLEDPIESSCSGMGDDNFDETNRTRMLIAYKIEEGIRCLVE
FT                   DYEEDTKNEGGIKMRITEYENFMVGIYGNTALFVRVGGSKGRVKRSKLLSETNVRFEKE
FT                   AKHLIKYRMRLTRDKYLEFLRINDVLFMGNEIMCSRIRKDLWPKSRIPKKWMQNYYKPF
FT                   WSGINEVEKNILSCYPRAMQRVFMGAFLQSKEKRFDLLEITEDVMAGIDRVLDEWLARC
FT                   KSVWEFLGMEIAPIKGLETMSRCKELINYTCPSLSVGQDVMNIKFRRIMRCNLDAITGL
FT                   KYSDVKNLGYRVIYMEMKKSRILGSTKPTRSINKLCRIAKKHFGDSRIEEVISLFDEKP
FT                   IIFEIDEYDLENKKEKGYVLRKISNIGGAYLFYGLGVAKEEQSPGQLRFPIYKNGELGE
FT                   IEIKDPEWMNWPMFNYSVSRSCGLSSFDEISHDFIESRILEFTSTGEGNEFEVAGRIFA
FT                   FGLQGRLEGVHPQKVGEFITAKYPVVSMALLAGMGMSHLGKRDDLLGKMYLHCLKSPQP
FT                   LYIHAGCIVGLGMLYAGSGNVFIRNVLSSEANKKGVFGDEQYNKGNKIWYDYTYRVLSS
FT                   ISLSMVYMKTSLDMFKFIELEDSLCELLTNGIVLFGSKQTRFRSKFKRSDTSTPEEVFY
FT                   SELFLLGLEMNEQLDSIIEEVAKKSRAASFYELYRGSGRLLYVSLYLLYKGIKVDLEGS
FT                   LFKSILEVCLFAERAMRENDEFKILFDASLVSLSLISNSSCNLDTIRILRRQIKATETG
FT                   KSLGEQTDLFFTSSRCKQEAQLSMRYGDIERYKMCLGIVTCGMGTLKIASTFHLVLDVI
FT                   STFFICFPISPVDQEYFNMTRYFLLLSMKENPEGFKSTVKYLKETNKRSRRKLRRDMSR
FT                   INKIFLKEYSEASDADKKFIIDILTDFYEKYAESDNLLDVEMLKNIACKTP"
FT   gene            complement(<144441..>145013)
FT                   /locus_tag="Eint_101120"
FT   mRNA            complement(<144441..>145013)
FT                   /locus_tag="Eint_101120"
FT                   /product="DNA excision repair protein"
FT   CDS_pept        complement(144441..145013)
FT                   /codon_start=1
FT                   /gene_family="HOG000149262" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101120"
FT                   /product="DNA excision repair protein"
FT                   /note="similar to ECU10_1170"
FT                   /db_xref="GOA:E0S9Q2"
FT                   /db_xref="InterPro:IPR000465"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR022656"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q2"
FT                   /protein_id="ADM12437.1"
FT                   /translation="MENTSRDGGFFPEKEDKKKELKEDESILLPVLPGKRCKYCLQIPL
FT                   DDEIEKTFGIPVCRSCRYSSLKFVTKTSCLSDYLLVDDELKELRFLERPNPRKGTWSRM
FT                   HLYLKEEVEEFAVWKWGSLEKIEEIKEKRKKRTKDRKQRKLKKNIKDLRRKTRMEVGDT
FT                   KKHEHVFEDDGEVCRCRCGMSVEEEEL"
FT   gene            <145122..>145805
FT                   /locus_tag="Eint_101130"
FT   mRNA            <145122..>145805
FT                   /locus_tag="Eint_101130"
FT                   /product="ubiquitin fusion degradation protein 1"
FT   CDS_pept        145122..145805
FT                   /codon_start=1
FT                   /gene_family="HOG000149261" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101130"
FT                   /product="ubiquitin fusion degradation protein 1"
FT                   /note="similar to ECU10_1180"
FT                   /db_xref="GOA:E0S9Q3"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q3"
FT                   /protein_id="ADM12438.1"
FT                   /translation="MLLDLFGLFGGKPSWSLSPKKFEGCNQNNFGGKVIVPQSVLVDLV
FT                   SFQIQPPFTFEISHSDGVFKTHCGVLEFTGEEGQVVVPSWMYQQLSMGDVDKVELKYMT
FT                   FPLGRFVKLIPHSVDFLEVENPKQELELCLRNYQVLSEGDEILFQFDEVGSMRFTVAHI
FT                   EPSSSAVYIVDTDLAVDFLEPIGFKDKVERERTVTKYIEVVNSNYDIKPIRMKKLGLYM
FT                   YKSAD"
FT   gene            complement(<145847..>147397)
FT                   /locus_tag="Eint_101140"
FT   mRNA            complement(<145847..>147397)
FT                   /locus_tag="Eint_101140"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(145847..147397)
FT                   /codon_start=1
FT                   /gene_family="HOG000149799" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101140"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1190"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q4"
FT                   /protein_id="ADM12439.1"
FT                   /translation="MHASELRTLHSSKNYEEIYNIIREEMEKLSLRDKLCTNDLEGLQS
FT                   SIEEEIRRCVHEQKGIPKPLVNITLLQGESFEARMKSLAISYLGSLCSVSYQEFLNCNF
FT                   QRLSSLKSCLGWIEESISRVSLKYSHVPDDWSLPREILLKYYVMTKQRVCDYFFYNEVD
FT                   EEDFIEAFDATIRCEKRLGKLFEKQGCSACVQSTSLEDGACKSKGLSQKETFCPHKTML
FT                   SSLFVPNIEIYLERSFKELMESDLNQENVKLCIISGFLDFFRGVEKILKRVEYLNDKSA
FT                   HRHLVHYFDEYLSLLIKRTRLPGCLNESIIVLNTMLYIRETALDFLDQIIEKSEVEEDI
FT                   PKIHMQMRKAERLQNTFIDDFLSSYFLGLDFSAPEGLSRKVIQILDKDIMNEEIEGIYE
FT                   DIRITLVESVVSHVFSGIYSIKVTPRISEALLLETAEIKRYLRTKVSVLPLIDVVEKYL
FT                   KIFLCPPDNERCFVENFILMSEGIFSFDQIVNNIGSSHGEDRLYLAYKSVVDSFNGVS"
FT   gene            <147571..>148188
FT                   /locus_tag="Eint_101150"
FT   mRNA            <147571..>148188
FT                   /locus_tag="Eint_101150"
FT                   /product="casein kinase II subunit beta"
FT   CDS_pept        147571..148188
FT                   /codon_start=1
FT                   /gene_family="HOG000149260" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101150"
FT                   /product="casein kinase II subunit beta"
FT                   /note="similar to ECU10_1200i"
FT                   /db_xref="GOA:E0S9Q5"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR016150"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q5"
FT                   /protein_id="ADM12440.1"
FT                   /translation="MENLLEDDSENLLRMSPDEYWVGDFMHRRENRSIVRVPDEFLEDR
FT                   FNIIGLDRYIKDLEKVYSSILDKGPRSSFQEESSLYYLIHQKYIFTKPGLETVLDRVMS
FT                   KEYGACPRIGCKSVGMIPIGLSDRPGVSSTKVYCHCCVSVYEARGILRLVDGCAWGKSF
FT                   PHFLILTHSYHFPSGKCEEYVPRIYGFRICAHDDNDSLSEDN"
FT   gene            <148254..>153584
FT                   /locus_tag="Eint_101160"
FT   mRNA            <148254..>153584
FT                   /locus_tag="Eint_101160"
FT                   /product="DNA polymerase type-B epsilon"
FT   CDS_pept        148254..153584
FT                   /codon_start=1
FT                   /gene_family="HOG000149258" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101160"
FT                   /product="DNA polymerase type-B epsilon"
FT                   /note="similar to ECU10_1210"
FT                   /db_xref="GOA:E0S9Q6"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013697"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q6"
FT                   /protein_id="ADM12441.1"
FT                   /translation="MRDELLEEQYGFISHHESRRREGWVLNYITTVFKDGRMEAKLYLI
FT                   DDKRAEFLVKIPYFPSLLLKASDYDSVEEYLRRKYAAEIYSMERVHRIDFNEYNHLNKD
FT                   PGVFLEVRFRTESGFSTAVKDFKKIVARNKVQKNNEYDCFGKDRTLCAEELMEGIFEYD
FT                   IPVEVCTANNLKIRCGKWYTFYYTGETYVIEKSERVVFPDLRILAFDIETFKKPLKFPN
FT                   PDYDEVMMISVKTECRGELIVNRRLVSKDIRKFEYNPREDMECVFDVSNEGDEEGVLIR
FT                   FVELIQKHKPHLITTFNGALFDFPFLEKRMKNYGISLRETTGFTLKDEYYISPFIVHLD
FT                   CYKWVKRDSYLPAGSQGLKEVTKVKLGYFPDEIDPEDMVRLAMSDPDKMASYSVSDSVA
FT                   TYFLYTKYVQPHVFSLCSLVPLSPTSALCQGSGTLCEALLVSEAIEYGVLIPERRRESK
FT                   TREHNGHIAESITYVGGYVECLRSGIFRSDLEHEFNISKEFIGEVVSSLDEILYEYKEE
FT                   GGFEEMKAQILANLQENKGRLRKEGLIYHLDVGAMYPNIILTNKLQPVSIVNEEICIRC
FT                   DFSDESNNCKKRMEWSLKVEYIPAGKRETEMIRRQVEKEKNFEGNEEEEVKKRVRRYSK
FT                   SMYGKKREKKICTRSSTVCQREIPFYVETVRKFRDQRYVYKRLQAQAQKAAEEATTDEE
FT                   RKYAMKSVVVYSSLQVAHKCVLNSFYGYVMRKSSRWYSMEMAAIVCNVGGNIIKKAREI
FT                   VEKIGISLELDTDGIWCIVPSSLVSSYVLPSGKKFSLLSGLLNHFVCKKFTNNQYQEKI
FT                   DGEYATRSENSIFFEIDGPYRAMLLPTSTEESKLLKKRYAIIDDNNKIAELKGFEMKRR
FT                   GELQITKKFQEELFLHFLDGSNLNECYESLAEVCRYWLDILKSKGEYLDDDTILELLSE
FT                   SRSMSKGFGEYRGRKSNLTVTAVRMSEVLGEGILEEKLKCEYIVAAYPENKSVAERAIP
FT                   VVVFRSEQKEEFLRKWLERDYSGDIRAVIDWEYYRVRLECVIQRMVILPALSQGIKNPL
FT                   SEVGIPEWAKAKTQLRGFDLRNVDDIEDAFCKARLSKDTEAGREKCKEDFEEDKENCKD
FT                   DEKKMRDLMETDVREYILKNRIAWIERIKRIIDVGDIIKMVCSNDGYMDVYRMGRSDSV
FT                   ERIPLERRIYMQVNDWRYFDKSGDIERVAVYFPENSETTEVGTISIKEHEFVKDYSLYR
FT                   KFLSHFSIRRVFEDKIPILYSNLKECEGHDVEFVTVGSFIFLGKPVYTVGEEEFLVFSG
FT                   KEGLYDLGRYLLRNFGKWRIGVIGSSDPCKTELRKILCKYHILEIQVRRNLSLKEYSVM
FT                   CNEQKEFHKQMAREVELVCKLSKYSRIPIFNVNENVMDVLFYRELKKNRVVCGRQECEM
FT                   SYSPRLRAESFRPGLYKKYVVEIECIGTLVLSIIEYEAFLGKDTLFKGVERKDFHILRS
FT                   LLKRIVLDSIKGEDGAKLLLRNIGRWIRSDSAIICSELRSICCMLQKRYMMHLAKKLRD
FT                   EKYDVICVAGDVVLIDTGKTSEESALDFFQYICKKGLELCGYEMMKMKAIRIFQSLAFV
FT                   DPSTYFFLDRGEYFCFSESKVPTAFLQAYFNEEKVDSEFVYSLVTKIPLESSKMVLKLL
FT                   SFRQDSQALLSNCYKLLHLSEFAEKERKEIYLDIVCPSCGMESALRARCIKCYNAYPKS
FT                   AVLEVCMAYAKHLLWLELSRDLSCTICGKSNEARLSSFCKCGGAFQKTSYGNELESLRE
FT                   IAGSPIFDGFYRRISKHFLK"
FT   gene            <153632..>154054
FT                   /locus_tag="Eint_101170"
FT   mRNA            <153632..>154054
FT                   /locus_tag="Eint_101170"
FT                   /product="hypothetical protein"
FT   CDS_pept        153632..154054
FT                   /codon_start=1
FT                   /gene_family="HOG000149798" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101170"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1220"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q7"
FT                   /protein_id="ADM12442.1"
FT                   /translation="MCSEIKVLERNNETQIDTLLYDHTLVHITFNTKEHPLSPRDLSIN
FT                   HLGRSSSGSVKVFVNSKKVDFSYELVFGYALSCIGIEEYDCKVYLFDDTDDLCVLKNLM
FT                   FAIDEKFKAGLRVFSDHSKTTVSLGGKIIYETTIVL"
FT   gene            complement(<154104..>155819)
FT                   /locus_tag="Eint_101180"
FT   mRNA            complement(<154104..>155819)
FT                   /locus_tag="Eint_101180"
FT                   /product="MdlB-type mitochondrial ABC transporter"
FT   CDS_pept        complement(154104..155819)
FT                   /codon_start=1
FT                   /gene_family="HOG000149257" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101180"
FT                   /product="MdlB-type mitochondrial ABC transporter"
FT                   /note="similar to ECU10_1230"
FT                   /db_xref="GOA:E0S9Q8"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q8"
FT                   /protein_id="ADM12443.1"
FT                   /translation="MKKKVSGRYSYMISLIIHFLVKDKAVLLGILTTVFFIMLSSKFHF
FT                   EFQKSLTKIEQYIARKTIDETDSSRLLITFMLLPISHYMSSLLYKLVSAYVIQLLIGKS
FT                   FHHCLREYLLTNYHRFHHLGSGQIHSLVERRSNGMVSFLRILFADIFFNASYVLWGFLY
FT                   FSRCSTGVVILTVIQILVYVVVSWYGTILRNHFRRKYNGAYNFASNRLYGILQNYDIIK
FT                   SYNKEENELQKYIDTFRDVGRHSRRYDQINGFVEFFQKSLLFVPNAFMVLMIIGGYMFK
FT                   SMRIGNRYIEYSKFFSELRSGIMKLKESTFVMNENLTDIFDSKIEDALEEEDLGLAIER
FT                   FGDTIRFNGMSVHIGNRLILEGFSGEIKKGEKIGIIGKNGCGKSSLVNVLLRFLDYSGE
FT                   VYIDGIELRRIRKSSVRGLISFVPQNHHLFNGTILENIGYSYNSIEYDHVMKKCVHFNV
FT                   HEIFSKLPRGYQTLVGENGKFLSGGQKQRVSFMRAMVKDSDIVVLDEPTSNLDADSEKE
FT                   LVETILKKMEDKTVFLVVHDHDLLRGFDKILGLHDNKVKIYNSFDDFIIDKSKY"
FT   gene            <155981..>158467
FT                   /locus_tag="Eint_101190"
FT   mRNA            <155981..>158467
FT                   /locus_tag="Eint_101190"
FT                   /product="karyopherin beta"
FT   CDS_pept        155981..158467
FT                   /codon_start=1
FT                   /gene_family="HOG000149256" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101190"
FT                   /product="karyopherin beta"
FT                   /note="similar to ECU10_1240"
FT                   /db_xref="GOA:E0S9Q9"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Q9"
FT                   /protein_id="ADM12444.1"
FT                   /translation="MDRRGLESCLYEVLKSDSTSGKRAEAKILELQSSDFERFISILVE
FT                   VFCDLKSNDQLRMVSGIILKNSLHANDPDLQKGCLSRWLGMRPESREYIKNTIKRALRG
FT                   PTPRFCTMAGAALGQISRMEIPNSLYQGFFEEMKRMVCDEETACGVCEAVGTCCSYLTK
FT                   EAPDILRMHNATVFEICIHPLKRGTTRESKLSGLKCLMNCMEVEGIFCYEENVNIFLNS
FT                   TIEIWNGDDEELIHKLMICFNRLVMLNYKFIRKSILENILGQYLGRFFKSKHDEIKIQA
FT                   IEYWCIFAEKRDEEMANKYMSVVLPEILSLLKKGPDYYEEIWSPHKAASSCLEIYTELK
FT                   GDKMMRNGMIWGFIETSLKSESKADVDIGAVALGSVMHEKCEDCLVKIVPDLVAGIGFE
FT                   ESKDSCLWALSRTAECNFYALVDHLPIILSRCGSVVLESSKSSIGAAWAMDCIFRSVAD
FT                   SKRKEGFASHIPSSTKKRADDFVESFLVKQYLDILNVLVKGTELANLNDSSLRVALFSA
FT                   LDELILICPQTVLDILIGFYDYTSKKIDECISVLGYATQDQLLVVEDVLSNYIGLIEAI
FT                   ATARKREDVEDLLELFIRILESTPTIAFGEVYTSISNLSTKFAPHTSRILPYMTRDMRC
FT                   TDRFVLNSVINLVGRLANTMGTDFNILATVLTSSLVQCLSSEATHRDLKPIILSVFGDI
FT                   ALALERNFESYLDMVVMLFQQISELNRHGDEEYVDDLRKNAVQLVNCSLVAIGDSSKVR
FT                   NLLPRIISIAHKMGIEDGSGKTHEDILGLIDDLVGMYGKNFGLDEPWIKEFLYGMMKSS
FT                   NDRNRKKASHVLEVLR"
FT   gene            complement(<158506..>161187)
FT                   /locus_tag="Eint_101200"
FT   mRNA            complement(<158506..>161187)
FT                   /locus_tag="Eint_101200"
FT                   /product="formin-like protein"
FT   CDS_pept        complement(158506..161187)
FT                   /codon_start=1
FT                   /gene_family="HOG000149797" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101200"
FT                   /product="formin-like protein"
FT                   /note="similar to ECU10_1250"
FT                   /db_xref="GOA:E0S9R0"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R0"
FT                   /protein_id="ADM12445.1"
FT                   /translation="MFFITSSSSLPGMEGETLMNGARINSRILEKIQALVKNSEGGDFR
FT                   CVGSTSLSNGSKEVYIKKERGDRRQGANLNVWRISHRVLVFGQCWDNSTESITRRNNTG
FT                   ELIEFLNTNYKDRFMVWSLGESLKKYPNVQKIPSLDFDLGLAYRISCAVRCWLEFNPNN
FT                   IAAFETQNGDEDKLRFLVGCVLRYCELADRTELIWEKCLEGAFASSLSNINTVKRYIKY
FT                   FDSASTLKGELAHTVILRQLIVTTIPSASTKSFLIGMKIMKKGEELCAIKEGDDDRVYR
FT                   DKDYAVFSGVDCDISEDIQVFLYYYLEEEEKRMVLLRINTLFYRQGLYRFALDDVECFL
FT                   PENRFDKEFTIDLVMIESGKAVQKPQCIHKVDLIQGLRLLNEGFWGEPDREIYERLVSE
FT                   GQNEIVAKFCAFMRYFSEKTSELVRTLEAKGFRASILEAKTLKHADIVFENKEKCWGKH
FT                   RDAEVEEISGEGVCGGVGIDRKALYTMENGNPKPLELIGSFSRVENRYKVKPKKIVVKK
FT                   RQAEKCDAQPNVVIKKPFHWIPLSRAEETIFSETSGISTDIDYEKFEEIFCEPFSEQKK
FT                   TSKETKRSIIEESRLFLASLSLKHLELRNITPENVYSILKTPDNPLGLQDLLNIEKMYP
FT                   GQEEVMDLISTPPESLGKVEKAMLEFSKLLDVRKLVEILIFERRFFDEIFLIEKTLLGL
FT                   LEVCNRILDSQSLRIVLRTILEIGNTMNFRYSISRKKANGFKLSSLYVFSNYRGKNNTS
FT                   LFPFLFHVLEANGVRVEHLLEELSPLHDLKNEELPKIREKINHFIEIYTEKLGLLNLLE
FT                   EDAKKEYAKFFRFAYSKLEEMSCSFKKFHLHSSMVKRKFGEEETKSLREILTTLSDFLN
FT                   STKQELGRYRKTQNRSFCPKAT"
FT   gene            complement(<161270..>162331)
FT                   /locus_tag="Eint_101210"
FT   mRNA            complement(<161270..>162331)
FT                   /locus_tag="Eint_101210"
FT                   /product="putative 1-acyl-SN-glycerol-3-phosphate"
FT   CDS_pept        complement(161270..162331)
FT                   /codon_start=1
FT                   /gene_family="HOG000149255" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101210"
FT                   /product="putative 1-acyl-SN-glycerol-3-phosphate"
FT                   /note="similar to ECU10_1260"
FT                   /db_xref="GOA:E0S9R1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R1"
FT                   /protein_id="ADM12446.1"
FT                   /translation="MKRAWNAIFFLVAMIVYFSYIIVGLAFVSVVWLVCYGKVAKRALR
FT                   RSAKITWLHLTRAVFSGYFPKKVFIRYNPAILKRSRNVIISNHLTEYDWLFVCCVLHCF
FT                   GRFKDICIVLKMSLKDIPLLGRGMKFFQFIFLNRKISKDKELIISGTSRLRSEGKYDLL
FT                   IFPEGTYIDKLSHPKSHKWSSEADVEIDGRSFDPEEVLIPRTTGFKILRENIRDDMEGI
FT                   IDITMMGNPYVKYPNDTFSYWDVIVNKSQKVNFMFFLDYIPNNNSMDEDSFLLKQFEKK
FT                   EKMISRFKEKNGEKCVTRIEEFSMIANLLSDPNEEYRDMEIELSSPWGPFFHIMFTLNL
FT                   GLLIGWIVRLFSK"
FT   gene            complement(<162415..>162954)
FT                   /locus_tag="Eint_101220"
FT   mRNA            complement(<162415..>162954)
FT                   /locus_tag="Eint_101220"
FT                   /product="Dullard-like phosphatase domain-containing
FT                   protein"
FT   CDS_pept        complement(162415..162954)
FT                   /codon_start=1
FT                   /gene_family="HOG000236379" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101220"
FT                   /product="Dullard-like phosphatase domain-containing
FT                   protein"
FT                   /note="similar to ECU10_1270"
FT                   /db_xref="GOA:E0S9R2"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R2"
FT                   /protein_id="ADM12447.1"
FT                   /translation="MQLVSPQKNDLGRTVVLDLDNTLVYSTFKKPRLYDFCLEVPGKKN
FT                   LQIYVKVRPHAVEFISIVGAIYEVIIFTAAKKEYAEKVIGIIDANKRIAYSLYRDSCTL
FT                   VNGKYVKDLCKLGKPLNEVILVDDSPHSYEFQPHNGIHIPPYTGEKDDDSLLKIMKFLR
FT                   EIHEDGMFGSIHQTPF"
FT   gene            <163105..>164013
FT                   /locus_tag="Eint_101230"
FT   mRNA            <163105..>164013
FT                   /locus_tag="Eint_101230"
FT                   /product="Ser/Thr protein phosphatase PP4"
FT   CDS_pept        163105..164013
FT                   /codon_start=1
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101230"
FT                   /product="Ser/Thr protein phosphatase PP4"
FT                   /note="similar to ECU10_1280"
FT                   /db_xref="GOA:E0S9R3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R3"
FT                   /protein_id="ADM12448.1"
FT                   /translation="MTENPLDVKYQSMLENIRDSLLPSREDVLVLVEEVRKILESEPNV
FT                   LYIDTPVNVVGDVHGQFYDVLNMMSLMEDPSEKPYLFLGDYVDRGYNSVDLILLLFVYK
FT                   RLYRNTLHLLRGNHETRMLSSVYGFKEECVRRYDLVVYWRICEAFQYLPIAAVVLGKYF
FT                   CVHGGLVPGMSLDFLMKHDRIGEITEINDILWSDPDETLGFRKSQRGAGYLFGEDVLRN
FT                   FLDEHGLFHFVRSHQLVNDGYKVYFDGKLYTVWGAPNYCYSSGNIACVMAIDENGHDFR
FT                   LFDRCEEQFKEIPVRCDFFGS"
FT   gene            complement(<164021..>164524)
FT                   /locus_tag="Eint_101240"
FT   mRNA            complement(<164021..>164524)
FT                   /locus_tag="Eint_101240"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(164021..164524)
FT                   /codon_start=1
FT                   /gene_family="HOG000157065" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101240"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1290"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R4"
FT                   /protein_id="ADM12449.1"
FT                   /translation="MNKSPFVSSSLERRYPIDISDGILQEITQYSVFELIRDIRDPEHS
FT                   YTLEQLGVVSREGITIGLIDSDGIAPSAGLPIKYIKVMFKPTIPHCSMAAIIGLCIKAQ
FT                   INQYIENHFIQVHIVNDGHINFKALNKQLDDKDRVLAAMENETLLDLMKECLPRHGELL
FT                   DMPK"
FT   gene            complement(<164579..>164893)
FT                   /locus_tag="Eint_101250"
FT   mRNA            complement(<164579..>164893)
FT                   /locus_tag="Eint_101250"
FT                   /product="60S ribosomal protein L44"
FT   CDS_pept        complement(164579..164893)
FT                   /codon_start=1
FT                   /gene_family="HOG000224989" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101250"
FT                   /product="60S ribosomal protein L44"
FT                   /note="similar to ECU10_1300"
FT                   /db_xref="GOA:E0S9R5"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R5"
FT                   /protein_id="ADM12450.1"
FT                   /translation="MVNIPKTRNTFCKKCSGYSPHKVSQAKKSKDNPRAQGNRRYARKQ
FT                   RGYGGQTKPILRRKAKVTKKLVLKLECTKCKFSHQKPLKRAKHVIFGGEKKTKGEALVY
FT                   "
FT   gene            <165043..>165534
FT                   /locus_tag="Eint_101260"
FT   mRNA            <165043..>165534
FT                   /locus_tag="Eint_101260"
FT                   /product="ubiquitin conjugating enzyme E2"
FT   CDS_pept        165043..165534
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101260"
FT                   /product="ubiquitin conjugating enzyme E2"
FT                   /note="similar to ECU10_1310i"
FT                   /db_xref="GOA:E0S9R6"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R6"
FT                   /protein_id="ADM12451.1"
FT                   /translation="MSTPAKRRLMKDLKRVKKNSCKTIFAEPLEDDLMTWAAVIFGPES
FT                   TPFEGGTFSLVLAFPETYPQDPPNVRFVSDMFHPNIYPNGELCLDILSNRWSPSYDVMG
FT                   ILISIQSLLNDPNTASPANTEAANLFSIDPHLYAEKVRNSVIKSWMDVENLRDKYGSPQ
FT                   "
FT   gene            complement(<165601..>168072)
FT                   /locus_tag="Eint_101270"
FT   mRNA            complement(<165601..>168072)
FT                   /locus_tag="Eint_101270"
FT                   /product="SNF2 DNA/RNA helicase"
FT   CDS_pept        complement(165601..168072)
FT                   /codon_start=1
FT                   /gene_family="HOG000192862" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101270"
FT                   /product="SNF2 DNA/RNA helicase"
FT                   /note="similar to ECU10_1320"
FT                   /db_xref="GOA:E0S9R7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR015194"
FT                   /db_xref="InterPro:IPR015195"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R7"
FT                   /protein_id="ADM12452.1"
FT                   /translation="MNVKLLRKYKSFIGDNEFFRAFIPNYEDVMKGDDEPIEPYTFISS
FT                   PKFIIHELKDYQIEGLNWLINMHENSINCILADEMGLGKTLQTIAFLGYIRYVKKERKR
FT                   HLIVLPKSTLANWKREFRKFMPNYKARIFYSSRKEMKREAEEIMSSKWDACLTTYEMCI
FT                   NAKNILSKVNWSYIIIDEAHRIKNEHSLLSKIVRIFSCDHRLLITGTPLQNNVHELWAL
FT                   LNFIVPEIFNDAEKFENYVMSIEEEDGEAIKRIRNVLQLFFLRREKIDVEKGLIPKKII
FT                   NLYSKLSPMQREWYKMLLKRDLSPLGSTRDPKGMLMNVVMQLRKCCNHPYLFPDAEPEP
FT                   YTNDKHIIENSGKMIVLDKLLESLRARGSRVLIFSQMSMMLDILEDYAMFKEYEYCRID
FT                   GSTSYKDRTEAIDAFNAEGSEKFIFLLTTRAGGLGINLSTADTVILFDSDWNPQMDLQA
FT                   QDRAHRIGQKKQVVVFRLISENTVEERIVYRSLQKLKLDDILLQGRCYKSSGVSQSELI
FT                   DILANGMEITEDEEKDENIEDLIRRGEEKTREMNMKLCDFKISDTLNTNIDCYTWEGED
FT                   YNIKKIENFIESNQDAYGRSSRTSVLFRTRPRIIEYPEYQFYPRELMEIQEKEIKLYEE
FT                   GKSLSPDEVARKKELQSQGFDWTKKDFQSYVKAMEKVGKDDVSKIAMLMKHKNDVEAYH
FT                   KVFWERVNELRDAEKIISSIEKSQKKMERRSKIREMIEGDFDSISAKLGKTRSRLGDYN
FT                   PLLIDLYRKYIDHPNWVECIRKDILKLPEYKFDYYLLSRTNSDIQKHINHLISALAKYC
FT                   KETKDTDPIKA"
FT   gene            complement(<168131..>168694)
FT                   /locus_tag="Eint_101280"
FT   mRNA            complement(<168131..>168694)
FT                   /locus_tag="Eint_101280"
FT                   /product="Ercc1-like DNA excision repair protein"
FT   CDS_pept        complement(168131..168694)
FT                   /codon_start=1
FT                   /gene_family="HOG000149254" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101280"
FT                   /product="Ercc1-like DNA excision repair protein"
FT                   /note="similar to ECU10_1330"
FT                   /db_xref="GOA:E0S9R8"
FT                   /db_xref="InterPro:IPR004579"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R8"
FT                   /protein_id="ADM12453.1"
FT                   /translation="MIKVSPLQKGNNVLNYLSNASWHYDNSITPDYEINRSTALLFLSL
FT                   RFHSCKPEYIHKRINKLKPYKVKVLLVHVDIPNYSKTIQELFDTTSLTMVLGFSIDECS
FT                   RYIRGFDEAGKRSIEAIRRGSHDEEGFLTAFPKVNKSNAQQILKYNGTLLRFFGKSSEE
FT                   MEKIPGLGKTKSEDIIKYLNMQFE"
FT   gene            complement(<168756..>169457)
FT                   /locus_tag="Eint_101290"
FT   mRNA            complement(<168756..>169457)
FT                   /locus_tag="Eint_101290"
FT                   /product="Rrp4-like RNA-binding protein"
FT   CDS_pept        complement(168756..169427)
FT                   /codon_start=1
FT                   /gene_family="HOG000149796" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101290"
FT                   /product="Rrp4-like RNA-binding protein"
FT                   /note="similar to ECU10_1340"
FT                   /db_xref="GOA:E0S9R9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9R9"
FT                   /protein_id="ADM12454.1"
FT                   /translation="MKTLFLPGEDVLESDGYIRGHGTQLRGSNIASTYFGRVKITNKLV
FT                   SIDPISSMKYNPEVGNVVVGRVIGIHNKKWKVELSSRGDAYLGLSAINLPGTVQRRKQE
FT                   SDEMSMRDFFDINDLVVSEVQKVNRNGTIALHTRNDMYGKLGQGLLVFAPHFLLEPLRT
FT                   RFLLHGNIKVIVGCNGYIWVGKTREDPMAFIEIASLVSKIKTMVSQNRYINMEELLEKN
FT                   S"
FT   gene            <169497..>170987
FT                   /locus_tag="Eint_101300"
FT   mRNA            <169497..>170987
FT                   /locus_tag="Eint_101300"
FT                   /product="putative beta-lactamase fold-containing
FT                   exonuclease"
FT   CDS_pept        169497..170987
FT                   /codon_start=1
FT                   /gene_family="HOG000231294" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101300"
FT                   /product="putative beta-lactamase fold-containing
FT                   exonuclease"
FT                   /note="similar to ECU10_1350"
FT                   /db_xref="GOA:E0S9S0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S0"
FT                   /protein_id="ADM12455.1"
FT                   /translation="MNVVPLGAGQDVGRSCILVTINGRTVMFDCGMHMGFNDERRFPDF
FT                   SYISKTKNFDKVIDCIIISHFHLDHCGALPYFTEVCGYSGPIYMTLPTKEVCPVLLDDF
FT                   RKIVGGKGDSIFSYQDISNCMKKVVTISMNETYKHDENFYITPYYAGHVLGAAMFHVSV
FT                   GDQSVVYTGDYSTTPDKHLGPASIKCIRPDLLITESTYGSITRDCRRVKEREFLKAVSD
FT                   CIARGGRVLIPIFALGRAQELCLLLDGYWERTGLEIPVYFSSGLTEKANEIYKKFIGYT
FT                   NETVKRKIFERNVFEYKHIKPFQRYYMDNKGPMVLFASPGMLHSGMSLRIFKEWCEDEK
FT                   NLVIIPGYCVRGTIGEKILNGAKRLEILGEEKDIKLEIKNLGFSAHADAQGILSVIEQC
FT                   APRNVMLVHGERSRMKQLKKSVEERFGIPTFLPPNGTLINIPSKNIVNLKIRKGHLSSH
FT                   FKPNLSKGKISLRMSLSSKKEENHIDVVDCEDYIEDDG"
FT   gene            <171112..>172761
FT                   /locus_tag="Eint_101310"
FT   mRNA            <171112..>172761
FT                   /locus_tag="Eint_101310"
FT                   /product="hypothetical protein"
FT   CDS_pept        171112..172761
FT                   /codon_start=1
FT                   /gene_family="HOG000149795" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101310"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1360"
FT                   /db_xref="GOA:E0S9S1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S1"
FT                   /protein_id="ADM12456.1"
FT                   /translation="MEKEDFRWFEGDGETEAEEFVPAPNRVSSVSYVIDAIGGIFYSIF
FT                   VLSLVARVTTYVFGLKLLVFSVDLNVVFLSITVVSLLFIVLAIARETMTFMALTLGMVE
FT                   NSDACAKLQRLVMVSVWFGLSAYWIKYVGTAYGHNFYIIKKVFMSGMITSAAYSIVTIA
FT                   MAYFESFFLKKTLKRKLDDVQKTERIVYAMKNYRYDISESGGGPTPECTCRDLFCFRTA
FT                   ATVGSRETGRNGGEEGFHMFTGGLLINAPEIRGIMDAKTLARDVFFKASGGKDVLSYED
FT                   FSAIFPGAQDAQNAFSFFDSNHSKVISKKEFHDTTIYFYMERVNLEKAIMRAEDFIGII
FT                   LGTLNVITGVVLCFVYLMIFGVPLQELFALILSGSLAFSFIASGIATDMYHNFMMLASH
FT                   PFDIGDDVIIDGADYRIYEFGLTSTSLIGENGGKVKLLNSDLRKKNLVNMTRAPEKIIV
FT                   FNFDLNPDIRPEEFKRFKSIIHEFIKQKPFDYDNEFSLQASTENFVSIDVLSCTMILKC
FT                   KSYKNKSKKFLLRVEMTSFLRSLIAEMGIGVK"
FT   gene            <172826..>173791
FT                   /locus_tag="Eint_101320"
FT   mRNA            <172826..>173791
FT                   /locus_tag="Eint_101320"
FT                   /product="inositol polyphosphate-5-phosphatase"
FT   CDS_pept        172826..173791
FT                   /codon_start=1
FT                   /gene_family="HOG000149253" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101320"
FT                   /product="inositol polyphosphate-5-phosphatase"
FT                   /note="similar to ECU10_1370"
FT                   /db_xref="GOA:E0S9S2"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S2"
FT                   /protein_id="ADM12457.1"
FT                   /translation="MLVTVFSWNVNNREGVADAIPEILGDQKSDMILISLQEHFDSQST
FT                   VAKSIQKMYPSYRMISVDRMFGLLSIVLSKERHTVERIKMGFGILGFINKGVCVTKISN
FT                   GIMFISCHLSAHQENNKKRLKEIRRIFECVCDSESVRNVKTVILAGDMNFRIAGGSRSL
FT                   DYLKSGKDDQCNEFKRAYPMFLEGMIDFKPTYKYIAGTDELCKKRHPSWCDRVFVSSSY
FT                   VKFNTYDSAYEVKISDHKPILCALEVSDKKTSRAAIPMIGYSGHHVIRGLTRFYCIVHE
FT                   YRNAVSALLLIIMLYLMLSRFKTISRLRNPFRVFYPEADC"
FT   gene            <173832..>181073
FT                   /locus_tag="Eint_101330"
FT   mRNA            <173832..>181073
FT                   /locus_tag="Eint_101330"
FT                   /product="ubiquitin-protein ligase"
FT   CDS_pept        173832..181073
FT                   /codon_start=1
FT                   /gene_family="HOG000149252" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101330"
FT                   /product="ubiquitin-protein ligase"
FT                   /note="similar to ECU10_1380"
FT                   /db_xref="GOA:E0S9S3"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S3"
FT                   /protein_id="ADM12458.1"
FT                   /translation="MEERFEWRWMGSPLEEKLHEYIRSMVEEEDLDCLAKKITAYFDIW
FT                   PFKEFSLRCWRILSDKLIDIISSLEKKYFSEGIQMFKMSEEDKSLLIGIFKLFQRIFGY
FT                   SRQRHPLDVSTQVMKFIYAMDLDVVIEAHKMLVFCLNYSIGLDEFSDDHDILFKCLGIN
FT                   SELNGEKILSLSEKAFVSIPKDLEGEDVFWTLKKNVDEYGRGNLVFELRQRINNENRDG
FT                   LNVLKVLGTCIFLILAKGEGAFDEIVEKIDFGEIWRFAGEELSENMEFAIMNLLDILIY
FT                   DEFDFGRISRILELSNTKGFFYKRFVNGFDEWTFERHMVFLIYNTLVGSQKTKYLKMNV
FT                   LMEVLPKFHECSPDVRYHFLRTVRMHCKETNSRGTAEFISRNGVGILTEYLRHAEKYDV
FT                   NENVNLKYSLKILSEIYMDERNRGVVGNFEDSPFLDVIVATIQKLCLFDSRIVSVCIGI
FT                   LSSFMFEEPLNLPIFMERGVNVVLKTQLSVEHTLEYVSAFVSYIDAFSLNLSFQKEISH
FT                   GEYLFKLLVLCREEEFLGSMSNTNKMVSLLNVLIMHHPIFKEDILKFYRFEIGYLKNLF
FT                   SEESSSLLVEKEYCIEIFNNFFSLVEKMEVYPEEKDADGFFNNVFDLVTNPAYSCNMQN
FT                   FFKGSFGEVYRTIYRESRTSLDKPFEQLISDTMKIIELSRMSEEQDTRDWKKAMKMEQW
FT                   CGAEADELIFSYESQISLACILCEDFMELIDNGVKTRLFKAMADLYLMLIRFSGAFISI
FT                   SNFEEHRFLSTYRSIRLKLEESTTKESIRLHLLQSVYLCNLFLLQRMYLLEIKDSFDKT
FT                   LELVERLVEVMALEGDDSITLGLRAIERLSKNFGKEHYEAISREWFIKSLLKPHSRSDR
FT                   LIAVINFLSSQLSSKINSDPKLRSMLLEYLEEIDISVSSDLRKVELSNMVIEAIGRIFG
FT                   DGGSLSDDEMEMIFRIYERFYISPLCSRLMIKRMIRLPRFTMRLVRIKAFPTFQYFLMK
FT                   DEKVYEHACFIVNRFFEYSDEFIEMASNVLLFGTVGRCPHRIDIKEIGKKISGLVMSEV
FT                   SSPKVLFFLIMYFRLLHRLGMPRHCGFDLGKLISRVKTCDEMTLMRILISYIITPDIDS
FT                   ILERSGIPSRRIRSKDREFLKSHDFLIYRDYDLFVEKCLKKSGLGPIDGICFKHGCNRT
FT                   FSLKGEEISVSDKEIDCSKTFIRKLVLLLDTQEYFGMVIQLLCEMMFNHPSLLHDICRY
FT                   QVLDIVYERCIRKMDVSSKHKVTGELHWGIMLFVIGLYSEVLLSKSSTGSEKKSETEQE
FT                   NTRKSLPSVSDFLLEKIKDGSNEDFLNVSFILVRSLTPLFILRHEDEEDTTMERFREIS
FT                   IFMGSVGIFEKIIKRIIAVDESDPKYITCIQCSLDYLGRVFRHCYGDILQDLDDYGDDE
FT                   SREIEYYSLVSEDHGFEESIFDSDESYFFDDPPFHEIEEERAMESDEAESSSQSENTVF
FT                   IKSIENDHEMPTEMYLISSEYYNISAESRTEIEALMCRKLYVDLIDSSTSCYTWMVNNF
FT                   QKSIVCELREPSVHCKEPERSLNEDDKDEGYVTDGEEKMIWNFEPTNDEDNLEDTNEAL
FT                   DTSNPPDREEIEEENEDVGSSESDVGSQNGEIPTLDPDNLNRMEEDELNEVLKAYFDER
FT                   RSLSLTYIPLHTGFYERLSSRVRPMFEEMERVYRESFFYDIRTESTKESDEEIMETKEN
FT                   LLEMDLSTFEEFIKKSIVEKDFPFAKSWKLVDALSKDTKMKSVVFKVSNSMISSISSSQ
FT                   EGDLNNYDAVKFRRTLCFLLSIVKSSIRYYGYFRENPEIVRKVFILLGKVKLTNDLLRL
FT                   VTDFSVIFRKDKDFVFGQDIDLENILGCFGRMVDSECFNLLEEFMENTADHFGPRFLDI
FT                   ILVEIKQQFSILSKDIGKEFPSDAFLESQKIFLRLWKMMTKVIGRSNLCSEERDIALLS
FT                   LMLNPLWNVFFENQKNKESIEDLINVSDIYEAFFVVGKVFENRFGETENTGCAEMCNKF
FT                   QTFYKKIIELRAKQINLLADERPEKLFRNFNSLISHSILTFSNKKKYLSRMLSVEGVDK
FT                   SSSFYRVYVDRNDVLRSSYFQVMAKSPEEFRTRRLEIKLTGEEGLDYGGLTREWLVLLS
FT                   KDFLDPNFALFEFSTEDKTVAVPCKNSYVNPEHLSYFKFVGRIMAKVIMDGNFINLYLP
FT                   KFIYKHILGKSCDLQDLESADPEFHKSLVWIRDNSVGKSLGLTFSFDDVSFGVHRTVEL
FT                   VKGGANIFVDDSNKEEYIKLATQYRLFDGVELQLSALKSGLFEILGNRALEMFDENELE
FT                   LLICGIPDIDIDDWKSNTLYYGYTESSKTVIWFWKAVKSFDSVNRARLLQFVTGTSTLP
FT                   FEGFSHLQGNNEIQKFSIHKISDRTDSLPTAHTCFNQLVLPEYSSYESLLKYLMLAINE
FT                   CSTGFGFI"
FT   gene            complement(<181095..>182582)
FT                   /locus_tag="Eint_101340"
FT   mRNA            complement(<181095..>182582)
FT                   /locus_tag="Eint_101340"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(181095..182582)
FT                   /codon_start=1
FT                   /gene_family="HOG000149793" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101340"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1390"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S4"
FT                   /protein_id="ADM12459.1"
FT                   /translation="MMPEIPSILPKLKKCAELSREIESQANTLSSLMERLQLSAVDGFR
FT                   PYINPKKNISRLLTFLDSFMSTKEIIEEEKSKLGEVFGESEKRFLPRDLKLLQEKKAIE
FT                   STRRLIDMGEVLKEYKGVKIVDTEIDILDDFVKRAIDGIEESFFVSLKRVPEYKPEFRV
FT                   FATFLLSNGNERRFISKYTDTVYSTLGFDDIGMNTELLIERTSHLDKFLLDVIEMNDNV
FT                   LGKENSKITNIGLLKMFVIGLKRAIADNLLKMEKEEDIANIGLLIILDSQLKYSGDKRI
FT                   RVVEELFVFKDSIHKIMCNSILKYFEDLDMIMEPNKYCNTEELCMKMEKALEAFYDNKD
FT                   VSKVFASEYGKDFELETVQDIFEKFSTKTMEKILFLAETLRGIPKSVYVVNNIYIFRNY
FT                   LKSLEGIPIEKMIEINVEDILNVWKKEISKRTEEDITFFLDKNIENQSRYRLPTELGEK
FT                   LAADIQNLVNDALKDKKYTGNTEKLKESISKLYQDSK"
FT   gene            <182703..>184388
FT                   /locus_tag="Eint_101350"
FT   mRNA            <182703..>184388
FT                   /locus_tag="Eint_101350"
FT                   /product="hypothetical protein"
FT   CDS_pept        182703..184388
FT                   /codon_start=1
FT                   /gene_family="HOG000149792" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101350"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1400"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S5"
FT                   /protein_id="ADM12460.1"
FT                   /translation="MVDFGASKKTLLTGFILMAYSDILNNRTYDLVGVDQGYTTFKGYH
FT                   YNAEKDMYDEVFSHKHKEKIHLVIPADFTGTGNVSYILVSKKGPEKFNIYIYFRDYDES
FT                   RYLGESITVPLLYACPDDLRPQLLVQYSDGLKKIRIDESGNMIKEPADEYGKLHKEHTS
FT                   AFVEVDGSMKACLCLVLDDGHGGRLLRILSNRNGEFINYFEMKLPDEIGPIVFGDFNGN
FT                   GMNDMAFVQKNGEKYLLKIYFNTTSRVGDGDKRLLGGFLPHQIDSTIFSEGNMKVIDLS
FT                   EEFPNCTPVIRSEDHFEGLPYGIFNADLRAKGRQDFFIIMKDIDSSIRIGVLENNSNPD
FT                   DIRLGKAEYNEDIFGLKNIISISCCDYNNKGREAVFLNRVVDNNAVVEAYKNDLSKENL
FT                   KLSLSTIHPGLQKYGSVVPGVSYLVSYGDGERIIISNQTPYSTFVHLKHQVAYIGLGTM
FT                   NLIVDSLMIGTPGKNGSPYAGPYVIDSIAIPNTDLVVYLEENEKYTVEAHFIVGDHFKT
FT                   IIGTLLIVAGVNLAFILLLQYRDRRRIIKAKNMDKLHPLFSTLQ"
FT   gene            complement(<184459..>186012)
FT                   /locus_tag="Eint_101360"
FT   mRNA            complement(<184459..>186012)
FT                   /locus_tag="Eint_101360"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(184459..186012)
FT                   /codon_start=1
FT                   /gene_family="HOG000149791" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101360"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1410"
FT                   /db_xref="GOA:E0S9S6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S6"
FT                   /protein_id="ADM12461.1"
FT                   /translation="MKERHRILLLSGLILFSFYFVYDIPSALSHHMDFGSESGIEYKIT
FT                   LLYSVYSLPNIIVPVFFGWITHVRKSTMAKLLCAFVFLGHLIFTIGVWNHSFKIMLIGR
FT                   FFFGIGGESFAVIQNKLISYEFKGKELGFAMGIFSCIARMGTVANFLVTPFLADYIGKM
FT                   FPCVVGIFLTLLGLWVCLRINNSERSHKVLKQKLIELQKNGFGDEVQEEKMYPGEGFLE
FT                   ESDSGFLLKASDPTPRDASNSLSIPENPFFYDYKESKPKELLQTDPILFENPFSPWKAD
FT                   GKETTSIKSRLEKGKPKVLFEESGILFYEPRLEGKNTHHSAFYVLVGMSFLFALVWAPF
FT                   YTIAPMLFQKRYGLSPVSSGNVLAIIEGISLVLVTFTSAITDAYGLKLWLIGAGCILFL
FT                   LGHLGIFFNFLSPYASATFLGFSGPLIACYWPCIPSLVSEESLGTGFATIYCILNLAFT
FT                   FSPIAVAFLASGDYSYDNVEIYILSVGMLAFSLVGLLFYLNKKQSLGLNRKTLTEMETE
FT                   "
FT   gene            complement(<186137..>187342)
FT                   /locus_tag="Eint_101370"
FT   mRNA            complement(<186137..>187342)
FT                   /locus_tag="Eint_101370"
FT                   /product="26S proteasome regulatory subunit 6A"
FT   CDS_pept        complement(186137..187342)
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101370"
FT                   /product="26S proteasome regulatory subunit 6A"
FT                   /note="similar to ECU10_1420"
FT                   /db_xref="GOA:E0S9S7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S7"
FT                   /protein_id="ADM12462.1"
FT                   /translation="MSLEELEMMDQSNPEEFLEKVREKIRMLNSETRILQSRVNTIKHD
FT                   ISTKNASIAENMERIRLNKQLPYLVGNVVEVLDNQSAVVNASTRMSSYLPITGLIPNSE
FT                   LRPGDLVALHKDTNIVFEKLPPDYDMKVGGMVLKSDAKPDETYEDIGGLERQIEELNEA
FT                   IVLSLTHPERFEKLNIKPPKGVLMYGPPGTGKTLMARACASKTNATFLKLAGPQLVQMY
FT                   IGDGARLVRDAFALAKEKKPTIIFIDEIDAIGAKRSDSDQTGDREVQRTMLELLNQLDG
FT                   FSSTEEVKIIAATNRVDILDPALLRSGRLDRKIEFPLPNALGRKRILQIHARNMSVRDD
FT                   VNFDELARSTEGFNGAQCKAVCVEAGMAALRREKTEISQNDFMDGIQEVLSRKKSKLLY
FT                   FT"
FT   gene            complement(<187414..>188622)
FT                   /locus_tag="Eint_101380"
FT   mRNA            complement(<187414..>188622)
FT                   /locus_tag="Eint_101380"
FT                   /product="bromodomain-containing transcriptional activator"
FT   CDS_pept        complement(187414..188622)
FT                   /codon_start=1
FT                   /gene_family="HOG000149251" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101380"
FT                   /product="bromodomain-containing transcriptional activator"
FT                   /note="similar to ECU10_1430"
FT                   /db_xref="GOA:E0S9S8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S8"
FT                   /protein_id="ADM12463.1"
FT                   /translation="MDSVETNLFGLERNQTWRNEKEMLYAKFKNGELKAVVVSSSDPCV
FT                   DKILLLRTKYLFQNQLSKMPGEYILRQVFDTKHANLVLLNSVGEVVGGICYRPFFERNF
FT                   VEIVFLAVDYDFQVKGIGGFMMDLFKEVIKEEIRSYFEKPSNGLSGSPKQKNRVIEDLT
FT                   PLLCRTPESNAPSLYLVTYADNFAIGYFKKQGFTTEIRFGGWIGFIKDYEGGTIVECCV
FT                   LWEINYLKKQEIIQDRKRKLFEEMKKVNEYHIIRKIDDYSEIKDVNDIPGVLNARYSAE
FT                   ETNDQRCQDRFISYLISDLCINAYAWPFLKPVDPKEVPNYYKCISKPMDLSTMSSKLKN
FT                   NEYKFIEAFVEDVNLMVNNCFTYNGKDTQYYKCAQKLLNHFNRRLEFYKHVVDKLPKKK
FT                   EIN"
FT   gene            complement(<188657..>189355)
FT                   /locus_tag="Eint_101390"
FT   mRNA            complement(<188657..>189355)
FT                   /locus_tag="Eint_101390"
FT                   /product="membrane associated phosphatidic acid
FT                   phosphatase"
FT   CDS_pept        complement(188657..189355)
FT                   /codon_start=1
FT                   /gene_family="HOG000149790" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101390"
FT                   /product="membrane associated phosphatidic acid
FT                   phosphatase"
FT                   /note="similar to ECU10_1440"
FT                   /db_xref="GOA:E0S9S9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9S9"
FT                   /protein_id="ADM12464.1"
FT                   /translation="MTREMLAITIVSIGLLFLSSTVEPYERPFNVNDRSISKSYLYHDT
FT                   ITFVEIAAISILAPLGIMFGTFRINIVKRVDEIYFYMSFLVACLFTSAIVENMKNVVGR
FT                   LRPDFLDRCIPVGGKCTGDPSIVMEGRKSFPSGHTSIAACGFMFLAFFIYKELSLPELR
FT                   AKVNRGIVFMLYSLFLMVPIAVGASRVIDNKHFASDVVGGGIIGALAGIARLKHLETTI
FT                   VAERYKRNEG"
FT   gene            complement(<189430..>190038)
FT                   /locus_tag="Eint_101400"
FT   mRNA            complement(<189430..>190038)
FT                   /locus_tag="Eint_101400"
FT                   /product="proteasome subunit beta type-6"
FT   CDS_pept        complement(189430..190038)
FT                   /codon_start=1
FT                   /gene_family="HOG000091079" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101400"
FT                   /product="proteasome subunit beta type-6"
FT                   /note="similar to ECU10_1450"
FT                   /db_xref="GOA:E0S9T0"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T0"
FT                   /protein_id="ADM12465.1"
FT                   /translation="MFNKKEMTGTTIIAIKYDDGVLIGADSRTSMGAYIPSRVTDKLTP
FT                   ITNNIFVCRSGSSADTQMISEYLKMYLTLYSHLESSIPLVQRAATLASKIIYENPSLLA
FT                   GLIVAGYDDKPRIFNISLGGTLVECDWAIGGSGSAFIYGYCDVNWKNGMSLEEGIGFIK
FT                   NAVSCAINRDNASGGCIRMSAISRNGVQRYFYPGDKVLQ"
FT   gene            complement(<190111..>192201)
FT                   /locus_tag="Eint_101410"
FT   mRNA            complement(<190111..>192201)
FT                   /locus_tag="Eint_101410"
FT                   /product="glutaminyl-tRNA synthetase"
FT   CDS_pept        complement(190111..192201)
FT                   /codon_start=1
FT                   /gene_family="HOG000259233" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101410"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /note="similar to ECU10_1460"
FT                   /db_xref="GOA:E0S9T1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T1"
FT                   /protein_id="ADM12466.1"
FT                   /translation="MLNLEEVFEKLEISSEKRHEVMKKEQVVKNMEKIFSGRSFSNRLL
FT                   YTLACTASRNANVELLANLIESGTIKNESMLKECLKHMGKKEVSAEEMVSFVKSNEVDE
FT                   ESIKNNIAKMRREGLSKKDMLSKARNTMPCADFRIVMEEINKIPDDVEEHEENLEGGDW
FT                   LEEGEIRKLPKPGETPQVSEEIRQAHLKRTGGRVVTRFPPEPNGILHIGHAKAINLSFE
FT                   YAKKFGGYTYLRYDDTNPKNEEVEYFDSIYEDVRWLGFEPYKVTASSDYFDKMVEFGFQ
FT                   LIKKGKAYVCHLSQEEICERRRQYTSDNMNERSHLSQYRNRSVEENLRIFQEMVDGKWE
FT                   EGTACLRFKMDTNTKNPLMLDLIGIRILNAVHPMKKVRYTVYPTYEFALCVSDSLEDVT
FT                   HSFCTREFFTRQESYHWLLDQLEIYKPIQWEFSRLNISNTVLSKRKLVPLKKYGIELDD
FT                   PRLFTIKGMRRRGFPPEAINEFCKSLGLTFAETIVDVKKLENFVRDNLNRTSRRIMCVR
FT                   DPLKVTIMNAEPCSVSIPDFPGSEVSRNVPFTPVIYIEKSDFMDKGDGDFLRLTLDQPV
FT                   GLYMLYPIRVVKVTEDGILAERWDGIPKKFIHWVSSDCVRVEMRMYSPLWTSFSPKDST
FT                   YLEEMNKDSLKIVHGLCDKRISEAGVEDRFQFQRIGYFCVDRDTTEENIVVNLTLPLKN
FT                   IV"
FT   gene            <192771..>193262
FT                   /locus_tag="Eint_101420"
FT   mRNA            <192771..>193262
FT                   /locus_tag="Eint_101420"
FT                   /product="homeobox domain-containing transcription factor"
FT   CDS_pept        192771..193262
FT                   /codon_start=1
FT                   /gene_family="HOG000112859" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101420"
FT                   /product="homeobox domain-containing transcription factor"
FT                   /note="similar to ECU10_1470"
FT                   /db_xref="GOA:E0S9T2"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T2"
FT                   /protein_id="ADM12467.1"
FT                   /translation="MGYNLAMTPALFMSRLPNLASSRMNEIRKVYIEANNRIVEEIDAV
FT                   TEKFSKEVETIPNISASVRIYLEEKIRSIREFVVDSIGFSIGEFRALYNPDGNESIKTR
FT                   RFPKFITEALERSFEIDQYPSEAEKSRLAKICKLSTKQINNWFTNKRNRSKSHDGGRQY
FT                   "
FT   gene            <193799..>194368
FT                   /locus_tag="Eint_101430"
FT   mRNA            <193799..>194368
FT                   /locus_tag="Eint_101430"
FT                   /product="TALE/PBX transcription factor"
FT   CDS_pept        193799..194368
FT                   /codon_start=1
FT                   /gene_family="HOG000112861" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101430"
FT                   /product="TALE/PBX transcription factor"
FT                   /note="similar to ECU10_1480"
FT                   /db_xref="GOA:E0S9T3"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T3"
FT                   /protein_id="ADM12468.1"
FT                   /translation="MNMIMDILNQVMYAEECYFSNRVSREKLMEDIRRLRSEYEIGIMR
FT                   DSGREGIKFKMALLFILRRVRHKIILEDRLMEMIDSEVAFVRGCVSSIISEPFGVKPVE
FT                   TMRPTQQEAETRCAKPRTRANFPMDTSQLLRSWLKENMDNPYPSDAEKAYLCQKTGLGP
FT                   AQINNWFINARRRILPFMKGKRASFK"
FT   gene            complement(<194690..>195838)
FT                   /locus_tag="Eint_101440"
FT   mRNA            complement(<194690..>195838)
FT                   /locus_tag="Eint_101440"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(194690..195838)
FT                   /codon_start=1
FT                   /gene_family="HOG000149789" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101440"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1490"
FT                   /db_xref="GOA:E0S9T4"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T4"
FT                   /protein_id="ADM12469.1"
FT                   /translation="MEREFDFIIYGASGYAARYIIEAFKAENVRLALASRNISKIKDKA
FT                   FPVYECKIDNIDEIASMTKVLINCVGPYSIHGECIVKSCIRNGTHYMDISGEVYFFELI
FT                   INKYHDEAVRKGVYIINCCGFESVPSDIGVMYLRDMFEYYVEIESVLKVSNVVVNLTTW
FT                   ESLLASVANFREMNALREKRYGQGKKRRSLRVVKKNSYQVIFRGIDYSVVRRSQELMES
FT                   IGINGAKYSAYLDVGGRIEMIKYRILAWVIWLFSGFSFGRWIITSLAKMFAFRTIKRRP
FT                   SFEEIRNADFTIEIRARGEKGNEIVGKLLTITGPDPAYIVTSVCLTQTAVTFLRSLNQK
FT                   ERGTGVTLFRGGVITPACVLYNTDIIPRLSSKGIKFELKESS"
FT   gene            <196095..>197474
FT                   /locus_tag="Eint_101450"
FT   mRNA            <196095..>197474
FT                   /locus_tag="Eint_101450"
FT                   /product="hypothetical protein"
FT   CDS_pept        196095..197474
FT                   /codon_start=1
FT                   /gene_family="HOG000149788" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101450"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1500"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T5"
FT                   /protein_id="ADM12470.1"
FT                   /translation="MSGKKEKEVGTPISAEGSNGEGEESFESDVMKHVIGAACMLSHKS
FT                   SDEDVTECSEEKISTFDVYIVNEDGKVNGYELKHIGPAGGVECSNSPQSSPSNEMIRSR
FT                   SFHFDRKNKGLPPQEFYRRKKSSEQLPWKINGNCSNGSKEKCEPIILEISEISDGYSVD
FT                   GTDEHQDINASVCSQDTGSSKISLKCENETSNTFVDLNFSNRQETSEKSDCRGLQSDKG
FT                   SQDEILLPFPSQDKDYTSSGSASPESRNGPSRNSDLEKIALSIVKITEPGESGKEKEHE
FT                   SDAPKAMGNIIKAIQAQESEDKLVINQKIGLNSPCPINEEKCLGEDAMMTSEDLSRELK
FT                   TALLAAFIPSMETSEMSETSEKSFVETSITRNIGGKPDSTEEVEKFRTVLNIGDSVPPL
FT                   LDVKDLAGKKGKDDEMIIFVEAEDIGKKRNVATRNNRVGRLVKFFESLEERNKERDPKE
FT                   E"
FT   gene            complement(<197554..>197910)
FT                   /locus_tag="Eint_101460"
FT   mRNA            complement(<197554..>197910)
FT                   /locus_tag="Eint_101460"
FT                   /product="putative zinc finger domain-containing protein"
FT   CDS_pept        complement(197554..197910)
FT                   /codon_start=1
FT                   /gene_family="HOG000149787" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101460"
FT                   /product="putative zinc finger domain-containing protein"
FT                   /note="similar to ECU10_1505"
FT                   /db_xref="GOA:E0S9T6"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T6"
FT                   /protein_id="ADM12471.1"
FT                   /translation="MLPKLNVPTRLNKSYLLEYRVHKIVPKTTPKPREVERSASNYRTI
FT                   LCKFFLMNSCKHGDNCTYSHDTSKFPCKAFHIKGNCTRKDCPFSHEPPTDKEMEEIISE
FT                   KQEESTSFFKSTLL"
FT   gene            <197986..>199044
FT                   /locus_tag="Eint_101470"
FT   mRNA            <197986..>199044
FT                   /locus_tag="Eint_101470"
FT                   /product="mevalonate kinase-like protein"
FT   CDS_pept        197986..199044
FT                   /codon_start=1
FT                   /gene_family="HOG000149786" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101470"
FT                   /product="mevalonate kinase-like protein"
FT                   /note="similar to ECU10_1510"
FT                   /db_xref="GOA:E0S9T7"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T7"
FT                   /protein_id="ADM12472.1"
FT                   /translation="MDPKIEFRVPGKVIVNGSYIVLEGETCRAIALKEYMISEAIRMES
FT                   SKQKIVVEVEGQEKITYYHNRSDLPEDKGKSSYYLLKVVDSFFEVTGIIPKNQIQIRMK
FT                   AGNGFFVNGPTSEKTGIGSSVCILVSIVYALLKFHQEDLNQIISLKGFERWGRSPVFRG
FT                   NLESHLGHLSLSKEILNHLLSITYQVHQKTNQGGSGSDAMCCLLGSIYSNREACIPIEK
FT                   VPRYLILGSFGKSTSTREMLKKIDLSDSKWKSLKDMNSRINKERRNPKKLYIEYLNIIR
FT                   NISTAIVPEKQYEILIKTNEYDIWGCGISGAGGDDCVWVLTDDYKSVYEYWQKAFAFTF
FT                   ITEVSYKGICLL"
FT   gene            <199196..>201223
FT                   /locus_tag="Eint_101480"
FT   mRNA            <199196..>201223
FT                   /locus_tag="Eint_101480"
FT                   /product="White ABC transporter"
FT   CDS_pept        199196..201223
FT                   /codon_start=1
FT                   /gene_family="HOG000149250" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101480"
FT                   /product="White ABC transporter"
FT                   /note="similar to ECU10_1520"
FT                   /db_xref="GOA:E0S9T8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T8"
FT                   /protein_id="ADM12473.1"
FT                   /translation="MQEKDLGPIVGYNLELKDIFLEAPNKDLSSSTKYVRLINGISTTF
FT                   ESGKLSVIMGPSGSSKTTLINLIVGIIQENSKVSGNVLLRGKSRNPKTWLTQVAYLNQD
FT                   DCIVPYITIHEYIYFCVSCRTTKKQRGGRSINEIINKVMKKLHIEDLKDVVMTAISGGE
FT                   RKRVMIAVEFAVSPEVLILDEPTSGLDSHLAFELIQMIKEYAVENNKIVITTVHQPGPG
FT                   LFDMFDYLLFLNKGSLVYSGSADQCERFFDSKGIHRVGNLSVSEFLFELFSGQSYISGI
FT                   EEYREAINKMIESAVQEGDLKIENKTMSQISGSVVKLPFSFSKALKIAKRKWIMEWRSW
FT                   RMMRNWIFEIVFLFVYVYFLYPMIFSIEFLNFKNLLNLNINERDETESVFRWLIGSLKS
FT                   MIDESLVGNVDEAIKWEICSFLLITLSLFGSTDILDGLNYVHRETSKATYGISTLYFST
FT                   WIAETPITILKCFVFLGISSSIGIHGGNTFELITYIIVGSLLILAFDIMMRSITSSSAF
FT                   RKFLSMITFIFLTSLTPEISYTFTKILSVPSAGNLRLLKLLKYPSILLWPQIFFQGFMR
FT                   LSFFERVMFPKEPNEKFTFIYKAIMGSIVTPRLYDLHLSDEENREKLLNPQTRFLVDQN
FT                   YSKYILLPLGATSLIIVILLSNYFLVRRFSPRLQLNLSNK"
FT   gene            <201261..>201593
FT                   /locus_tag="Eint_101490"
FT   mRNA            <201261..>201593
FT                   /locus_tag="Eint_101490"
FT                   /product="hypothetical protein"
FT   CDS_pept        201261..201593
FT                   /codon_start=1
FT                   /gene_family="HOG000149785" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101490"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1530"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9T9"
FT                   /protein_id="ADM12474.1"
FT                   /translation="MESLILWDGRSICGLKKIPKTILIVDEYNTITPEKKSKIKDSVAE
FT                   MDIDFEEEATRYSLVILCNTVLRFNLKNPLVLAECEIWFTRKTFSSKVFEDALIHYSEC
FT                   EIRNGV"
FT   gene            <201601..>202062
FT                   /locus_tag="Eint_101500"
FT   mRNA            <201601..>202062
FT                   /locus_tag="Eint_101500"
FT                   /product="ubiquitin conjugating enzyme E2"
FT   CDS_pept        201601..202062
FT                   /codon_start=1
FT                   /gene_family="HOG000149249" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101500"
FT                   /product="ubiquitin conjugating enzyme E2"
FT                   /note="similar to ECU10_1540"
FT                   /db_xref="GOA:E0S9U0"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U0"
FT                   /protein_id="ADM12475.1"
FT                   /translation="MNPREDSSFAAFRLKTEIESIQLLPGSLLNVDRSSEDKYAMEIKY
FT                   SMMITEGIYKNRLFRFKIKIPHAYPFKPPKLLCLDKVFHPNIDDDGNVCMEILRLGWRP
FT                   SHGLESILVNLYVIFVEITGEDALNTQAGDLFKLDYERFVRIARGQERI"
FT   gene            complement(<202078..>202380)
FT                   /locus_tag="Eint_101510"
FT   mRNA            complement(<202078..>202380)
FT                   /locus_tag="Eint_101510"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(202078..202380)
FT                   /codon_start=1
FT                   /gene_family="HOG000149784" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101510"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1550"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U1"
FT                   /protein_id="ADM12476.1"
FT                   /translation="MEASINLWKNSSLKGTLNRIFKEEVHGPLRVLISPNNIGVVLLDP
FT                   KSSYQFVEKTLNKKILKNLDFIVVDGHKASLPFDFVLKEVSEDAKEEYAAIIHKR"
FT   gene            <202419..>202688
FT                   /locus_tag="Eint_101520"
FT   mRNA            <202419..>202688
FT                   /locus_tag="Eint_101520"
FT                   /product="hypothetical protein"
FT   CDS_pept        202419..202688
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1560"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U2"
FT                   /protein_id="ADM12477.1"
FT                   /translation="MDLSGMNRLFEVLDKIKNKVEKEERPPNPKEALERELHKLYLCIS
FT                   LEICKQKLQGSVGKEVLDKVKEIKQYFKHIENIRGKDRNDPVQK"
FT   gene            complement(<202697..>203122)
FT                   /locus_tag="Eint_101530"
FT   mRNA            complement(join(<202697..203089,203120..>203122))
FT                   /locus_tag="Eint_101530"
FT                   /product="40S ribosomal protein S24"
FT   CDS_pept        complement(join(202697..203089,203120..203122))
FT                   /codon_start=1
FT                   /gene_family="HOG000186306" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101530"
FT                   /product="40S ribosomal protein S24"
FT                   /note="similar to ECU10_1570i"
FT                   /db_xref="GOA:E0S9U3"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U3"
FT                   /protein_id="ADM12478.1"
FT                   /translation="MSLELEISGLKENKLLSRKELDVVAYHPGMPIPSREEITDKISEL
FT                   YQTSKKNIVVGNLKNRYGTHRTTLRAKIYSNAEVLSSVEKKHVVAKITGKELQITPRRV
FT                   RKDERKKRYKIFGTIKRAMKKAEKKNK"
FT   exon            complement(<202697..203089)
FT                   /locus_tag="Eint_101530"
FT                   /number=2
FT   exon            complement(203120..>203122)
FT                   /locus_tag="Eint_101530"
FT                   /number=1
FT   gene            <203211..>203426
FT                   /locus_tag="Eint_101540"
FT   mRNA            join(<203211..203213,203250..>203426)
FT                   /locus_tag="Eint_101540"
FT                   /product="40S ribosomal protein S30"
FT   CDS_pept        join(203211..203213,203250..203426)
FT                   /codon_start=1
FT                   /gene_family="HOG000149247" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101540"
FT                   /product="40S ribosomal protein S30"
FT                   /note="similar to ECU10_1575"
FT                   /db_xref="GOA:E0S9U4"
FT                   /db_xref="InterPro:IPR006846"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U4"
FT                   /protein_id="ADM12479.1"
FT                   /translation="MATITINKAGKVRNQTPKDPVVEKERKKCGRCRQRLKFEKRNEMG
FT                   YFDVMGKMKLNPQS"
FT   exon            <203211..203213
FT                   /locus_tag="Eint_101540"
FT                   /number=1
FT   exon            203250..>203426
FT                   /locus_tag="Eint_101540"
FT                   /number=2
FT   gene            complement(<203595..>204005)
FT                   /locus_tag="Eint_101550"
FT   mRNA            complement(<203595..>204005)
FT                   /locus_tag="Eint_101550"
FT                   /product="small nuclear ribonucleoprotein D2"
FT   CDS_pept        complement(203595..204005)
FT                   /codon_start=1
FT                   /gene_family="HOG000149246" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101550"
FT                   /product="small nuclear ribonucleoprotein D2"
FT                   /note="similar to ECU10_1580"
FT                   /db_xref="GOA:E0S9U5"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U5"
FT                   /protein_id="ADM12480.1"
FT                   /translation="MFLPNNPDNPGEKESMEMKGPLSLVRRAMVKMIPVLISLRNNRKV
FT                   TGKVVAYDRHYNLLVREAREFGTARGRNKGRKKRQGSEFSRKLGNVFIRGDTVILVAVG
FT                   AEAEEPEKNSMENDEKKNTDLTQEECQTNSKV"
FT   gene            complement(<204063..>204899)
FT                   /locus_tag="Eint_101560"
FT   mRNA            complement(<204063..>204899)
FT                   /locus_tag="Eint_101560"
FT                   /product="choline phosphate cytidylyltransferase"
FT   CDS_pept        complement(204063..204899)
FT                   /codon_start=1
FT                   /gene_family="HOG000230945" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101560"
FT                   /product="choline phosphate cytidylyltransferase"
FT                   /note="similar to ECU10_1590"
FT                   /db_xref="GOA:E0S9U6"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U6"
FT                   /protein_id="ADM12481.1"
FT                   /translation="MMKRNDTEKYKMMAPTYPDRNTFEYEEMTSEVGMYKVPVNRPVRI
FT                   YCDGVYDLFHYGHARSLKQAKNLFPNVYLLVGVTDDDITIRLKGNLVMNEKERAEGLIH
FT                   CRYVDEVITSAPWELTSEFLQKHRIDFVAHDDIPYKGENKDDIYKFVKDMGMFIPIKRT
FT                   KGISTSGIITDIVRNYDVYVRRNLERGVSAKDLNISFLHMKRIKMSKKMNEMIKNVDIQ
FT                   REIEDIRREIRIAMRYWERVSNEIISGFIENFYHGKTSGRFIDRLVEFVKLKRKNE"
FT   gene            complement(<205019..>205630)
FT                   /locus_tag="Eint_101570"
FT   mRNA            complement(<205019..>205630)
FT                   /locus_tag="Eint_101570"
FT                   /product="putative meiotic recombination protein"
FT   CDS_pept        complement(205019..205630)
FT                   /codon_start=1
FT                   /gene_family="HOG000006783" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101570"
FT                   /product="putative meiotic recombination protein"
FT                   /note="similar to ECU10_1600"
FT                   /db_xref="InterPro:IPR005647"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U7"
FT                   /protein_id="ADM12482.1"
FT                   /translation="MATVKMKADQKKSILLEIIRTSKSFFKLQELETLGSKKGIVVNTI
FT                   KEILQQLVDEGLVTVEKVGTSNLYWSFASEGVQKKKLKCKELMDECKRMSEDISNKRKH
FT                   LEDERKSKNYTEERSRLEERLNSLEKMEEEQKKELKKFEETDPIVYDKLIGDRKKVIDE
FT                   YNKIVDNIFVIQDYICNKFAMEKSEFNSSFGIPQDLDYIQ"
FT   gene            <205701..>206966
FT                   /locus_tag="Eint_101580"
FT   mRNA            <205701..>206966
FT                   /locus_tag="Eint_101580"
FT                   /product="hypothetical protein"
FT   CDS_pept        205701..206966
FT                   /codon_start=1
FT                   /gene_family="HOG000149782" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101580"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1610"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U8"
FT                   /protein_id="ADM12483.1"
FT                   /translation="MMSLELTKENINAVSLELVKNKKMFDKNVNYVMGFMLKSFPEKNE
FT                   LLSRIKVLNIKSRSAKKIDPESDVMEQIAMNVFAIKNLDEGSFTKNMLALFRDPSSFSQ
FT                   AFLTYFYSNLNLSTTKTDEILNGLVELLLSESKLKKSFMNFMNSIELSEDSESISLEEA
FT                   KSLHKASDDHTFEKIINKESYDESSSTVMSLVSLDDSEEIKRIDTSISLLFEGKREKMS
FT                   MLSILVCTRVLNIIRIILENNYPRDVDVIPVLMYIAEIDQTIFKKSMSAIKIILRKTDY
FT                   RDKEKLFEMFCALLERNPGIIRMAMLFVDTCGKHFNWPRFLEIIDGNEEIDLDVVDRSY
FT                   IPNSSFYEFILFAEDPRRYMKTIKSMIRNELDSSLLRDLKEKINGRPDLKDIKPIKDAI
FT                   SSRLKLLSQKKCSKKERKDNSN"
FT   gene            complement(<207016..>207930)
FT                   /locus_tag="Eint_101590"
FT   mRNA            complement(<207016..>207930)
FT                   /locus_tag="Eint_101590"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(207016..207930)
FT                   /codon_start=1
FT                   /gene_family="HOG000149781" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101590"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1620"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9U9"
FT                   /protein_id="ADM12484.1"
FT                   /translation="MDEFVSLLKALKKNDKITQNVLLMISESFRYNEEAVSDALIKNHR
FT                   SLLGKEAVLDFLFLLCSKDTRYLSLFEKYKDEFNRNHKIFKLLSGESQEEKPKRPRIDE
FT                   ESSSSSEDMIKASINERNTLIDEEGETDSKPKEVASKKTSRSVLEEARTKNLWDKKEQE
FT                   SDILNNEYLKTEMDPSILYYPNQCKLCGLRYKDTPEGDEQMGVHIDEHRRKARVLGEKD
FT                   CISREFFPTLEAWTKNIEKIKLRLEVEKVEKIVHSGGPALCDVCRSRIEVEWDDQEDRW
FT                   ILKDAVSLEKGGRTSFCHRKCVS"
FT   gene            complement(<207994..>209163)
FT                   /locus_tag="Eint_101600"
FT   mRNA            complement(<207994..>209163)
FT                   /locus_tag="Eint_101600"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(207994..209163)
FT                   /codon_start=1
FT                   /gene_family="HOG000149780" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101600"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1630"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V0"
FT                   /protein_id="ADM12485.1"
FT                   /translation="MIIFPEEKPTKYLNDSFALKMLGAPKYNGKFDFSRKELDIPLAFP
FT                   FRKTAVKSKSPPQVAFMEKIDNDSVIYSSDGHFFNVLGKYKYSFRIEDTCKRLVTGHQK
FT                   AFILTEKHMYIYEKKKVSMFSISAIDLSTSSFGEVFVLTSKEILLFDEDGIKKVFPYTG
FT                   RVNFIHFYLFRELIVVGVKQVFHLNLNNLKVSTIYSTPLRIQLTILKDRLYIQEGTSKG
FT                   FRVTSLNIEDRTAESIFLEDFMKISVGKSMLALYKRGGEFLFCDRFDLINSKTVVYEVE
FT                   NLIGFFFVEEKSYFFFKEKFVMWNKGCVKEIKIGLEKNRNYLVKFPDNLEMLKEVYETR
FT                   QTPKGVFRPGKVVSTLYEIIKQITEKEDESVKSMPKKKIKYSEKNLGGF"
FT   gene            <209295..>211634
FT                   /locus_tag="Eint_101610"
FT   mRNA            <209295..>211634
FT                   /locus_tag="Eint_101610"
FT                   /product="putative DNA helicase"
FT                   /note="involved in mRNA decay control"
FT   CDS_pept        209295..211634
FT                   /codon_start=1
FT                   /gene_family="HOG000205990" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101610"
FT                   /product="putative DNA helicase"
FT                   /note="involved in mRNA decay control; similar to
FT                   ECU10_1640"
FT                   /db_xref="GOA:E0S9V1"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V1"
FT                   /protein_id="ADM12486.1"
FT                   /translation="MKCQYCEVEELLIECVGCGKHFCNSRSASSISHIVFHLVKAKHKS
FT                   IRIGGDIKCRKCGEDNLFKLLENNGKIFCNGCSSGRMVVEERCLTIIKSPEVQGKRLTK
FT                   QQMAEMEEKSMASLPYVKSRFEAKEYVEVFSSLIEAECKKEREIKESMRQENVFVRWEK
FT                   LKYCYFYFQNGDSELKINIGDEIRLTHKSGFVLHGFVSGETFSEELKVEIETPGDYPRS
FT                   GYTVEYLWRGICYERMEWALRKLYNTYKKETDKIKRNKNKNDERKPCDKGIDVCRDLSV
FT                   QRPTNRGDIGAMGDEGKMQKGRKSLNEGPSIFEYILKGYKEGIGNSGHIFPVPDLPRLN
FT                   ASQEIAVRAALGRKVTLIQGPPGTGKTLVSSAIVYNLVKHYGGKVLVVAPSNTAVDQLT
FT                   LKIHKTGLRVLRVMSRRRECGQSDVNFLSLHENLKELQEGRKKKDECYGDHNRYNSIYN
FT                   DETNESLKKHLLNQAEVITCTCVTSGQKMFNKFRFHYVLIDEAVQSTEPLSLIPLVYGC
FT                   KKLVLVGDHKQLGPTILCKKVAQAGFKQSLFERLISIGVVPYVLSVQYRMDADLCEWPS
FT                   EMFYNGELLTGGKNFCRFDLGIPTNFFYVCYGREEVSPSGTSFVNQAEALHCESIIRHL
FT                   FKCGVTENQIGVITPYEGQRSYILNRIFGAEPGNLEISNVDGFQGREKDFIIVSLVRSN
FT                   LYQGIGFVGDKRRMNVMLTRAKHGLVIIGNPMTLMRHDMWSNLLSFYDRKGLVMEGPLH
FT                   NLRRVVIKPPKLFDFREISRSLMNQI"
FT   gene            complement(<211737..>213671)
FT                   /locus_tag="Eint_101620"
FT   mRNA            complement(<211737..>213671)
FT                   /locus_tag="Eint_101620"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(211737..213671)
FT                   /codon_start=1
FT                   /gene_family="HOG000149779" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101620"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1650"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V2"
FT                   /protein_id="ADM12487.1"
FT                   /translation="MGDSKIKGAGCTDIQDFSFRIDSLNMNDPENVVWAYRNIQQVYSH
FT                   SAVDFEKMVKIMMGTKLLDFNTSLIVLEMVGNALQDHFEKQKEDEEISFVASKCGLSIS
FT                   SGENKVSTGYIDYLYKLILPFARICTKQVVDIVAFLFTRTSRAEFDELFEMFEKKKDFL
FT                   VELYLLKVRLMRERSLKYKCGRCKDAREMSSLEMEEWIKNMKISSVGELGDDKGVECEK
FT                   KTDFYSIDSAGGGRREDGMEGLPEELSFSQDKPFFESTTSPSNNSKDREEAKNKLEGDT
FT                   LECRPHQRPYEEECHDGVCRCRVEESEDKTCLCASYKPSDESRCLKEAKKYLLDIESVS
FT                   PRFFLENVALYLSLSFDKELLDLFEKYIGTEYEPVCASHIFKLKAIDSGVLEAMIGRMR
FT                   NSKREMLKSDNLPVTDTTFGLYIEWCADTFGSISISSVNDYSNISKLYIKFLRSFPHKK
FT                   MFLILEEICESKIERVSDAVYAHIAEDLEEIVKILLNLFNSTEENNKLSKDEEKMSMLG
FT                   DEKTFKNAKRLNSPEFCIEQELERIVLEVCKRYRKAFLSQIRVLDHFPDNEFLLKISKT
FT                   LCTNYENDWRYRRALLHSYREWPKFFGEILNIDSFTKDPVFIVRRTALDIKEEIDVGSE
FT                   SKIPKKETL"
FT   gene            <214009..>215175
FT                   /locus_tag="Eint_101630"
FT   mRNA            <214009..>215175
FT                   /locus_tag="Eint_101630"
FT                   /product="spore wall protein 1"
FT   CDS_pept        214009..215175
FT                   /codon_start=1
FT                   /gene_family="HOG000154461" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101630"
FT                   /product="spore wall protein 1"
FT                   /note="similar to ECU10_1660"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V3"
FT                   /protein_id="ADM12488.1"
FT                   /translation="MIKLSLLLSLASFTAVLANQRPRCQRCPVSSSKYFQQNNLLGSRF
FT                   QNEVQRLCARRVREESSSESSSSSSSEDCSRRRRRPHREWEDSCSSSYSSCSSTDSCSS
FT                   SAPCPPPVAQRCDIELKTPIILMGERIYEFLKNYEDQYKKAVLLFLTNILSQISGFNPV
FT                   FPGGDYDALIEQLKTLGVTVPANTAAELAAIDAAESSALTRAIQANAQKVISDLLTRVS
FT                   AMCYLDIMSLVNSGLLASQVSSVFNNIQPIITIAGNDLFAKQMAVFQKIPGTLPSAAIT
FT                   AITNALQGNRTNFVTFFTTQTSNLQTSVQNSLTTLISELEKLATDTETAFTAFANAEIS
FT                   ALISRIFPTSTTSSGSGDSTGSGSTGDAGDAGDTGEDGGDDEGTEGTG"
FT   gene            <215371..>216723
FT                   /locus_tag="Eint_101640"
FT   mRNA            <215371..>216723
FT                   /locus_tag="Eint_101640"
FT                   /product="DEAD box ATP-dependent RNA helicase"
FT   CDS_pept        215371..216723
FT                   /codon_start=1
FT                   /gene_family="HOG000112171" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101640"
FT                   /product="DEAD box ATP-dependent RNA helicase"
FT                   /note="similar to ECU10_1680"
FT                   /db_xref="GOA:E0S9V4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V4"
FT                   /protein_id="ADM12489.1"
FT                   /translation="MKFEDLKIDQRIEKGLRESGFVDMKEIQQKVIPMALEGHDIIGSS
FT                   QTGTGKTLAFLVPILQKLTDLQWSGGDGLGCVIITPTRELALQIFDVLSKVGKYTVLST
FT                   GLIMGGLETENESLRLSNMNILVCTPGRFLQHLQENPYLNTGGIQILVLDEADKMIEMG
FT                   FKETLEDILGYIPSKKQTLLFSATPKASTARILRLEDPKIVSMYKEEGFPSQLHQYFYM
FT                   MRMEDKVNYLHTFIGSNPGVKGIVFFSTCKEVKFHYLLFEKLKLRNRIFCLSGGMSQKQ
FT                   RIDTFKKFVREKNGILFCTDLGSRGLDFPKVDVVIQYDCPCNIETYVHRVGRTARNNEG
FT                   GESYVYLVYGEEKLLGDIQKKGWIKKQETESKDEEDRGSSEEIVEGPNIRIKSIDRMIK
FT                   GLIKSNKELNEYCRKYLTTYEKFLTFSSKRYSESIIRKISILYEYFGISKD"
FT   gene            complement(<216778..>218016)
FT                   /locus_tag="Eint_101650"
FT   mRNA            complement(<216778..>218016)
FT                   /locus_tag="Eint_101650"
FT                   /product="enolase"
FT   CDS_pept        complement(216778..218016)
FT                   /codon_start=1
FT                   /gene_family="HOG000072174" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101650"
FT                   /product="enolase"
FT                   /note="similar to ECU10_1690"
FT                   /db_xref="GOA:E0S9V5"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V5"
FT                   /protein_id="ADM12490.1"
FT                   /translation="MKVKDALEEIKPRMILTSRGHPTIEVDLITSKGVYRSSCPSGASR
FT                   GSKEAVVVSDGGKSYNGRGVKTVINNINEVATKSIFELECPVDDLQGIDDCLLKLDGTK
FT                   DKSRIGGNGIIALSTAFCKMGAAYSNRRVDEFLSDIGMFKRKIPIPHFNVLNGGIHSGN
FT                   KMDVQEIMVVYQYDDLEKNIESGCVFYESLKKTISERYGALYTSVGDEGGFAPPIEKLE
FT                   EGLELVLEASRRCKRTEMKIAIDFAANEFLRDGKYHLDGEVYTTRDLGEKYMRILREYP
FT                   QIYSLEDPFSEEDYDGWTWINSEVGNKINIVGDDLTVTNPQLVENAGIRKMCNTLLVKP
FT                   NQIGTVSETINAIKVARRHGMKIMVSHRSGETEDHFISDLSVGVGAEYIKSGAPCRGER
FT                   VSKYNQLLRLNEY"
FT   gene            <218084..>218374
FT                   /locus_tag="Eint_101660"
FT   mRNA            <218084..>218374
FT                   /locus_tag="Eint_101660"
FT                   /product="RNase P subunit Rpr2"
FT   CDS_pept        218084..218374
FT                   /codon_start=1
FT                   /gene_family="HOG000149778" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101660"
FT                   /product="RNase P subunit Rpr2"
FT                   /note="similar to ECU10_1695"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V6"
FT                   /protein_id="ADM12491.1"
FT                   /translation="MKKDFSKHLKYLYITALNMIGIPSLHRRKTKKMKMISNKYQVRLS
FT                   REIKRTLCSTCLSILVPGFNCTSRIVRKENGLCLKTVCGCGSEKIFVAQGR"
FT   gene            <218463..>220358
FT                   /locus_tag="Eint_101670"
FT   mRNA            <218463..>220358
FT                   /locus_tag="Eint_101670"
FT                   /product="dynamin-like vacuolar protein sorting protein"
FT   CDS_pept        218463..220358
FT                   /codon_start=1
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101670"
FT                   /product="dynamin-like vacuolar protein sorting protein"
FT                   /note="similar to ECU10_1700i"
FT                   /db_xref="GOA:E0S9V7"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V7"
FT                   /protein_id="ADM12492.1"
FT                   /translation="MAVMDLLIEKINDLQDICTENNISNRIELPQIVVVGSQSSGKSSV
FT                   LENIVGRDILPRGTGIVTRRPLILQLIYSKTEDYAVFNHLPETKFTNFEEVKKEIIKET
FT                   NRILKSKNDVSPLPITLKYYSSKVLTLTLVDLPGLVRVPTNDQPKDICTKITEICRKYV
FT                   SNRNALILAVSSANTDISNSDALQLAREVDHNYERTIGVLTKVDLMDSGTDVVDILAGR
FT                   IICLRLGFVPVVNRSQQDIERNKSIQQALKDEEVFFLSHESYKRNRAYCGTGYLITKLH
FT                   NILHEHIKQCLPELQERINSGMIDAQNNLRDLGNICLSPKENVMRIINTVSKRFSDILS
FT                   GNIESKGNELMGGARLNYAFNHHFSKFINRLGALDNIHDEQIRALLYNSSGSSSVLLFG
FT                   HVAFEKLARVSVESFKLHSLKLVSIVFSELVRMIKHIVDVSTASRYPVLGERIIACAIG
FT                   MFKERCDATHKLVESFVDWNTGYISTRHPDFIRWNEMLSREMEDSVLERKAEKIDFYKG
FT                   MESKATLDSIPNTLRIRDGLSEQEVIEINMIKSMVESYFEITKKIIVDQVPKAIMCELV
FT                   KKAENSLQETLFMEIYNREDLDSIASESEEVKLERSRIESMLKALKQAYDIICSL"
FT   gene            complement(<220380..>221171)
FT                   /locus_tag="Eint_101680"
FT   mRNA            complement(<220380..>221171)
FT                   /locus_tag="Eint_101680"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(220380..221171)
FT                   /codon_start=1
FT                   /gene_family="HOG000149777" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101680"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1710"
FT                   /db_xref="GOA:E0S9V8"
FT                   /db_xref="InterPro:IPR008594"
FT                   /db_xref="InterPro:IPR011145"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V8"
FT                   /protein_id="ADM12493.1"
FT                   /translation="MENVIKKFILEESLTSSEGHLYIGKVEGQKAILIFPNQPVPQDTF
FT                   SQFLSLPMERIQSNDVYYTYKVLGNMPISFRLIYPATEEHIRKYSSSPIYIRETYEEYL
FT                   DFLKNYGHISTSWMDNIIDPSKRNVNEEILYEDQEIMIIPDYKWNKQLIDHLHLLVIFK
FT                   DPALKTIRDINSHNLLIRAQENANTILATKFALDPKHVFMFFHYRPTYLRLHIHIINIK
FT                   IAHEGTVSSIRAIPLHDVIHNLHMNSNYYKKDMFVLLKEAN"
FT   gene            <221265..>222398
FT                   /locus_tag="Eint_101690"
FT   mRNA            <221265..>222398
FT                   /locus_tag="Eint_101690"
FT                   /product="3-hydroxy-3-methylglutaryl CoA reductase"
FT   CDS_pept        221265..222398
FT                   /codon_start=1
FT                   /gene_family="HOG000050844" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101690"
FT                   /product="3-hydroxy-3-methylglutaryl CoA reductase"
FT                   /note="similar to ECU10_1720"
FT                   /db_xref="GOA:E0S9V9"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9V9"
FT                   /protein_id="ADM12494.1"
FT                   /translation="MEECMGIKIEGICSQEDYSDVINRCCENLIGYKKVPLGVSNRGVL
FT                   INNRMFFIPIATTEGALVASMCRGIKLINACGGVEGYAENVGITRGFTMRFESFREAMR
FT                   FYQWIKMEKSIANLKRIGNEGSRYMRISKIESKHVIGEDVYIKVHGYSGDAMGMNMITK
FT                   SCVQISNEIVRLFPNSSLVCISSNTCTDKKWSAENYCNGRGRKIFMNLRVDNRNCEEIL
FT                   GVNIDRILDVYHAKVVVGGSLVLGGFNCQAANYVAGIFLALGQDLGQIIESSNCILSMK
FT                   KLESEVLSVSLFMPSVTVGVVGGGTHLEPSKSFLRQFSNVNDEYIITNKDEDKSVAPGY
FT                   LGLALGAAVLGGELSLLGSLADNTLMESHLRLNRRQG"
FT   gene            <222528..>223355
FT                   /locus_tag="Eint_101700"
FT   mRNA            <222528..>223355
FT                   /locus_tag="Eint_101700"
FT                   /product="hypothetical protein"
FT   CDS_pept        222528..223355
FT                   /codon_start=1
FT                   /gene_family="HOG000149776" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101700"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1730"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W0"
FT                   /protein_id="ADM12495.1"
FT                   /translation="MSIRLTIRYRTDSIEASVMMTDTLESLKLRIQEITGVPVDSQVLL
FT                   FNDRVLNDNNKELKELGIENDSTLYLKKRSGARKEGKRQDFTASMMKNPLVKNFLKNPD
FT                   AMKSIVEMFPGLKEEMSNNPELRMMMNSSNLQEELEMFSMNPEYMNTQLKNLDITMSKL
FT                   ENIPGGLNMINSMIKDVQDPLSSALKEGMGRGYRVKEGRKIDKPINEAIPGARKEESQL
FT                   VKYRDKLAELKQIGFSNTRKNFTALIACNGDLERSIMYLRELDSKSSPTQRAK"
FT   gene            complement(<223449..>226514)
FT                   /locus_tag="Eint_101710"
FT   mRNA            complement(<223449..>226514)
FT                   /locus_tag="Eint_101710"
FT                   /product="putative RasGAP domain-containing protein"
FT   CDS_pept        complement(223449..226514)
FT                   /codon_start=1
FT                   /gene_family="HOG000149775" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101710"
FT                   /product="putative RasGAP domain-containing protein"
FT                   /note="similar to ECU10_1740"
FT                   /db_xref="GOA:E0S9W1"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W1"
FT                   /protein_id="ADM12496.1"
FT                   /translation="MESKKEELKKNSINVHQRLGTDVHVSSEDMDLERRNTRAYEYLCR
FT                   LEEAKSWLGDFTSVPESFEEFEEEMRKGVILTDICKVFAPNSVKNVFVDCTLQYRHTDN
FT                   INYFLSGVSHIGLPEYFHFEVIDLYEKKNFVKVIYCIHALAHLLSSKGISKNIKSAKGK
FT                   IFSYDDMARADVQVEKMNMPKFDNIEDVLKEKIAMEEAAGNGENKVRKEILDQENVEEK
FT                   EGSFLSEDISVCDESFDILKLTLRTFLYKKCFDDIYYRKEVSLFSIRRFAFIFFSNSSE
FT                   MVKENLIENLHHKISRKFDSIYAKEAQIKDIETRIRLIVQNRMEVGNITIKNPIPEDED
FT                   TRDFERVLLFLQNNPKYLSELLRNVNDPDSFIVSIIIPIFSNVSSKKEEYMFINLVLEI
FT                   FRKELLDNGLDVRKLVPIDMSLGIHSSTFFSLELFREVEFPVHHTLMPGSISHKLMVNY
FT                   FRISQGSFVLRDKILQVVKNLENIEVDANPVLIYKMLFNQSTSADKALENERVREAVQT
FT                   RLMVVRGVIASALDLLESSVESIPYILRYFLKLYGPRTFYSEFVMPFILAPDAFIESFE
FT                   VGKSLRNKCFIISKILEHIADRVMFFEESDNGEEEKDGDGMSKYMSFISGEKKNFELRF
FT                   YSPLYPFFRRCHERYQSILSKLTNVSGLDHYFQFESMNELGKLKRATVHLPSSTANQLI
FT                   TLLLSNTRILGSELCEILETLPLFPDDQNKTLSFTFFGPEWICSQDPEKIALENFVRGL
FT                   KRKLIYAISVCKGRNLLEMLLKESDEEERSRYLEMKKSAICTKEEDDGLSIASPPKQYE
FT                   TIDQLKESIIDDLNFLEDKKITSRHNLYSELLFMLAQDIVILRFMSEERSKELRINEIS
FT                   YDNLCYKDDYLSGKIELYQNYLNSFAAKLAIKRRSLFGFNGVDDIIRDSKYGTHKYSAE
FT                   KLMNMGVLVQIYDSPDISEIFFLFLSDTPLLFSVEIYVQNILVSHPVSFRFDDLLKLRK
FT                   NGNNICDIAGICSFSVCRFIDLVNSKYIGSEV"
FT   gene            <226593..>228446
FT                   /locus_tag="Eint_101720"
FT   mRNA            <226593..>228446
FT                   /locus_tag="Eint_101720"
FT                   /product="hypothetical protein"
FT   CDS_pept        226593..228446
FT                   /codon_start=1
FT                   /gene_family="HOG000149774" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101720"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1750"
FT                   /db_xref="GOA:E0S9W2"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR015697"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W2"
FT                   /protein_id="ADM12497.1"
FT                   /translation="MQELLLNFIHTFFGIHGKSPSPLFLESAMRYLKPSKFEAMEDDEI
FT                   ENAIKIKSYRAYLAYRRMKKNIIAKMLCYVLANVADSEISVMSELDRNVKKGALGIEIS
FT                   YFSEASLPLLKESVGTHIYGIAFQVYQNACIYRKLRSETSFSSKAHSYFYEIVREELEK
FT                   YERSVIEQDEELLSFYVGMYSRYIRIQIIHQLNECFRDNPKKPFEFLKFNFLSNHPFYR
FT                   QVLESSCLHIDSCLQEFLLTGSFKDDTNEFFICRKVTIDPWEEFTIDFGLVPYFISNRV
FT                   VQKILYIGKCSSLIRRYDLERIGSLDTFQASQIESRMEKTTEGVNFRNLVEEELENIAR
FT                   QINILNPNLEENIDLILHKINKKIRHDFLSCPAICSQIEGIKNTFLFRRCDFIETLFLY
FT                   LKDSRDLTRKSFSYVLDLAIRNTYGDVDEFTSGLGVYIVDDENKYENFALFCQVSYPAS
FT                   IIITKESVLKLVAIFQFLWKLKRVEHLLLRISKMKMEGKTKIKIASYKTLVYKISYFVF
FT                   QEVIEKKWNFFSASGEMPLNKLRLGMEKVLDEVINICQIGGKMEALLDSMKDSLIDTGA
FT                   RSSSFSDEEIQRKLSELVKEHGNSFIGTSLYDLHKYSKAIN"
FT   gene            complement(<228462..>229064)
FT                   /locus_tag="Eint_101730"
FT   mRNA            complement(<228462..>229064)
FT                   /locus_tag="Eint_101730"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT   CDS_pept        complement(228462..229064)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101730"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="similar to ECU10_1760"
FT                   /db_xref="GOA:E0S9W3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W3"
FT                   /protein_id="ADM12498.1"
FT                   /translation="MKIHGAVLLVLLCMGVNTSPNRGTPYLDVEYVVNGTKKSGRITFE
FT                   LYWDAAPKTAANFYKLVEGTHIGNEFYKYEGSIFHRIIPEFMMQGGDIVKGNGTGSISI
FT                   YDGQPFEDEKFIFGHDGIGKLSMANSGPNSNGSQFFITFSPQPHLDRKHVVFGNVNEDC
FT                   ISLIKDIEKVDIYSTRPIPPVKIVKSGIMEKDRKEYL"
FT   gene            <229109..>230578
FT                   /locus_tag="Eint_101740"
FT   mRNA            <229109..>230578
FT                   /locus_tag="Eint_101740"
FT                   /product="leucyl aminopeptidase"
FT   CDS_pept        229109..230578
FT                   /codon_start=1
FT                   /gene_family="HOG000243129" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101740"
FT                   /product="leucyl aminopeptidase"
FT                   /note="similar to ECU10_1770i"
FT                   /db_xref="GOA:E0S9W4"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W4"
FT                   /protein_id="ADM12499.1"
FT                   /translation="MPLKMELLDYGKLKVTGETNQESTKVRIILYSPSKEGVDIKSEKK
FT                   DSSHQAFLNRMGAKGNSGESYVLPEENGKITVFVGIGKEDENVFLVKNNAKKAGALAYK
FT                   AVSQFKNLEIFLESEFMGKEVASGVTLASYKYQFLNKEKGEPKKVAINTQFPSVKKAIM
FT                   IGNAQNFARFLGDTPANLMNPTLFTEYAAKYLHGKKNVTFEVFGKEFMKSKSMNLLLSV
FT                   SQGSVQEPKLFVAKYRGKGGDGVDIALVGKGVCFDSGGISLKPSARMSLMKGDMLGAAS
FT                   VLSVFGLAADMEIKINIDLVIPLVENLPSGTATKPGDVYIGMNGKSVEIDNTDAEGRLI
FT                   LADALVYAQEGHPTYIFDVATLTGAMAVALGDAFIGYFTSDDKLSEIIYQSGIDASDPT
FT                   WRMPLSQLYLPTMKSDVADLKNTGEGRYGGSASAAIFLNEFVGKEYKWVHFDIAGVMNS
FT                   NNSKGIYGDGMTGCSVSALIETIEKLSTIVN"
FT   gene            complement(<230646..>231917)
FT                   /locus_tag="Eint_101750"
FT   mRNA            complement(<230646..>231917)
FT                   /locus_tag="Eint_101750"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(230646..231917)
FT                   /codon_start=1
FT                   /gene_family="HOG000149773" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101750"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1780"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W5"
FT                   /protein_id="ADM12500.1"
FT                   /translation="MPDLTSKISRFNSFDLESYLNNTFQRYEGFILENERHNISKIEHE
FT                   VDTELLKTFLLNSDSLLDILNVYEESYRMVTSMVDLTKELVRYNMDGGVEEEVFVDKDL
FT                   VRKFRRVLDNFDNEVDVFATEGRYLVHFDILREKSGKECILIMTNDILLIGIVQEGAKK
FT                   YRLLNAYSYSIIQIQIKDDLLEIKVSPTVYVFEKNKESVEYILRIYQELTYTYKKKTDS
FT                   TVQKPVIDKELIDYLVFTEQYEYIEADECFHSPKVLFHDKTEMVRYLSVISKGKKGISP
FT                   YVFSFLEERFKDGLKRINKIQPLKSFIEDIFGYFRVFLEEQTILVKDLEKIESIKRSGM
FT                   VFLIEEQLVRCIEMLESRVFNKGYDVKYTDSILEAVKENLVFSKYDFSYIMDRFLKKRN
FT                   NYKKKCLGNAMKDIGRIIEDMISN"
FT   gene            <231978..>233717
FT                   /locus_tag="Eint_101760"
FT   mRNA            <231978..>233717
FT                   /locus_tag="Eint_101760"
FT                   /product="glycyl-tRNA synthetase"
FT   CDS_pept        231978..233717
FT                   /codon_start=1
FT                   /gene_family="HOG000242015" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101760"
FT                   /product="glycyl-tRNA synthetase"
FT                   /note="similar to ECU10_1790"
FT                   /db_xref="GOA:E0S9W6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W6"
FT                   /protein_id="ADM12501.1"
FT                   /translation="MRKFDQQQIDQVLKKRFFLAQSAHIYGGISGLYDLGPPGLSIKTN
FT                   ILALWRKHFVLEEDMLEIETTTMLPYDVLKASGHVDKFCDILVFDEVTGDCFRADHLVE
FT                   ETLEKMSPTEEVIRDLQRVDCMTCQEIDAVISKYNIKSVLGNKLSKSQQFNLMFGTQIG
FT                   YKGGQTMFLRPETAQGQFLNFKKLYEYNNEKLPFASASIGKSYRNEISPRSGLIRVREF
FT                   DQAEIEHFVLPDEKKHPKFSSVKEIKLKFIQEDSSEEISLGEAVERKMVCNETIGYYIG
FT                   RTALFLIEVGIDKELLRFRQHKKEEMAHYAKDCWDAEIYTSYGWIECVGIADRSCYDLK
FT                   CHEDGSKVDLRCKRRLTNPKEVEEWILKLDKKEWGARLRDRFSTLIEMINGFSQEYIEK
FT                   NISALDGNKNYLNVEFDGHGINVECSKEKKKIFVENVIPDVIEPSFGIGRILYALLEHS
FT                   FYQREDLRPVLKLKPMIAPIQCAIGYLIYYNEFEEHILKIKRSLAENGLVVHVNERSCS
FT                   IGRKYSSYDELGVPFFITFDPDFLKDSMVTIRERDTMNQIRVDVEKCPSIILEYIRGES
FT                   KWN"
FT   gene            <233777..>234784
FT                   /locus_tag="Eint_101770"
FT   mRNA            <233777..>234784
FT                   /locus_tag="Eint_101770"
FT                   /product="hypothetical protein"
FT   CDS_pept        233777..234784
FT                   /codon_start=1
FT                   /gene_family="HOG000149771" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_101770"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1800"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W7"
FT                   /protein_id="ADM12502.1"
FT                   /translation="MRTKRKIVILIVTFVVLLILFTTLIVRRKRSYINSRNASGLVKSN
FT                   IITNENSGIPSTKDRGLSFGLTSWQLKENGSLKKIDSIFMPILEKAYNLEKKEDPESKN
FT                   KDETIEDELFRHNQRLISFKIEGKHSIGNYLFGLLRKTIDNICACSPPDGKKHETFGIS
FT                   SEHTALIRHYIKYFKTFVCMPKVIYHGNTEPEDIYKLHFDSINCFIGARLTKYHTASSF
FT                   TKGEEKYMTYIEQFIDTEASDIPIEILSEGRERLSVKDHILYTLLHYICLFYSKSQETR
FT                   DMLYTKMKIEKMGISSINLSKIINDYRYSDIVESIRPIHFVNDSSCIVKPLIVK"
XX
SQ   Sequence 234890 BP; 68554 A; 49115 C; 48677 G; 68544 T; 0 other;
     ttcaatcctc ttcccctctc cccacatcga ggaaaaaatg cacagcctca aaatgtcgga        60
     ttactcctcc attcgcacag cttgcatcca taacggtcgt cttccgtcca catcacagcg       120
     cagtcagtct tcaggcttag aggccttcag ccattatact cccgacgtag ctccgcaaca       180
     gccagcaggc ttgccgctcc accagaggtc gcaatcaaga gttcctctcg tactatcaag       240
     atttactgcc cagtcaatca cagtagggta aaactaacct gtctcacgac ggtctaaacc       300
     cagctcacgt tccctgttgg tgggtgaaca atccaacact tcgcaatttc tgcttcacga       360
     tgataggaag agccgacatc gaagaatcaa aaagcagcgt cgctatgatc gctcggctgc       420
     tacaagccag ttatccctgt ggtaactttt ctgtcaccca tgtcccaagc cttataggac       480
     atgggatctc taggccaggg tttcccccaa acaatcccgc aataggaata gtctcaagca       540
     ggcttatgcc cttgtgctcc acgcgtggtt tccttccccg ctgagcccgc cttaggacgt       600
     ctgcgttagt ctttagcagt cgtgccgccc cagccaaact ccccacatcc ataaataaac       660
     cgctgaggct cagtcatagt ggtctcgcac atctcccccc acctctcttc ataaccaccc       720
     tcagcacttc tcacatgcta gagtcaagct caacagggtc ttctttcccc gctgatcagc       780
     ccaagcccgt tcccttggct gtaggttcac aatacaggtc gtagggacag tgggaatctc       840
     gttgctccat tcatgcgcgt cactaattac atgacgaggc atttggctac cttaagagag       900
     tcatagttac tcccgccgtt tacactcgct taagctcaaa aagccgtaac taaaagtgca       960
     ctgggcagaa ttcaccttgc gttcttccgc aaggctatgt ttttaataaa cagtcagatt      1020
     ccccacaaca aacagttcta gcacgctaga gccaatcctt ctcccaaagt tacacatcca      1080
     tcttgccgac ttcccttaca acccttctca aattcgcttc cgcgtcaaac agtggacacc      1140
     tgttgcggtc taggtacgac atgcatgctt ctttttcatc ggaacaggtc atctcctcag      1200
     cgctgcttcg tctcttaaca atccacaccg ctacttcccc tagttctgct ctcctaggat      1260
     caaaaatccc ccatccgtca tcatcaagtc gcctcaaagc atccatacac tcaatcttca      1320
     atcagtctcc gtttcaacag tcgattcacc cccatcaaat ggggaaccct cgtccacagc      1380
     gcaaatcctt tcttgttact actaccaaga tctgctcata tcacccctcc acccccgctc      1440
     acgcaggacc ttcgtcagaa tgatatcgcc ctcttactca gctccgccgc taaggcctcg      1500
     gatacctgca attcaatccc ttccattttc tccagcgccc aattcggtag gtacgttgca      1560
     acacgtttct tagcggatgc caacctccat ggccaccgtc caactgtcaa aatcaaaccg      1620
     ccagattctc ttcccttgca tacggctcct tatcctaaaa aaggttcatc ccttctcgca      1680
     catcatgctt accacaatat gcccactggc taccccctta caagacatct tcaaagttta      1740
     acgctatcgc attagtgctt tacaacatct tacatcaagt cgccgctgtc ctgagagaca      1800
     tttcagaggg aaccagctac cagatggttc gtttggtctt tcgcccctat gcccatctca      1860
     tgccatcgag ttgcacgtca gaacggctta gatcctccag aacactttcg catcccttca      1920
     atcaacacag gcatagttca ccatctttcg ggtcggatca ctgcatccac tagctctcgc      1980
     taaaacaatc cagccatcct ctccttggtc cgtgtttcaa gacgggcggg tctcatcccc      2040
     ttcaaagcat tcactttcat ttttcatctt gtctttttca catttcaatc actctacttc      2100
     ttcgctatcg gtcattagct tatatttagc tttcggtgaa aaaaaacacc acccaattca      2160
     ggctgcacta ccaaacaacc ctactcttct ctcaagtccg gatacttaca ggccattccc      2220
     cctctaagat cagggacttc aatccctagc tcagtctcct cctactcaaa acaacccgcc      2280
     aaacgcagtt accattcgag ctcctgtcct ttcactcgcc gctactccga caatcccttt      2340
     tggtttcttc tcctcccttt attgatatgc ttaagtcaaa ggggtcccca agcgcttccg      2400
     cttcattcag acatcctcaa aaaggcatat cgtcctccta cacgtccttc ctcgctgcta      2460
     atgcctatca atcccgtgaa tcctcaaatc aaaaaaattc cccccaatct ctcaaatact      2520
     gatcctgctg ctggttctcc aacagcagcc atgttacgac ttatatctta tctaacacga      2580
     aggactcaga ccttccaatc ttcgtccact gcgtcatctt agatagcgac gggcggtgtg      2640
     tacaaaggac agggacccat tcaaaacaac ttgttcaatc gttattacta ggaattccac      2700
     gttcagaagc ccattacaca gcttcatccc tcacagcagg ctccctcgcc atctatcgta      2760
     gtgcgcgtgc cgcccgcttc atctcagggc ataacggacc tgttctgttc cattcctccc      2820
     ttgccccaaa gagcactgtc aaagggtctc acatcttacg caacttaatc caaagctcac      2880
     gccatccatt tcaaacggcc atgcaccacc gccgcgcgca tcccgtcctc gttctcctgc      2940
     ccgcttcaga accggtaagt tgccccgcgt tgagtcaaat taagccgcac actccactcc      3000
     ttgtggtgtc cttccgtcaa tctcttcaag tttcactctt gcgagcatac tatccccaga      3060
     acccacatac tcaagatttc tcatgcacaa cactatatag tcccgtccag tcggcatcgt      3120
     ttactgctag aactaaaacg gtatctaatc gatttcgatc ctctagcctt cgtccttcat      3180
     cgtcacataa gtccaagagc acagccttcg cttctgtccg tccagtcagg gtcttcgtat      3240
     ttcacccctc gcccaactat ccggtgcccc tcgtcctctg ccaaacctct tacatccaca      3300
     tcaggacata atcccccaaa caaagacata caaaagacta cggacttttt aactgcagca      3360
     ttcaccatag acactattgg agcaggtatt accgcggctg ctggcacccg acttgccctc      3420
     caatcaatct cgactccttt acactcgaaa aaaactcact tctcataacc gcctccccaa      3480
     aggattaggc aagtttcgcg cctgctgcca tccttggacg tagtagccat ctctcaggct      3540
     ccctctccgg aatcaaaccc cgatcccccg tctcccgtct ccgcctagtt aggccattac      3600
     cctaactacc agctgatagg cctacaactt acttggctcg tgtcaaaaac actcctagcc      3660
     ccctacctgc agtttcccgc agttacagct ctcccgccaa ccaaatcatc gtactatcac      3720
     tgagccgtcc gtcaatcccc cacaaggttc atcaacatgc atggcttagt cccagagaat      3780
     agcatccacg tcaggcagaa tcaacctgat gctacccccc atcaaaaatc tctcagatcc      3840
     ctcatcaaca aacccctggc cacagccaca tcaaatccca aaaaatcctc catccccacc      3900
     gtcaaacaca aatctctctc agaggagacc aagactaatc caaaaccact ctcttttctc      3960
     cccacatccc aatccccccc ctcgctcccc cttctctcca tagcccctcc cctctgcaaa      4020
     ggagactctg gggggaaata agacggtggg ccctagaaga attcccaaga agccgcggaa      4080
     tatagatttc ggagagagca gcagctcgga aagctccatg tccgagcaaa gggaggagaa      4140
     gcctctgtac atgttgaagt ccacagggcc tgggcgaaag aagaggagaa gaggagatcc      4200
     atttattgat tgttatttga aaggagatcc atccaccaga tgcacgtcgg acagttccga      4260
     ggggaggccg gacataggcg atgcagttat ctacaggagc gatctcgaca gcggcgacga      4320
     gatcatatat cttagtgagc tgttgcaagg atgacggcaa cacacaccaa atattattaa      4380
     agcatgtgtt ttctatgcag ggtcccgatg tgttttcaag ccgtcgaaga atggatggtt      4440
     gagggcgtct ggagcagtga tcctggttga agagcagaga tcaagcatcc tgtagagcag      4500
     gtcgtatccc tcggagccga cctcggccca cgggttaagc gactcgataa ttgtctcgaa      4560
     ggggattctc tcctcgggaa ttgtgtctat gttcgacctc cacagtcttc cgtagaactt      4620
     tgcagccttt ctcatttctg cgtgtccaaa gatcgttgca atctcgacaa tggcgtcgat      4680
     atcctcggac gagtagaaga agggatattg tgcagtcagg atcgtcaaga aaatcacccc      4740
     cacagaccac atgtctatgg ctctggtctg gtgagggtag cggaacagga cctctggtgc      4800
     tcggaaccca cgtgtcccgg cccgaggagc cttcatctgc ggcctggagt ctctctcgta      4860
     gtatcccgga ggctttgtct tcgacacaat cgagttgaag aagagcaggg gtgtctgggg      4920
     cttgctactg tcctttggaa gatgttcctc cctgcggtct tcgtactggg caagcccaaa      4980
     gtctatgagc atccctcttc cagtctcctt attgtacaga aagttccctg gcttcaggtc      5040
     tctgtgtatt atgccattgc catgcacatg gtctatcgct tccaacaggt tgtacagata      5100
     ctgcttgatg tcattcaggc ctgcattgga aataaactcc cggaagtcga tgggcttgaa      5160
     gtacggaaag acagcaatca cctggtcttc gttccggaaa accccgagaa gccccatgca      5220
     gttcctcttt ccctcaagtg ccttcagaaa cgtcagttcc tcgagaaccc ttgctggaga      5280
     gctggttctt gttattacct tcagagcgac atgtctcccg gcctctgcat caagggcctt      5340
     gtacacaaca ctgaacgacc cttcgcctat tttttctatg ggcgtgtact ttggtatgat      5400
     gaaggacaga tgcttgaggt cggactctgg gatcttttcc tcttccatcc ccctttccag      5460
     gttttttatt ttaagattgg gtgtggctct gccataccga ttgtctttca tggctggaag      5520
     gggatggaga taaagggtgg gaagggtagc cctttaatgt gtggaggact caaggccgat      5580
     ctgtttgtta gatacaaaca aatggaaaga aagctcaagc ttctcgagat aagggaggcg      5640
     tatgtgcgca aggaagtgga gacgctgagg agggaagaga gacacagcaa agaggagctg      5700
     gatagagtca agagtgttcc gttgataatg gggcagtttc tggagcctat cgacaactcg      5760
     acagcaattg tggggtcgac agcagggagc aactttgttg tccgaatact gtctactgtg      5820
     gaccgagagc tgctgaagcc aaacactaca gttgcgctgc acagacactc gagtgcgatt      5880
     gtggatgtgc tccctccgga agtggacagc acgattcctg taatggggga gtctgagagg      5940
     ccggaggtga cgtatgcaga tgtgggaggg ctggatgtgc agaagcagga gataagggag      6000
     acggttgagc ttcctctgct gcaatctgag ttgtacagac agataggaat tgatcctcca      6060
     caaggggtgc tgctgtacgg gccgcctgga acggggaaga cgatgcttgt gaaggctgtg      6120
     gcgaaccata caaaggctac atttataaag gtcaacgggt ctgagtttgt gcagaagtat      6180
     cttggagagg gtccgcggat ggtgcgggat gtgttcaggc ttgcaaggga gaaggcgccg      6240
     tcgattgtgt ttatcgacga ggtggactcg atagcaacaa agagatttga tgcgtcgaca      6300
     tctgcagacc gggaggtgca gcgggtgctt attgagctgc tgaaccagat ggacggattt      6360
     gaccagacgg caaatgtcaa ggtgatcatg gccacaaaca gggcagacac aatcgaccct      6420
     gcactgctca ggccgggacg gttggacagg aagatagagt ttccgcttcc cgaccggagg      6480
     cagaagaggc ttgtgttcaa tgccatcaca tcgaagatga gcctcaagga cgaggttgac      6540
     attgagagcc ttgtgtgcag gcccgagagg ataagctgtg cagacatcaa ttcgatctgc      6600
     caggaggcgg gaatgcttgc agtgcgggcc agcagataca tggttacgca aaaggacttt      6660
     gaagaggcat actcaaaggt tgttgagaga agcgacacaa ggcctgcatt ctacaattaa      6720
     atagtttgtg ttttcccgac taagaggcct gggttggatc taaagatgtg aacatcaaag      6780
     aaggtattta attgctctta tccttagtct tcaaattttg gattttctta agcctgaaga      6840
     aatctcctct atcttgctcg tcgagctcgg aagaaatgta agaaatagtg ttctctaatt      6900
     ttgggattat gttgaattcc agtgcgttaa ctcttctatt agtactcatt agtatagaat      6960
     tgaggactcg gaatgagttt ttcaatgcac ataaatctac aagcatttcc aaaacttcca      7020
     agaacttttc tctacactca ttaagggatt gaccgcttct gtcaaggaag agaataggct      7080
     gtgtgttttc cttttgaagg gtgaagaacg gaagactcac tccagaaacc tgttctattc      7140
     ggggctttac atatacattt tgtttttggc attcgtacaa gaacatcttt aggttggccc      7200
     caagaaactc ggcttctgtg agtttaaaga atgcgtcttt tatcttttga tttatgccca      7260
     actcttttct tttgtattct tcttctatta ccctgtactt caccttcagt gcgtcgcttt      7320
     ttctcttcag cagagaatac cccttttctg cactcttttg ctttgtttcc attgtcttta      7380
     gattcattct tgtgggaaac acaggtattt tctggcctgt cattttgtgg gcttttgtta      7440
     gtaatctcaa aagtaaattg gaggaggcaa acatattcca aaatcggatt atcttgaatg      7500
     atcttcggat ttcatttatt aatgactatt tctccactaa acacacatcc catgtcgtat      7560
     actattctat catcctttat gttagggagg atgaacctcg gaattctgtc gtcatctgtt      7620
     ccctcgataa ctcctagcat aaagcaatca attctctgaa gaaatttctt aaagtcctct      7680
     atgctttttt cgattctctt gatttcatct tcgtgcttgt tgttgaagtg gttgaatata      7740
     aacttttcac tttcgaatga ctttccacag aatccacact tgtagtggtt ttcattaacg      7800
     attgttgtca tgttgttaag ctcttcttcc ttagtctttg gatgaagata tccaaaccct      7860
     cgatagtttg ctaagaactc tcttcttctt gtggctgtat cggttgcttt gtggtttcta      7920
     caacccatca tcatttcaag aggatcatca tactggtgtg cacatgtgta gcagtaaaga      7980
     aatatgctct tgagtgctcc acagatgaac ttcgcagtgt tcctctctgt agagctgtct      8040
     tctagtgttg atgcatactt ttccagaacc tcctcttcat ttacatcaaa catcctggat      8100
     agagaggtaa atattgatgc tgacatttgg tagtcatcat cttcgaacga tatttctggc      8160
     tctgacactc cggagatgtc gaattcctca agctgaacac ccagtccctt atctaggatg      8220
     gacttcataa acttgatcga gtcttgcgtg tttgcttcct tttgcaagat aatatagcat      8280
     agccttgaaa atccattttg cgacgtttgt tgctggatcc aaaatctttc aagatttaca      8340
     cattttgaga aaatagagta tataacagat ccgggcatgc tatctggtat attccttgct      8400
     attatgcatg ggccttctat cttgaagcta tgaacattac aaatggtctt tctcctttgt      8460
     tcaaaaaagg aattatctaa gtatctatat ataaaccatt cctttcctaa gcttttgtca      8520
     aatacctcag gcactcttct tctgtaatag tttgtactgt agtcttcgta agattgtata      8580
     ggaagaacca tttccaattc ccttttggta acaagtcttt gttgcttcag taagaaaaat      8640
     atgtcaatct tatcaaccag agttcttttt gtgtccattt ccgagggctg ttcttgatag      8700
     cgagacttat tcggttgcaa aacgacaaaa cgcccctgga gagactcgaa ctctcgacct      8760
     ttcggttaac agccgaacgc gttaaccact gcgctacaga ggctgtgctt ccacatacac      8820
     cccacaaact gtttccaaca tccgaacaac aatctaacaa aaaccctctt cctccttgcc      8880
     cccatggata caccgaagag gaactttaag catcctagaa acctcgtctc aaagatgcca      8940
     agaaacaccc cgcacgacat aatactctat gcgctcacca cagagaaggc tgcaaggtgc      9000
     atggagcagt tcaacaccct ggtcttctat gtggagaaga cctcgaccaa gccggaaatt      9060
     agagatgccg ttacccagct ctatggatgc aaagtcaaga aggtcaacac cttgatcaac      9120
     aagcatggga agaaggcata tgtccgattt gacaaagagg gagacgccat tcaaatcgcc      9180
     tctaaaatag gtgcaatctg aattaaattt attttcggtt tttattcttt tcttatcctc      9240
     cttagtcttg gcaacttctt ttttgaaatt agaagctcaa gaggacataa ggctattcac      9300
     aatgtcttcc gatcctatat ttgacaaatc tgagtttgtc tgcccaacac ctaagaataa      9360
     aatgggggca ttggaggaaa aagccatgtt cagtatctgt cctatcttgt tatccaccgt      9420
     atcaactttg gtaaggagta tactgtcgat atttcttaac tgatctgcat ctttaattgc      9480
     cctgttaaat tccttaatat gttccaagct atcggacccg accagtgcct cccctacata      9540
     tatgatatgg tcaggcttat taatcttcat tagcttggta agagacatca tgagattctt      9600
     cttgttgtgc attcttcctg ctgtatcaat gaggataaca tcataccctt cgtgctgagc      9660
     ttcttgaatg gcacatcttg ccaccgatgc atcgtccttt ccatatccct tttggtagaa      9720
     tccaacagaa taacccccta attgaaatct ctctacatga gtcttaagtt gctcaattgc      9780
     tcctgctcta aaggtatcac acgctgctat gtacactttg agtttgtttt tcagaagcca      9840
     gtaacatatt ttagccaacg atgtactctt tccaactcca ttcactccaa cgaagcaaat      9900
     ggaaaacaca cctttatgct tccttattcc gtctagcatt ttttcatggt ctacagacgg      9960
     gataagtttt ccaagcacat tagacatttt ttccttaaac ttcttttcgg aaacgacatc     10020
     tagtccctct ccagacaact cctccatgac attctctaca agtgttctgg ttatttggta     10080
     gcttacattt ttgtttatta aatgcgtagt catcttgtcc ttcagctctt tcacttgtat     10140
     ttgatcttta aacaagccaa atgctttttg gattgttgct ttcttaataa ccttaacaaa     10200
     attacttact ccacttgaag gcgaagagta gtttaattcc tcctcgtttc ctatatcttc     10260
     ccattttctc tccttattct ttttccatgc cctttttttg ttttccgagc cagccttttc     10320
     cttacttttg ttcagataat tatcaattgc tatcttgaga ttaggcgttc tagatagact     10380
     caaatataca atggcccccc taatttcgta ttccataact tcatccctaa ttttcctttc     10440
     cccgcccggc ctagacacgt ctagagatac tactatttgg ttgaaatgtt ctggcatcct     10500
     cccttcttcg tggataacca gtcctctctt gttgaatacg caaaaatatc ccatgcaagg     10560
     gctcaggtct cacatgtttt ttgtcttgtt gggccagtag gccaaacaaa ctatcccaag     10620
     ttctcctcga taatcgtggt atatccattt gcctcaaaca gtccatgctc tatgacccca     10680
     cagatgctct tgcattccga tataaagtcg gcgttgtatt ccacatcaac tatacaattt     10740
     cctaagtcgc tgattaatgg tcctgccttc cctgtggttt ctcttaagaa atgcttcaac     10800
     ttatactctt gaagaatcga aaggaacttc atcagggaaa tagaggagat ttcaatagga     10860
     acaagacatc cttcaaatgt ttctctatac ttatgccttt gaactattat aatgatatct     10920
     ttggccatgg aataaagtag cttttcggta gtaagtgctc ctccccctcc tttaatcaga     10980
     tttccacatt tgtcaaagta gtctgcaccg tctatgtaca gatccaggga ctcatgaccc     11040
     agggggcttg atactatcaa gcccttttct ctaagcttca gtgctgtttg gatgcttgag     11100
     ggaacataca ccacttccct atctagaacc cctatatacc tttctatagt agttcctgtt     11160
     ccaattccaa tcactgtcct gctctctaca ttttttttat atccttccat atgtccctga     11220
     agacaaaata ataaatctct taaaaggaaa aatctccaat aattcacaac tacgaatgca     11280
     aaaaacatcc ctcctgccac agttacttct ttcatgatca aacagtagca ccatatgaaa     11340
     ataatgaaag acattgcttt atttaacaca cttcttaatt ctacgcacaa catcacatcc     11400
     atatccaatg atgcttgatg catcctggtc ttcccgagaa gtcacttcca caactccgga     11460
     gatacggtct attttactcc acaagcggcc ctcaactata aactctccaa gatcctcctc     11520
     aacatactcc acactcaccc cgaatgtttc tgccatattt tcaagtagca tcgagcgata     11580
     actttcaaga acctgtccat aaacacgcag cctcatctct cggcagaata gatttacaaa     11640
     ccttccaaca aatacgtctt cctggagaga cttgcaaaaa agatataagt cttccataaa     11700
     acttccgtaa ttgcattcaa acaatgatgt cgccagctgt accccaagct tctcggagct     11760
     tcccattaca tcactacatt taaggatccg tgtctcaatt tcatttctct caaatccgag     11820
     taagccgcag aatatcatat atttcacagc ccgtgaatag cttattacct cgcttgattc     11880
     aaatgatgga agcacctcgc tgaacaaaat tcctgcttcc ttaaacttcc tctccatcat     11940
     tttaaatact cccttgtata ctttgtatct gtttcttctg tcccaatcac atcctctttc     12000
     gtatgtgtca tcagccacat taatactctc ctcaacaatt cttttgttcc ccacaatcaa     12060
     acccattctg attttacata gagaaatgtc catcttcaac gataatgaca tgtcgtctct     12120
     catgagcttc ctcatccatt caaatccatt ttgtgtatcc atcacttggc aatagaactc     12180
     agccgtcttc cgctcaattt cttctgcata cgtttcgttc tctgtttcct tcttcctaag     12240
     ctcctcaagc tcctgaattc tctgattttt gcaattcagc aatgaatcta tgcgctcatg     12300
     gtttggctgc aatatacctt tttccacaag gaaactatag agatcataca tgcatttatc     12360
     ggaaagaagc ttttcaagtt cttcctgggc ttcggattta cccagctttg ttgcatgaat     12420
     aaggtcatgg acaagtaatg tcggctcctt gaagtcaaag tccatgggta catagtcgtc     12480
     ttggttttaa tatacaaaca cgatagtaat gttaaaagat aagaataaaa tgcttttgct     12540
     cgggctcgaa ccgaggacct catccgtgtg aaggatacgt gataaccgct acactacaaa     12600
     agctcagttt tgttgacaag acttctcacc tataggtgat ataaacatat atgtgtttgg     12660
     aacttaaaat ccctcaatgg acgatacaat tcaaaggtat aaggaaaagc taaatgagct     12720
     ggagaaaatt ggaagtgaaa taaaagatat gctttccctg gactatgatt tggattgctt     12780
     aagccattcc ccatccgtat gctatatcgc tacatcgctg gaggagggga aggccgaaga     12840
     attagaagag aataagtatt ctatagaagt tcaaatgata ataaccattg ggaagtcttt     12900
     ggattcaacc ttaaaaaaag atctcatctc aaagattgaa aagattaaag cgatcaatat     12960
     tgggatagaa gaatacaggg atgcaattgc gtcccgattc aaatatctcc ataatctact     13020
     agggaatgat cttctattca agttaaccat agaggtgaag agtcttctcc ctttggcaag     13080
     agctattcca tcggagataa tgaagtatgg cattgagaca tacggatttc cactattgtc     13140
     tcaacaccag ctgatcatga aggcctctcc acagaaccag gaaaagcttc ttaggaagct     13200
     ttgctgtaaa gtcacgatgg ccgccaaact ggatttctgc gaaagcagct ttgaaataga     13260
     tttttatagc cagatggaaa agatttttaa cagtcttgaa agcaaagaaa aagaagaaaa     13320
     atctattctg aaagttccac ttgccagaaa agaaaccaga cggggaggaa taaatgcaag     13380
     gcgaaagaga caaggttctt caccccataa aagaaggaga cttctgaagc tggagcctga     13440
     cgaagccgat ggataatgcc ccatgggaaa tttcatccca taatgaaaag ccttttagat     13500
     ttcataaaaa gtcgtcctga gggagtagtt gaagaggagc tttctttaga gtttccggat     13560
     atgtccaagg ccgatattgc aaaggagtta aataattatc ttaagtgcca ggagatcagt     13620
     ctgtttagag acaaaggcgt tctgtattac aaaccatcac cagttaatgt ggatgactac     13680
     gaacttatga tatacaactt ggtaaatcag agtggaagtg aaggtgtctg gctaaaggtg     13740
     ataaaagata aaaccaatat gccgcataac ttggttggaa aggtcctcag gaacatggaa     13800
     acaaagagaa tcatcaagtc tgttaaatgc cttaagaata acagaaaagt gtatgttttg     13860
     tatgatcaag ttccttctga agagattact ggaggcatgt ggtttcaaga taacgatgtg     13920
     gacgtggagt gtgtaactaa gattctcgag attatactgt tatttctgga aaaaagactg     13980
     ggtgatagat tggagcttcc cgagtacgaa gagaatccta aacttgagga aataatgaat     14040
     tatgttaagg acttgggcat cctgtctgtt cccctaaggc ttgaagatct tgagacattg     14100
     gtagatatac ttgtatttga tgggagggta gagaaactcc attcggggcc tatagtcaga     14160
     tatagagccc ttagaccata tggaaagtaa atctcatgga tttgaagtga agacattcgg     14220
     cttgttgcga aatttttact tattttcaat ttctctgcca gggataaatg gatgatggac     14280
     tttcgatagg aagcgaagga tattttctaa atataaaatg ccacgaaaga cctataacgg     14340
     atgtcaagtt caattacgat ggagacttaa tatttacctc tgggaaagat tccatagcca     14400
     cacttctccg ctctgatgga tctgtggtag gagagtacaa aggacatcga ggatcaatct     14460
     tttctattgc tgtggataac aaaagcactt ccttagtgac aggaagcgcc gaccagtcca     14520
     ttattttgtg ggatgtttcc accggaaaaa tgaaggcaca aaccgatgtc ggcgttgtag     14580
     ttaaaggctt ggatttttac aaggacggga cgttgtgtct gggatgtagt gacgattcca     14640
     tgggaaagac cccctccatc gggattcttg atacaagaaa caaaagcttt gagaagattt     14700
     ttgttcccac ctcatctcct ataaagattt taatggacat ctcagaaaac tttttggtat     14760
     attgcgattc aagaggagga gttagctctg tggaccttcg aaactctcag gttatcaaga     14820
     gtgcaaagat acacacatcc aagataaata atattaggcc aagcaggtgt agaactttct     14880
     tcattacagg ttctatggat tcacaggcaa agatcattga ttttcttgat ctgtcagttc     14940
     aaaagacatt tgtatgtgaa gaaccagtga attgtgcagc catattcaac actaacgaca     15000
     aagttatctg tgttggagga attaatgcaa gggatgtaac tacaaccaaa ggaaagtctt     15060
     cttttgacgc aaacttcttt gatgtagtaa catgtgaaaa aattgggtct tatagcacac     15120
     attttggaac aataaattct gtagatgtcc atccctctgg aaagctttac tgctccggag     15180
     gagaggaagg gactattacc attctagcat ttggccaaga tttctttcag gccaacttta     15240
     ccaatttcaa ttaaaacatc atgcaaaagt catttaatat attcatgatc tttagggcca     15300
     ttttttattg caatgctccc gtcgggatat ctaacttcct ttaagcccga ggggaatgtc     15360
     ttttcgattt gcccatttga aaactcataa gtaatcactt tggtttttgc atcatacaaa     15420
     tatctatact gattgctctt tacaacatat gtggacccat ccttaaggta ataccttgtt     15480
     ttgttttgga gctggtcctt atgcatgact cttttagcct ctagtgattt cttgtactct     15540
     tcattgagct tcttcagttt aagtatctct tctttgagga cgtcgaccac ggaaatgttt     15600
     ttgttttctt ctagtcgctt cattagtgtg ctaatggtct cgatcttttc ttttatgttt     15660
     tcctgcatga aagtcatcct atgcttatgt ggggcaatgc tgattatgtg aggtcacctg     15720
     gaaaggaatt aaaagccgca aacagaataa gagaatttgg aagaaagcca attcgccttc     15780
     aaacttaaat ttttatttaa cgcttacttt cgattatccc atcaattctt aaaagctgcg     15840
     acactgcttc aatagcagat ttgatgcatt ggctcttcac agcatatggc tcaagcacaa     15900
     gatctcttgt gtctacaatc tccccggtta ttccattaac tccgtagaag gatccttcct     15960
     gatgcttttt ctccaaaaga gtgatggcct ctagaggatt aaatactccg gagttttcaa     16020
     ggagtatgga aggaattatg gttaacgccg aagccactct tgaaaaaact tcggcttcta     16080
     tttcgttgtc tccggaattc tgcattaact cgtgtgacat tgccatctcc acagctcccc     16140
     ctcctgggca gagcttggga ctgataaata tgctttttgc taccttaact gcatccatga     16200
     agtttctttc gagttcatca aggatatcct ttgtcgggcc acggataata acactgcaag     16260
     ccttcgggtt tacacactta ctgaatttgc aatagtattc ctctccatat ttaacatatt     16320
     caaacagtcc acaagaagtt cctatgtgcc tttcctcaag gtcttcaggc ctgttgacag     16380
     gtcgtgctcc gcaggcttta cttagcctag aaacatctgt tttctttaac cttcttaggc     16440
     ctgtgatgtt gttttcaaag agaattgaca atgcaagatc actaatccct ttctcacata     16500
     ccacaatatc aggctttgct gcaattattt tctcacacat ttcacggact tgctcttcct     16560
     caatctcaag tgctcgtgtg aaatcgtttt ctttggaaaa ctcatagctt gtttgacttt     16620
     ctcccttttt gtattcaaga ggagactcaa ctatagcaat cctcggattc tcgatggttc     16680
     ttctcatctg tggatgtata atgtccttgt tgatgagtat tccatccatg acctcagact     16740
     ctacaaaatt tcctccaagt attttctcta ccttcatgtt gctcttaaga tcgcatctgt     16800
     tctcttcctt tatgtaaatc ttcttcacag cttctaaagc aagctttcca ataggaacct     16860
     tgagaatact gcagactttt gacgccacac taccattaat tattttgatt cttgtttcct     16920
     cgctggaatc taaggacata gctgttccgt caatggcctt gatacaaact tcaagtgctt     16980
     tgcttaaaga attgcatatt tttataggat gaacatcctt gtctaatatg taagtcatct     17040
     cgttcaggat ctcggctgca aggagtacaa ccgatgttgt tccatctcct acttcatcat     17100
     cttgtgtctt tgccaattct ataagagatc tagctgatgg atgtgcaaca tctaactctc     17160
     taagaatagc atttccatca ttggtaagct ctatggaatt tatctttgtc aaaaccattt     17220
     tctgcatagc acggggccca agacaggtcc ttatcaccga tgatatggtt ttggctgcta     17280
     ttgcactttc attttggatc tgtgcaggct tgtcaggtac aagaatgtac atctttcgag     17340
     gaattggttt ctgcattttt ggggctttac agattctcct aaaaaattgc tccggtcttc     17400
     catcccacaa tcttacttcg aacccgatga tgatggattt caagaagccc caaggctaga     17460
     gttcttagga attgacgact gcagaattgt taaggaatct tttgatattt ctttgaattt     17520
     attttttgaa tgtatgaatc cctcatggat tccatgttta caaaagagca cagttggctg     17580
     ataatatctt cattcttcga gcagaaggga cttgtcagac aacaactgga ctctttcgac     17640
     cagtttgtta agacaaagat gcaagaggtt atcgacgaga gtcctgcaat aattgtccag     17700
     tctgctccta cggcaggaat agaaacccaa aagagaataa ccgttagatt tgggcaaata     17760
     tatgtttcaa aacctcctat ttacaccgag tctgatggga gaactattac ggtgtttcca     17820
     aacgaagccc gtataagaga cttaacatat gcatcccctc tgttcatcga tgttacaaag     17880
     gaaaccatat ctgagctagg ggttgtggac aagcacaagt attctagagt tccctttggg     17940
     tccttaccag tgatgttgag atcgtcgtat tgtgtccttt atgggctaag cgacaaggat     18000
     ctcattgatc ttggagaatg tccatatgat caggggggat actttattgt aaatggatct     18060
     gaaaaggtga ttgtagctca agagagaatg gctagtaaca cagtttatgt gttcaagaag     18120
     gcacagcctg cgacctatac acactatgca gaaatacgtt cggtcccaga aaaaagctca     18180
     cgaaatccaa gcactttatc tatgaagtta tgcagatctc cgggagtaat aagggtttcg     18240
     ttgccactag ttaagcagga tattcctctt tttgttctgt accgggcctt ggggttttta     18300
     tctgacaaag agatcatcga tcatattcta tatgaagatg atgatgagat gtttgagctc     18360
     ctgaaggaaa gtattgaaga gggtatggtt gttcaggacc agaatgtggc cttggattac     18420
     ataggaaaga ggtcggcccc tgttggaaca ccacaggaaa aaagaataat tattgcaaaa     18480
     gatttacttg caaaagaagt tcttcctcat attggaacac aggaattttg tgagacaaag     18540
     aaagcatatt ttattggata tattgttcag agactcctac ttgtagctct tggaaggaag     18600
     aatccagatg acagagatca ctatggaaag aaaagaatgg atcttagtgg gccattgctt     18660
     gcatctctat tcaggacttt atttaagaag ttgtgtgcag atacaacaag acacatgcag     18720
     aagtgtatag aaaacggacg ggagtttaac atagcccttg gtctgaaggc aagtataatt     18780
     acacagggtt ttcggtatgc attagctaca gggaattggg gggatcaagc gaaagcaatg     18840
     caaacaaggg caggcgtggc tcaggtttta aatagataca attttgtttc aacactcagt     18900
     catttaagaa gggtcaacac acctattgag aaggaaggaa agctggcagc gcctcgacag     18960
     cttcacaata cccattgggg tatggtttgc cctgcagaga cacctgaagg acaggcatgt     19020
     gggcttgtaa agaatttgtc tctcatggca tatatttctg ttggttcatc ttctgggcca     19080
     ttagtagagt ttttagaaga atgtggagtc gaatcactgg aggagatatc cactccgcaa     19140
     ctcaatgcag ccactaagat ttttgttaat ggaatctggg ttggaattca ttcggatcct     19200
     gtgtatctca taaagtcgct taagttactg aggcggagct tggagatgga caaggaggtt     19260
     agtattgtcc gagatattag ggaaaaggag attagaatac aatcggatgc aggaagacct     19320
     tgccgtcccc tgttggtagt caaaaataat gagcttgtaa ttactccaga agacatcaaa     19380
     aggctgaaaa gaggggaaat taaatgggat aatctgatta gcgaagggtt tattgagttt     19440
     ctggatgttg aggaggaaga gatgtccatg atagcaatga acacaaaagc tcttgaagag     19500
     tctaaaaagg cttctgatgt aaagatatcc tacacgcact gtgagattca tccggcattg     19560
     atattaggga tctgtgcatc cacaattccc tttcctgatc ataatcagag tcctcgtaac     19620
     acctatcaaa gtgctatggg caagcaggcc atggggatct atgcaacaaa cttcctgttg     19680
     aggatggata ccttgagtaa tattctattc tatccacaaa agcctcttgt aacaacgaag     19740
     agcatggaat atcttaggtt caaagagcta ccgtctggcc aaaatgcttt ggttgcgatt     19800
     gcatgctatt ccggatataa tcaggaagac agtattatta tgaatcaaag tgccattgac     19860
     aggggcctgt ttaggagttt tttctacagg acatatacag accaggaatc tatgtcaaga     19920
     ccaggtgtta atgaagagtt ttgcaagccc agccgaggaa cggtcttaag gatgaaaaat     19980
     ctaaactaca ataaactgga cgaggatggg cttataagtc ctggaacaag ggttacggga     20040
     gacgacgtcc ttatcggaaa gataacacct atacttgatc ctgaaagaag cactaaggag     20100
     gcaccggttt atgtctataa ggatagtagt actgcaatgc ggagaaccga aacaggtatt     20160
     gtggatacgg ttattgttac aaacaaagat ggctataagt tttccaagat taaggtaagg     20220
     tcgggaagaa ttcctcagat gggagacaaa tttgcatcga gacatgctca gaaaggaact     20280
     ataggaatta ccttaagaca agaggatatg ccatttacat ctgatggaat agtcccggat     20340
     ataattataa atcctcatgc cattccaagt cgtatgacca ttgggcattt gatcgaatgt     20400
     cttcttggga aagttagtgc aatgagcgga gaagaaggag atgcaacacc ctttagcgat     20460
     atgactgtta atgagatctc ggccaaattg aagtcctatg gcttccagca aagaggactg     20520
     gaagttatgt acaatggaat gacgggaagg aagctccggg cccaggtgtt ctttgggcca     20580
     acatactatc aaaggcttaa gcatatggtt gatgacaaga tacatgctag ggcccgaggt     20640
     cctcttcaga ttcttacaag gcaacctgtt gaaggaagat ctagagatgg agggctccga     20700
     tttggagaaa tggaaaggga ttgtataatt tcacacggag cgtctgcctt tctaaaggag     20760
     agactgatgg acgtgagcga tgcatactct tgctttgtct gcaacttttg tgggctcctt     20820
     gcaatggggg gaagcaaagt aaatgaatgc aagggatgca acaataccac caacgttagt     20880
     atgattgaaa tcccctatgc ctttaaactt cttgttcagg aacttatggg gatgaatatt     20940
     gcaccaagaa ttcgctttga agaataaagc tatctctact gtccaggctg ttggaaactc     21000
     ggactttctc cgattccata cgtttcaaat atctttgcta tgaaacattt ttacttttga     21060
     aaccaggaat cacaaaataa aacggatcta taaaaatgaa cgaagattta gagccaatgg     21120
     atgaattcag ccgaggactg aggcctacgg acagatcttt gccaatagct aatatatcaa     21180
     agattatgaa gaagccgatt cccaaagaag ccaaagtcgc taaagatgcg aaggaaataa     21240
     tgcaaaagtc tgcgggtgag tttatagcta taataacatg cagagccaag gaaatatgcg     21300
     agtcagaagc ccgtaagact gttactggag aagacttaat aagagcaatg gacgagctgg     21360
     atatgcctta ttatgccgag ctggcaagga agtattatat tcagtataga gaacttgcaa     21420
     aaaacgaaag ggttcgaaag tattcaagaa gctttgacta cggcaagcct taatccctgt     21480
     aatgtgatat ttaaatagat caattaaaat cggttgtctt tatttaatgg gaaagaattt     21540
     attccagcta tcagctaacc cattacgaat gagtggaata agatcgatga tgagtgtgat     21600
     accccattgc acgggatctt caagatttac ctacaacaat acaactgtgt tctgcatagt     21660
     tcatgggccc tcagacagta tatctaggca agaggatcct gaaatggcta ttttagatgt     21720
     gaagtggaga gacattattc ttatcaatgg aagaatttat gacaagtatt tctcaagaga     21780
     aattgaaaag attctttcta aaagaatcat tcttgaactg gatccttgca gatcaataca     21840
     gataagtttc aatgttgtag gagaagtaag aaatactctt ttttgtgctg tgaatgctgc     21900
     acttttggcg ctttccgatg caggaattcc tcttatatct atgttttatg ccagtagctc     21960
     gtttacacat gaggaggaag tcattgtttt tgatggagat gagaacgtat tggccagcca     22020
     ttcatttgga tctatttcaa agacaggcat ggagagagca aaaagctttc ttaaatatgt     22080
     taaagaggtc cagacttata ccctgaagtc caagtttcct ttttgcatta gctaactgat     22140
     atatgtttct agatgtaagt attgggtctt gttccttggg aaaaggatgt ttaaggcaag     22200
     ttacttttta ttttttatgg ctttggaatg gaaatgttta ttcaagagaa tttcatctct     22260
     cctggttcat aacatggttt ttttctaaat cttcaagaag aattgatagt acttttgtca     22320
     gaatattgac tatctgaaat ggcttcaggg tgagaagctc tgcaatttca tcaatgcttc     22380
     tgttctggca gcctaccatc agtaaaacag atttcctaag aacagacagg tcctggctaa     22440
     acattccatg gaagtacatt ctagatatgt ctggaatgat atctgtcaca agattcagat     22500
     ctatctttcc tccagatgcc attctaattc tagaaatatc atcatatgga aaatacatca     22560
     ttctcccttt ttccgggaca gggtccttta aaagagaaag agacagagac ggcccaagac     22620
     ttttaaaact gcttgagagc tgcccgacaa atcttgacat gaatttttga ttgtatttgt     22680
     atattctatc ttcttctgtg tgagacagag atctaataaa gacagcagag tgttctccag     22740
     tttcctgtgt aacagcttgc tttactccta caggcacaaa ttgattcttc agccagaatc     22800
     tacatagggt ttcggccatc ccgaatgatg ctccaatcca actgacttga ggaattagca     22860
     catccgttat attctgcaaa agaatatctt tctctccgtc tcttactttc attgaacaaa     22920
     tatcttcccc gtgagaggac aaatgcttaa tcaacaggtt tagagatgct gttccatatc     22980
     ccatcccagc gtattccgga tgcactgcta ttctaactat acggattcca tatacgttca     23040
     aaaacgatgc atcgatatgt tcctcggaga tgacccaagg aattagattt ccttctctca     23100
     gatgtcctgt ccttgtgcat ttaccttcaa aagaaatctg aagagagcaa atgacttttg     23160
     gtatgtcctt cccatcatct tcagcaggtg ttacaagagc aaatatctcg tgtcttggag     23220
     agtctgctag aacctgaaga tcattggggc tatttttgta atgggaggaa atgaacaggg     23280
     aaaatacatc gttcaagaac ttctctgctg gcggctttcc ggaaaacaga acatctttgt     23340
     tcacataaaa aagactgcat tccgatggcc ttgggcaccc ttggatcttc ggaacagatg     23400
     catctaataa tagcgcctta tatagccagt tttctacggg atcgttttgg ccatatcgaa     23460
     ttgattcttt catagtcaat tctttgtata tgaaagaaga ggattcagcg ctgctctttc     23520
     taagcatctc cgatagctta acagaaaatg cccttcccgt cccctcgtat ccatttaccg     23580
     ttgtagccat gatgacaaag tttggaaaga tcagctttgt gagatacaca agagggattg     23640
     ctgcagcctc atcaacaact aacagatccg gatagtattt aagctcattt gcaggattaa     23700
     agtattctat aatatgcttt cttcccccgg taaactcaat cttttgcata aacctcttgt     23760
     ttcctctaaa ctggtatatg attttaaagt cgatatactt tttatatccc agcttttcaa     23820
     ggcccgtgat gagaaatagg aatactgtct taacattctc tatggcggga gaggcaatat     23880
     acacagacag aagccccagg cttattgcct ttgctattga aatccccaac gcagcagact     23940
     ttcctcttcc tcttgatgca gtgatagaaa atactgtttt gcccgctctt gactccaagg     24000
     ctttaaagat ttcctcaata atatatatct gatctctagt cttcccaaga cttttcagga     24060
     cctcactgtc tgggtcatac tgttcttcat acttatcctt gctaactttt aggtttttgt     24120
     cctttgggct gttcatacag tctaatacgt tgagcttatc gtccagaaac agtgcaaagt     24180
     tcgagcttat caatgatttg aataatcttt tgttgtatct gggttcaaac tccccaattt     24240
     tctcatggag gtcagttttg tgggatataa gtgtttctat agaatgtgca gtatccaaga     24300
     gtaacactat agctcctcct ccccttacgg tttccatact tgttgctatt aagttgggag     24360
     acaaggcttc aaaatcttgg agtatcagca tatctactgt tcttcccaaa atcctttcgc     24420
     tctctctgta ttcaatgaat tctatatctc tagctcttat aaacaacgct aaatcatcct     24480
     gggattcttc ttcctctatt ctcttcttct gtctctttcc tgaaaccctt tggccggtct     24540
     tccttgttac ttcattctta tggcaccaaa ctatactttc cacagagccg tttgtatgtc     24600
     cctgcaatat tctgtggatg gctggaatct gggcttttcc attctccccc aataaaataa     24660
     cgaaagatct atggtttctc cttccgtttt cttcaaagaa gttttgaatt cctctgtcgc     24720
     atagaagcgt cattagtaaa ggattatttc caaagaattt atttaggcaa agggctggaa     24780
     aatctgctaa atacagagat agaggttttc aaacggtcat ttgtatttcc ttattgcttc     24840
     ggtgatggtt cctaggaagt ttcttttgtc tcgaaagtcg aatccaagcg gaagtttaaa     24900
     tcctaatggc tcctctggta caacaaggtc cagatagaaa tcccctggag gaaaagaaaa     24960
     acaagtattt tgcttttttt cggcgttctc actctccgcc tttttgttct cagtcttcat     25020
     atctttcaaa atagatgcca tttctgctat cacttctttt ttttcaaaca tttccatgta     25080
     ataggccttt ctcataagcc tgtgctttgc accctggaaa tgtatccttc tgcttttcag     25140
     cttgtcgttc agcagtgtct tgttacaaaa ttcgcagaaa tactttgcca taggaaagga     25200
     tagagtttct ttgtgaattt tgagtctccc cggaactact ttgggtattg ttgactgaga     25260
     gcggtaagac cttgtagcaa agtggttaac gcggtagatt gctaatctat ttccctctgg     25320
     gagcacgagt tcgaatctcg tcaaggtcgc tttttgcacc agtccccttt ccattataaa     25380
     caaaatactg ttttgtaata ccctaatgag gaataattac gttccacaag aaaatgcttc     25440
     ctcccactca ttatctgtcc acaccacaaa gaagatagaa aagggaaagg gagagatgta     25500
     tgggctgaaa aatctggcag tgataattgc ctttttaagt gttggaaaat tcataataga     25560
     taacaataga gaatttggct ttctcatgtc actacctctt cagactcttt ctctgcttga     25620
     gtgttcttgc tttctcttgg caattcttat gagttttgta cgctcactct ttggattcta     25680
     catagaggcc agaaagcttg ggcacttata tatatgttta aacttaggtg tctttgaggc     25740
     gtttattgca tacttgaact taaactacat acgtcacata tattcctctg gatggtcgat     25800
     gatacttaat gttgtctaca cagctaagct tatctccttc catttggttg tgaaagagct     25860
     cagaagagac cgaaagatta acatagaaga ggaattaagc ataagacatt ttctgtactt     25920
     tctggttgtt cctactctct gcttccagtt acaatttccc atgaggtctg gaagaaatat     25980
     caaaggcatg gttctgaaaa ccattcaact tctagtaggc ttccttcttt ttgtcctggt     26040
     tatggatcaa tatgcaatcc ctagcatata tagaatcgtt aattttgaag atctaacgac     26100
     agtaattgaa aacataatca atctttcaat aagtaccata attctgttct taatattctt     26160
     ttacacggtt ttttattgct ttctagagac tgttgccgac ataacactgt tttacgattc     26220
     atgcttctat caagaatggt ggaatgcatc ttctgcaagg gaattctggg ccttatggaa     26280
     cagacccgtg tatctttggt tcaaaagaca tgtgtatgct ccaatggttg gaagaggaat     26340
     ttccaaggaa agggcaggag taatagtatt tgcaatgtcg ggattgatcc atgaatatgt     26400
     tgtctccatc tcgataaaaa aattcacagg atggtttctg ataactatgc ttcttcaagt     26460
     tcctcttatt catgttacgg agtcattcag acggaaattt cccagtctgg ggaacttttt     26520
     cttttgggga gctttttgcg tgattggcca gccctctgta atattattat attacaggtc     26580
     tttatatcta aaagaatgtc acatgtagaa gcacaaatct ggaacatact accttgagtc     26640
     aagaatcagt atttgttttg aaggtaatta gatctataaa aataaataaa taagcctaag     26700
     ggatgaagga aatggtattg aaaaagagaa cgtttttgca tgatgctata gacatggtgt     26760
     cgatggggag tcatacactc gaaaacgacg actttacaag atgctttcaa ccagcagcgg     26820
     caatcgaaat ggactcaagc gggatatttt atacgttctc ctttgtaata agatatttta     26880
     ttttgttccc gatgaggata gcatttctta tcttgtctat ggccgttttc tttcttatga     26940
     tactccgagc agcatttaca aaaaataaca tgcatctgga gagtgcattg atatttggag     27000
     ccaagtcctt gatgcttgca atgaatgcaa agataaagca ccgagggata aaaaagaggc     27060
     aagcagagcc tcatctgtat gtttcaaatc atacatcatt tgtggacttc tttctcctct     27120
     gcagccataa gtttcctcat gcctgtgttt ccgaaatgca tggtgggctt tttgggtttt     27180
     tgttcaactc catcttgata agaaacggat ccattggatt caagaggagt gaaaaggttg     27240
     acaggcagct tgttgtggag aagatcaagg aacatgtgag ctctggagga gcacctatgc     27300
     tgatttttcc agaaggaaca tgcgtcaaca acaagttttc ggtactgttc cagaaaggtg     27360
     ccttcgagct cggtgtaaca atatatcctg tagccataag gttccgtaga gggctgtttg     27420
     atccctactg gaacagaaga aaccatgggt ttgccatgca catgttttat ctcatgaccc     27480
     gatggagact tgaggccgag gttacatgga tgaaaccaca taacattatg aagaacgaat     27540
     cccctactca gttttctcat cgagtcaaag ccgccatttc caaggaggct gggctaagga     27600
     acacattatg gaatggcttt ctcaagagta gcccggctat caaagataga gaaatactca     27660
     gggaatctta tttaataaca tacggaagga ttgtatcaaa ctctctagac aaaagtaatg     27720
     ctgtcgatgt agagaaaaac agattctatt tatacgataa caatatcgac ttttcttctt     27780
     caagaagcca ttcctatttc gaatccatga tatcttacaa gaaatttcag aacgaagttt     27840
     taaaagaata cttgagactc aaagagcttc cccaaaaaga cctgaagttc cttctgtcta     27900
     accacaaaag ccgagaggac tctcttggag actcggaaag aaagggattt tgcagctgtg     27960
     ggaccaagaa aggttctaaa ggaaacaatt tcaagaagaa gcagagcaac cctcttatgt     28020
     tctgcaagta tgagagtttt aagagtccaa gcctgggata agcacttcgt gttttataaa     28080
     gcaaagaaaa agccggcagg cgcttcttag aatcattcag aaacaaaatt tgttatcttg     28140
     cgttttacag acccaagctt gcattggcta actctatctg caaaccgaag agagcatact     28200
     gtttcattga aatgttctgc atcaggtgaa atgttgacaa gcatgattgc cctggagttg     28260
     ccagataaaa aactttgtaa aagatgtgta agcttcgagt tcctaaatgg gatatggcca     28320
     tcctttctta gaatagaatt aaaaacatct cctagtgccg ataaactttt gtttatgttt     28380
     tgtgtttcct ttagcctagc cccctcggcc ttagaaacac taagcctttc tgatcctgcc     28440
     aagtctatga gcgccatgac cccttccttt tcttcctttg aggttttatt actcattttt     28500
     attttcaaga tgaaaatcac atggcttctg ctcgacttca tattgcagtt ggtgtctcca     28560
     attttttttc tccgagcacc actttggaat aggccaatgg cttccgatgc attggaaaca     28620
     gatatactaa tgcagtccac catatttaca tctccacctc tatgcacaat tccaactttc     28680
     ctcatgtctt ctgaaaacag atctacaaca tcttcgttat atatttctac ataactgcac     28740
     gtgatgtcaa acacccagcc gtccgttctc atttcttcaa tgatgctgta gatatctttc     28800
     aacgttctaa caatcagccc tggattatta tcattccctt ccatagtata agtctttcca     28860
     cttccagttt gcccgtatgt gaacacacaa actcgatacc cctccagtac tgaacgaagg     28920
     atcatctcca tttctccata tacacattct tgtgttgtat gcggcccaag caccttatca     28980
     aatgaaaaag aatgttcctt acctcccata ctaattttca gagctccatc tgatatttct     29040
     attctcgatc cctttctccc agctgtattg ggccttatac ggcagattac ttgtacagag     29100
     cctttaagat ccattatttc acttttaagc tttgatataa cttctttata ggctaagcac     29160
     tccttcttgg tctcttccag ctttgaagcc ctttctttgt attcatcaag acaggactgt     29220
     atccttaaat tatctttacg aaggcactca tttgcagaca caattctaga caattcttcc     29280
     ttcatcttct tcacttcgtg attcttttct tccattgcaa tggcaatatc cttcgcctgc     29340
     agctcttctt tataggtgga gaaatcagtg actttactta tattttctat tatcaactcc     29400
     aactccttaa tcctctctaa aagctcagat tccctgtttc ttgtagactt gctacatcca     29460
     ttatatccac aagttccagg agtgcatatc tcgagtaaaa cagagtcctt tctgaccctg     29520
     ttcggtattg tcgcattgat gttttctttg atttcactaa acatttcctt tatctcatct     29580
     attctgtgac gaattcctgg ggttaccatt caaagggtct gtgaaccttc gcattaagtt     29640
     tgactttgaa ttaccatgct cctgatgtta taatcccaca gttaatggga actataggct     29700
     gatttatttc atatattcta tattccagtg gtcggtgaga aacaattgtt tgaaatgact     29760
     tctgtccaat agtttgagat tattcaacat acaattcttt tttagaatca tatatctctc     29820
     ttttttgtcc ctagaaatga agtgttctgc atgccaagta gaaatagagg aaaatatcaa     29880
     agctcattat gcttcggaag tgcacaagat aaacgtcaag aggcagatct ataatgcacc     29940
     cccgataacc attgaggaga tcaatggaga acagttaagt gatgacgtgt ctctagaaat     30000
     taacggactt gagacgggag agaagtgttc aagttcgaag aaatactcca gaaaaaggaa     30060
     ttcatcaaaa gtcgtaggtt gttctccaga agctgtgtgt ttattctgtg agttcccgga     30120
     gagcaatact cactatagag atcatgggct atctgacgaa gaagttgcat acatcgataa     30180
     caaagtttgc tatatgtgtt atgaggcttt tagtgaacgg gagagcctta gaagacatat     30240
     ttcctctgga aatcacagaa atgccatgac tgacggggtg aatcttatat tagaaagcgg     30300
     taaagttata caggggagag gccgtaatag atcgagagaa gaagaaccta gacggcctga     30360
     aagtagagaa agaaatatga tagtgagaag tcaggcaaaa gaagatagaa gagctatcat     30420
     aaagaacaag aatcggctga agatttccct ttccatgaat tttcaacccc gtttcaaacc     30480
     tgattggatg caataagctt ttggattgaa atatcttaaa aacagggata ttgtttgtga     30540
     gttatgacat ttcagaaact atttaaaaaa atcttggata cctaacccac aaatgacaag     30600
     ctactcgaca ctcaagattg gaaaaaagta ctcacctggg ttcaagacgt acgtgacaca     30660
     gaatgggaag atagtttctc cgtttcacga tattcctctg cacatgacag aaaataggga     30720
     agttatatct gtgatctgtg agatccccag gtttgaaaat gggaaatttg agatcaataa     30780
     aaaagagagg tttaatccaa taaagcagga tgttaagaat ggaaagccaa gatttgtaaa     30840
     gaatgtcttt cctatgaaag gatatttgtg gaattacggt gctataccac aaacatggga     30900
     gagccctcat gagattgaca aacatgttgg agcaaaggga gataatgatc ctttggatgt     30960
     cattgaaata ggagggagga aaaagaaaat aggagaggtt tatcaagcaa aggtccttgg     31020
     aagtattgca ttggttgacg aggatgaatg cgattggaag gtgatagtca ttgatgtatg     31080
     tgacgaaaag gccaatgaga tgaatgacat tgaagatgta cagaagatgt gtggaggatt     31140
     acttgagcaa accaagtttt ggtttgagaa ttacaaggtc cctgacggga aggggaagaa     31200
     cagttttgcc ttggatggaa agtacatgaa caaagagttc actctaaaag tcatcgggaa     31260
     tgcacacgaa agttggtgtg gaatggtgaa ctccaaggac agtgaagata tttgtaagga     31320
     gaattccact ctaatggata agattgatcc tcccgctatc actggagaag atttgtccga     31380
     ctcagaaatt cctgactatg tcaatcagtt tgagttcatt aaatgatggt ctgatatgta     31440
     tcatgtctaa gctattattc atatatccaa aagacagagg accctaataa ttagtatgaa     31500
     gaatctgaaa ctttcccagt ccctagttaa taaattaatc tctaaggctg atgttaagtg     31560
     taccaagagt gcggagaaat tattatctaa atcgattgtg atttctgtgg catttttatc     31620
     catgtgcatt gacgagttat ccgatgaaaa ctgcaaggaa gaagatgttc ttcaggaagt     31680
     tttggtagct cttggagttc cagtaaccca taatgatgtt cccagcttga gccaaaaata     31740
     ctaaaagata tttattctaa gaaacaccca ctccattcta tccttaacga caacacttca     31800
     tgcatgataa aaagctacat gattcagcat cagatgttgc ctgctttgta tcccatatgt     31860
     gttttgctgc ctctagaaac acaagattca cattttccct tgtacgcgaa gaacattcaa     31920
     aaaaccttgt cgcattaatg ttatctgcga ttttccttcc ttcgctttcg gaaatcattg     31980
     aggatttatc aatagttggg tcgtccaagt ctcttatgtc tttcttcagt ccaataagaa     32040
     agaactggga cgaggggcaa tagttcttta tttccatcag ccattttctt gatatgtttg     32100
     gaatcttctt cttgttttct attgtgtagc ataacaatac aaggtctgtc tccttatatg     32160
     aaagaggtct gattgtgtca taatcctctt gccctgccgt gtcccacaat gctaaggaaa     32220
     catacttgtc gtccgaaatt tttacttctt taacaaagtt atcaacaaca gtgggaatgt     32280
     atgtttcggg gaactggttt cttctaaata cctcgagtaa acatgtcttt ccacaggccc     32340
     cgtctcccac aacgacaact tttccagact tgtgcgtctt gttattcatt atttagtttt     32400
     tttacttctt tctttttatg tgaagcttaa aggagatttt ccatttgtta ggcctccatt     32460
     tttacatttc ctacatcatt ggttatctgg aggtctgcaa ttggtttgtc ttcttcaaac     32520
     aattaacctg ataacacagc aattaaatga gggaataggg gaagcttcat caaccttagc     32580
     aacaacaaat aagactgtgg attttggaac taactacctc ttttttcttt ttttcttaga     32640
     tattcccata aattccagtc tttctctctc tgcaattgca cttgcttttt ttgtttctat     32700
     tctttgaatt atacggttaa gtgggacggt atatttcttt acatgtccgc caagcctttc     32760
     catttttttt ctctttagag taattctttc tttgggtgtt ttactattct ctatgacctt     32820
     ctcgatttct tttatgcatt cttgaagctc cgcttgtact tttctcggca tggagggtat     32880
     gcttatgtga gtcttaagtc tctgtgagcg gggagttttg tcattaatct ctataaacat     32940
     taacccctag aaatgagctt gacgatacct gggctagatc ttataagaaa cgagattgag     33000
     gagatcaaaa gtggaaatct tcgatataca atcgccaatc tgtcgatcaa agagcctata     33060
     tcattatctg tcctccgaaa cggaggaagg gtcaaagact ttgattacaa gagaaagtac     33120
     accataaaag agcttcaggg gatatttgag gaattttcgg aaagtgtcaa tgagcaggat     33180
     ccctgtcttg tagtatatga cttcatacac ttcgacgatg atggaattca aaaaaacacc     33240
     ctgtgtttga tctcctacat tcccgagcat cttgtaccac ttaagaaggt tgcatattct     33300
     accaatgcct taaaccttaa ggaactactg gatatttccg ttcatatctc cataaaaaag     33360
     aaatctgacc tcatcttcga taacattgcc gagaagtgtg cagcgtcacg gatgaaataa     33420
     atgttttatt attatgccat ttatattcat cctactgatg tgccaatctt aaatatttcc     33480
     attcaagata ccaaagagat gggtcttgga ataaacacaa aatctgttag aggactaaga     33540
     agatttacaa gaagtaagac ccaagttatt ttcttcgata attcccgttc tccaaagaca     33600
     agtaagaaca cacagaagca ccaggaatgc agggaagacc agcctgctga aaatattcca     33660
     caagtgagta atgttttgaa ggccgaggag agaatgtttc cttttgagaa gctcctagaa     33720
     acctttacca acttggaaaa aaagaagata cagaaaacct taaggccctg cgatggcatc     33780
     aatcccatga agactttgag gaaagattca tttgcagaaa ggtattttga ctctccttct     33840
     gggaccttcc ttggaaaaga gagacatata tcttcatctt ctcaagagcg tacataagat     33900
     tgatttggaa accagggaga tctaagatgg agtaagagta cagatggttt taaaaacttt     33960
     ttgcgaagag gccaagccat ggaaaataaa aaagaagaaa tcagaaggca ctataacaac     34020
     attagggaaa aaggaaaaga aggccgacag aagagtaagg ccataaatat caggaataca     34080
     aacaatttca tcaaatcttg tcttataagg ctatacacaa agaaaggaga cagtgtttta     34140
     gatcttggat gtggcaaggg aggagacttg ttgaaatacg agaatgcgaa cattagcgag     34200
     tattatggaa ttgatattgc agaggtgtca ataaatgacg cacggataag agcaaagaac     34260
     atgaagagga ggttcaaggc ttcattcaag gctcaggatg catacggcca ggagatagat     34320
     ctcgggaaac aatttgacgt agtgtcttcc cagtttagct tccattatgc cttttctagc     34380
     agtgagactc taagtatatc ggtaggaaat gttgcacggc atctgaagcc aggtgggtat     34440
     tttattatga ccattccatc cagggatgtt attcttagaa gatatgaaca ggatagaatg     34500
     tctaatgaat tctataagat cgaaatcgat aggaaagagt ccattccaaa ggaagacatc     34560
     aaggaatatc gattcaccct ggtggactcg gtaaataact gtattgagta tttcgttgat     34620
     ttccctacca tggtaagtga attcaagaag ttaggagttg tgttggtgga aagaaaaggg     34680
     ttcattgatt tccttgaaga ggaaagtaaa aagaaccttg agctatttag gagaatgaaa     34740
     gttaaatgtc tagaaaaagg agaattagaa gttgttggga tttatgaagt tatcgttttc     34800
     caaaagctaa gcccgaagga agagtcaagt gttcaataaa aatccaaatt gatctccaat     34860
     ctcatctact ttcttccgga ggtcattgga caaccttggt ggctcaaacg caagaatatt     34920
     agacaagtag tacataacta tggaatgccc ttctaccaat ggttttatac gccttaagat     34980
     ccttagatgc tccatcggca tctcttctat aattcttaca atctccatca gaatctgtac     35040
     gtccgatgct ttttgctcaa tcattccttt cactattcct attatttttg tggcatggcc     35100
     ctccatgtat ttgtttatca tcttgtacaa gtctttaaca tcttccgagt ctggaggtcc     35160
     cagcaaatgc ttcgtttcgt agatgtcctt tattacagat tcgagatcag agaacttttt     35220
     tagctccacc gactcatagc atttatctat atattccagt accttatttt ttagatgtct     35280
     tttctcttct ttggaaacaa catcaataaa aagattgaaa acatcctcca tgtgtgccat     35340
     tgcatcttta aatgtctcaa ctgttacaga aggtatcttt ctaaacccat cgtcaatcac     35400
     tttggtcttg accctcttaa gatgagaaaa gtaaaccatt ttggcatctg atgaaagctc     35460
     gaccaccttt gtgttttctt ttagttttct tatccacacc ttgatgaaaa gtagttcctt     35520
     gttgtacaaa atcttttcaa tacattcaaa atagtgatcc gttgctagga tttggatctt     35580
     tccatcaacc ctccccataa tcttcagata gtgtcttgta atttctttca gacactcttc     35640
     ctcatctaga taagatagtt ctaaactctt tgtactattt tccttgaagt tgactaatag     35700
     agtattcata attttatgtt cggacttgtg ctcgcaaacc ttaaaataca aatcaaagta     35760
     gtaaagtgcc tcatggaagg tgcatccagg cctctgaata ttcctgtaga tgatttctag     35820
     gaattcgcat ctttcatcgt ggatggaatt ccaaaccttc tgtatataca cagagttctt     35880
     cagttccaaa tacatctcca tggcgccttt gtatatgtca acaaacctct cgagattatg     35940
     gagatttctt cgaagataaa acttgacatt gaacaataaa gaatatttct tcatgtagta     36000
     ctcccttctt cctccctcta tcttcccttc cacatcatca gatattcctg aggtcatctt     36060
     cctgaacttt tcttcaacca ctttaatgtt gttttcaaga tctgtggtga attccttatc     36120
     atatcctttc tgcttgatat ctacccaaat ctcttctaaa actgttctac actgcacaaa     36180
     ctttccaaag tgctgcttca caagctgctt atttctaacc tttgttctat ttatcacctt     36240
     tgtcaagaat atcaacgcat cattcagatc atactcggta gcatttgcat atgtcttgtt     36300
     tatcacatcc actgcattga actctttgcc ggggttgcct ggctcctggc tctccgcatc     36360
     catagccata gacaatagaa aaattttatc accttgtatt agaaaaaaac aaatggaatc     36420
     acccacatgc cagggctatt tgctgccaac aatctgataa agagcagaaa ggccaagaga     36480
     ctagccgata ctacttacag aaagcgagcc cttgggacaa agtacaagca tagtgtgctt     36540
     ggaagagccc cacaagcaaa ggccatcgtt ctggaaaaga ttggagtgga agccaaacaa     36600
     ccaaactctg ctataagaaa ggctgttagg tgccaactga ttgccactgg aaagaagata     36660
     acggcattcg tgccctatga cggatcggtt acatacatcg aaagcaatga tgaggtaacc     36720
     gtagaaggat ttggtaaaaa gggaagaagt tttggagata ttcctggaat tcggttcaaa     36780
     gtctgcaaag tacagaatgt gtctttgcat gcaatattta caggaaagaa ggaaaagcct     36840
     tcaagataat attaaagttc agttaactgt ttgtatttta acgaaaaatc tttacttttg     36900
     ttgttttttt tgctcttcaa gagacaatcg gatggcttct gccaactcgg gatcatcctc     36960
     ttcaaccaga tcattcccgc ttataaacgg tagaacccgg tcaataaact cttcgttggt     37020
     tttaacctct atgcaagaaa agtttgtgaa gtcgatcttt ttgaaggctt ctaccatttc     37080
     tactgcttct ccgaaaaaaa ccattttgat tccaatgcca aatgtcaaga gctggtatat     37140
     ccttgcaaat agctcatcct tctccgactc ttggagctct gaagccagaa agaccactag     37200
     tatacatcca ggagaatctc tctgattgaa gatgtgaagg gattgagaaa gacatctcat     37260
     aatgtctcct tccttattca actttatgtc attaagaaag gtttttatgt gtgatctctg     37320
     ctttgtaggt gtaattatat cattggattg tacttgcacc aaaggaatga ttcctattgt     37380
     attttcttgg ttatcctcaa acttcctaga tatcagagat tctactgttt ccttctgtac     37440
     aatgaatcta ctaggaagat agtcttggtt ttgagaagcc attccattat caaacaatac     37500
     aacaatagtt tcaggcatct aggggtggcc tattctacaa atttagaaga aaaacttctg     37560
     gaaagagcct cctagaacaa ctctacccaa agaggccatc cagctggtat ggaaactatc     37620
     aagtatgatt tattaaggat ttatcttagc attcagtcaa ttccacattg ataaagtcat     37680
     ttttctcaat ggattccttg tattttttgt ttatgtaaag gacagacctg acccacatta     37740
     tacaaaatat ccctacaaac acagtggata tagaaaccat gtttctaaca tctcgaacat     37800
     caaacaccac cgttataaga gtgcagtaca cagaccctat tgtttttcca atgtttatcc     37860
     ctagcccatc gtgtattccc ctgaaggaat ggcgatgaga aggggggact cttatagagg     37920
     ctgcttcctt tgcaacgtca aaaaaacaat acttggatat ttttatgatc gtattcaaaa     37980
     acatcccggt atagttttcc aaaacaaagc tccccaggta cccctcccgg ggtgtgatga     38040
     cttcatcttc agaaatgttg ttgaagaaaa ccatgggaaa aaacaaaacc aatgtgatta     38100
     tagcgatagc aggtgctgtt atggccacta aaaaccatcc ctttctctct ataagatgag     38160
     ttgcaggcct gaagaacatt acaatcaaaa aggcggaagt tattatctgt gccatggcat     38220
     taagtttgtt gatataagaa gatccagaca aagaagcctg aacagctccc aatactactc     38280
     ctcctctata ggttgcttcg aatatgtttg agcacacgga agtagctatt acagactcgg     38340
     tcattgccat gagaaaccta gacttcctca ttattcttaa cgacttagta aaccccattt     38400
     tgtggtcctt atactccttc ttacttccat actctcgatc gtcttttggt gtaaatttgt     38460
     cggtgaaata gcttgttatt gctgatacag ctgtcaaaat ggatgttaca acaaatacct     38520
     gagagaacag actttccttt ttgctatatg gtagggtgtc cctataactg tttaggcttc     38580
     ttgtaagcaa accagaggaa agcaagacca ttcctgatat caaggatacc accggtaaga     38640
     acttctttag ctgggcttct gtgctctgat gaattgctct tgagaagaac ataaaggaaa     38700
     ttataagaga cccccacaac tctgccacaa gatataacac agtagaagcc cattcgttaa     38760
     agacaagaaa tatgggaaag aaaaagtcca aatgtcttat cttcattttt ccatcgctga     38820
     atatatctct tgaccaaaag aagtctggct gaagcttctt agaacagggc cagattacca     38880
     acccaaatag caagaagaac acagataaaa ttataaggac aacttcgaga attcttggct     38940
     ggctaagaaa tttcagccct ttctgtacaa taacgatgaa aaagaaagtc accggtaaga     39000
     ctaacacaga ctttatgaac aatatcgagc tagggatttg agtgttcatc atcaccatat     39060
     cgcctagaat gtacaaaaat gcgtcaatgt acgaaagtaa agcataaagt aagctaaaaa     39120
     gaagagttgc cttggtgtcg ttgctgatat cattaattct ctggagggtt ctgctatata     39180
     tggaagcaca atgtctttct tttccaagta tcttgtcttc gcagccggct aaatcagtgc     39240
     attcattttc tagcatttag ggtattatct taagaaaatt aaattggttt gttatttaag     39300
     actttgattc ttttgtatga catgtttata ttaaaccgga gagccgagtc gagaactaga     39360
     cctcatagcg aagataatca aaagagaatt gatttctccc tcgcaatccc aagtaatgga     39420
     tgataattgg aaagccttca acttgaaaat cgagcatgga ttaggacaca aaaggactct     39480
     tgaatgggaa aggattgtaa agcatcgcat aagacaaaat tcgctaaatt tagcaagtga     39540
     aaatgaaatt gagcggtatt ccgataagta ctttaaaagt cttctttcag aggacatgat     39600
     aaaggagata gtaagtgtgg aactgatgcc acccgagatc tcaaggacat ttggagaaaa     39660
     gaaagagaag aatatggagg acattgaagg aattgaaagc tcagcttcgg aggagtatga     39720
     tgggtcggat gaaactgaga atagtaatga tgttgaaaac gactatgaag agaacttcta     39780
     tgaaaatgaa gaggatgatg agcttactga agaaaaagat gaagaaggat tcttctgata     39840
     taagccgagg tggacgggat agatcttcgt ttgtctaaat ataaaatttt tgtaaactca     39900
     atagccttgg tttggatttt agaatggaat tcgatgaact aaatattgat gattctttgg     39960
     tacaagcatg ccaaagaaat ggaattacta ggcctacgga aattcagaag caggtaattc     40020
     ctatggtact tggaggaaac gacattatag ctgtttcgca gacggggtcg ggaaagaccc     40080
     ttgcatttgt tcttccaata gtgtcacgcc ttctgctgaa gaacagatct tttttctgtc     40140
     tagtggttgc tccaacaagg gaattgtctt cgcaaattgc cgaatgcttt aatatgtttg     40200
     gatccacagg cctgagggtt tgcttacttg ttggagggac taattttaat cttcaggcca     40260
     atcagctttc caagcatcct catattgttg ttgggacacc gggaagaata gctgaacata     40320
     ttctaaagac caagtcattc aaagcagaaa gaataaggaa acttgtgctt gatgaggcag     40380
     atcgattctt cgaacaagac tttgtagagg atttggaaac cattatccga agcttgagag     40440
     agaagagaca gacactcctc tttacggcga caatgtctaa tgaaatatcc aagttgtcca     40500
     gttcgatact tataaagccc aagaccattc gtgtagtaga aggatatgaa acggtttctg     40560
     ctttgaaaga atactatttc ttcacagcaa tgaaatggaa gagttctgcc ttggttgaat     40620
     tccttgagat gaatccaggt gcatctacta ttgtatttgt atcaatgtgc ataactgctc     40680
     gagtaatgtc tctggcgctg agtaagcttg gattccattc ggaagcactc tatggggaat     40740
     tgagccagga aaaaagagaa gaaaccatga ggatgttcaa ggagaataag ttcagcgtcc     40800
     ttgtttgcac cgatgttggg agcagaggat tggatataag ccatgtagac ttggtgataa     40860
     acttcgatgt tccaaagagt ggaaaggact atgttcaccg tgttggaaga actgctagag     40920
     caggaagggc aggaacagct attacgctcg tgactcaata cgatgttgaa caacttcaga     40980
     gagtggaatt tgtgctgaag aagagtctag aagaatttaa accggtaaag aagaacttcg     41040
     aatcaatacg cgagaaggtt gaagaaacta tccaagaagc ccaggagatt ctcaaggggg     41100
     aaagaaaaag aaatagaaga cattgatgca taggactatc aataaagata agtatttaca     41160
     ttctcataga atgaagaata aattagatat ccgcttaggt tttattttga gttttctaat     41220
     ctatgttcca tctttttaag tgaatagaag gttaaaacag agatgaaacc acatcggaca     41280
     caagtatcaa catgttagag cttgaaggat tattgaaagt atttactttc cttggagttc     41340
     cacatcaatg ccgcccgaag gtactgatcc agaaagagaa gtaccagaag aaaagataaa     41400
     agaggaggaa aataaggagg ggcctggaaa agaggaagaa ggagagaaaa agaaggaaga     41460
     aaaaaaagat gatggagtaa tagacgatat cattgccaac aacgctgttg atgcacctcc     41520
     tgttgagccg gaaaatgaaa taatattcac aaaggccaag gtgtttgaag aggaagagct     41580
     ttctttctgg aatatagaca gctatttgca cagtaagttc tcctatatcc ccgaggtcat     41640
     tagaagacta atagaaatta ccattgtggt atttctattc atggtttttc ctctagttct     41700
     ttcgtttttg gaagatggaa aggaagtatt atacctcccg aaacaggtat ttcagaacac     41760
     cggacaaggc ccaacatact tattttttcg gatcaacctt ttcatatcaa tgtgttatgt     41820
     gatttacgtg gtggtctctc tgtttgcaag taacatactc tatatcatgg ttggggttct     41880
     aaacttcttt aactacgatc ttgacgagta caccatagag atcattcaag tgataaactc     41940
     gacgtcgtgg tgctggaagc aatccctaat agctgctctg atttttttgg ctgcatcaat     42000
     cacctcccag ccgtatgatt ttggaaaaaa tgatggaagt tataagtaca aagtcgtcac     42060
     catgatactt atgtactctg tctttatatt tgttgtgttt cttgagaaat tctttatgtg     42120
     ctttatgatt tcagagataa gaagaaagga atacagaaac agaatatggg atatcaatta     42180
     caagacattt gtgttcaaga agcttgcagc aatttccgag gtttcttcgt ccgaaaggaa     42240
     ggagcttgca gaaaccatcc agccagactt cgatccaggg ttttatttaa aatataacga     42300
     cttaaaactg aactcggtgg aagctgcaga aatggttgcc gagtcgatat ttggattcct     42360
     ggaagttcaa acgattatat acgaagattt agagaagttc tttcccgaca atcacaaaga     42420
     agtgtataca tacctggcag acaactcgga agttaaagat aaagacaatc ctccaataac     42480
     gtttgaggac cttaaagcca aggcaatagc cttgtataag gagaggacag acatatcaag     42540
     aactcttcag tctagagaca ttatcataaa caagttagat ataatactgg ttggaattgc     42600
     aatgtacttc ggggttatat tagtgatgat tctcttagga atcaactacg aagggatgct     42660
     tgcggccatt gttccatcaa tagttacctt cagttggata ttctccgata ctgtcaagga     42720
     gatatataat tgctttatat ttcttctagt caaccatccc tacgattgtg gagatagggt     42780
     tgtaatcgat ggggaagaac tttatgtgtc ctctgttgat ctcctatcat ccacattcac     42840
     tggagtgaat gggagacaag tactcatacc gacatctact ctgttcagag caaagatcca     42900
     taacataaga agatcaggaa agcaattttc tgaggtcagc atcctagtaa gtaggaaaac     42960
     ttcatttgat gcagcactca ggcttaagga tggaattgca aaaacatttt ctgagtctac     43020
     gaagtcattt tcgggggaga tttatatccg agacttcagg actgaaggag aaaatgtcaa     43080
     gataattttt gcaatacaac atcagtctaa cttccaggat gttaagaaga aatacagcag     43140
     aagggctgaa attgtaaata tactagaaaa ggaaatgaga agccagggaa tagagtactt     43200
     aaactcatac agattcagtg attagttcta aaaataaaat acttttatta gaacagatga     43260
     agcgttttga gtgaagatgg atttgggagg gatcgaggac acaggtggaa ggcgccatgg     43320
     tccagtggta cgatacgtgc ttcgggtgca cgcgacccga gttcgattct cggtggcgcc     43380
     cgaggctttt tcattttctt agaatcgtat gcttttcgcc cgcaacaata cctaaatgaa     43440
     tactagttcg gtgggaagtc acccctataa atggagtttg gagacaaagt aattccctac     43500
     gatcatgtca tcataaagac aatgcattcg tttatattca caaacctcag gccttttctt     43560
     ccccttcaca tacttgtatc tcccatatct aaaaagcaga ggatatatga gttaacgaat     43620
     gaggaaacat ccgacctatt caacacagta agagttgcga tgttaggtct caaagaccta     43680
     tgcgatggat ttacattagg tgtccaagat ggttcctgtg ctgggcagac ggtgtttcat     43740
     gttcatgtcc atatagttcc cagggtagtt aaagatcttg aaagaaacga tgatatatac     43800
     gaaaaaggcg ctttggattc tgccgacagg ccggcaaggg aatacgatga gatgaagaag     43860
     gaagctgcaa agcttagaaa aatcataggg agagcctttg actctgaagg attatattat     43920
     cagaacagct ttgaatgatt ctcccattgc tttctacaat aaagtagatt tttattaggg     43980
     cccacgcatg ttggagcttc ccccagatac cagaaaaggc tttttatatc tggtcgatag     44040
     agaagtcttc tccaagttca agggatatgt agatcttgac ttcctgtatg aagaagacca     44100
     tggtgaagta aaagtagcct ctgtcagtgt attagaagat agttttatgt ggtctgaggg     44160
     aaatgaggag aagtctgctc tcccaagtga atttagatgt tcccatggaa acgagataac     44220
     tcataaatca ttgaatcttc ttccccagga gggatgggaa gagttgatag actgctggtc     44280
     atgccacaac tgcgagttca gaaccatgct agatctcaaa cttcggccta gagaaggggg     44340
     tctgcttctt tccgatttct ttttccttgt aaatgatcga gatctcccag aatgctgtag     44400
     aaaaaatgat tcttctgtaa gaaagctgtt ctacaacgaa attgagcaag aggaattcac     44460
     ccacagagct ctaatctact catatatgaa ccttcatttt cgaaacaaga atgttctttt     44520
     acttgaagta aacgaaaaga aatacgagat taggtacttt tataagacaa tgttggtatc     44580
     tgcaaatggg aagagtttgg agaaaaagga ggcaatgaag gtaggaatca aagaaacgga     44640
     caagcttctg gaagaaaata agaacataaa caatttctat tctaagctta tatgggatgc     44700
     agtaacatta ggcgcagttg gaataactgc cctaggatat ggaatttcat ttgtaacaga     44760
     aaagtaaaat tgctgttaat ttattgattt ttggaatctt acttgggaat agcccaagac     44820
     gatacttaac ggtgcctaca gctgaagaag ctgatacccg ctcttgttat gttttctttc     44880
     gattatacta agtagttttc tagctgcact tgaaatctct tttcgggtgc tatccacgac     44940
     aagtgcaaag tacggagagc ttttgacaag gcatttcttg aagtgataga ccttttggta     45000
     tagaacttga agtaatttca gaataataac tgtcttgtct cctttcatac tgttgagtat     45060
     tagatcgttg gcatcctcga tttcttttgg attgtgtcta aggatgctac caatacacct     45120
     tgcatacaga acatccggat catcacagta aaacaaaaag agaatttcaa acatctttct     45180
     gtgaggaaga ccatactccg aatcccagta tagataatcg gttataaatg atatcgcatc     45240
     tttatccttc tcttcgacca gcttaaccat gacatctgca tatggcttga agattttaaa     45300
     gcaaagagaa aaagatgcct gggatacttg gaagaaaacg catctatttc tttcgtagat     45360
     gatccttaga agagattgga tctcttcgtc tgcctcaggg tttaccttta gataaacctc     45420
     aaagaacttc gtaagaagct tgcctttcaa cttcgagaca tttgagccaa ggaacttcac     45480
     aacctttatg agtacagacg gtgaaaccga aagtcccgag gtatcaagta ccttgtgcat     45540
     gaagtcaaga tgatgttcgt ctggagcgtc tacgtatgcc tttattgctc ctgtcaggag     45600
     gtatcgtgaa tcaatttcga gcatgcaatc ttgcagctca ggaaatttct ggagaatgtc     45660
     tttaacgtaa ggtcccatga tgtttttatg cttctcaaag agtattctga cagactcctt     45720
     cttatgttct atcatgcagg gtgcaatcat aggtacaaac tgcaaggaat cgaatggaag     45780
     tttcctcaga agaatatcaa aaaggctact tcggaaacta taatccgaat tcttggctac     45840
     atccatgagt ttttggtagt ctatggaggc ttcatcttcc acaattgtct cgaagagatc     45900
     gagatcacct ttgaaatcag aaaagttgcc aagaaagtag tcaaagcaga attgccggta     45960
     cttatcatat tgcagaacta gttcggaaac aatgaccttt ataacattcc attctcttat     46020
     cgtagtgcat ttgataagat gaggaatgta cttactttga aatagtgctt tgactattct     46080
     ttctcctcca aactcgacca gagaagaaga atatcggata aaatcctcct catctttagg     46140
     aagcaagttt tgtttggatg ttgtttcaat gaagtctacc acatgttcat tccttctatt     46200
     tccaagaatc ttacaaaacc cgtactttct acacagagat aaaagagcat catggtgtct     46260
     ttccacaaga cactcgtcaa tcacctcttc tttatatctg tatagtctat caaccacatc     46320
     gtaattgtct tttgaaaatc cttttgtgct cagaatcttt tcgcagtttt ctttactcac     46380
     aacctcaaga tgaatcctca gtcctgagta aaaagccgga taaaaccaca tcttatctat     46440
     caaccatccg aagacatcgt ttatgagttc ttcatccttc acctgctgta aatacccaca     46500
     cagtgcatcc atatgtgcct tagatgagaa ctccatggcc ttcttcagta gtcttctgct     46560
     catctctact tcaaaacctc tggccttttc agagagatag ttcagatagg ccgggttggt     46620
     gtaaaattcc ttttggataa ttatagttgc cagatctatg ttcatgagct tggctgtgtc     46680
     gatgatgttt ttcacaaaga cattttcttg gcattcgtcc atcaatgaaa aaagtacttt     46740
     ctcatcaagg tagtccacaa agacatttcc atcatatttc acatacttca agcaggtttt     46800
     cataatcttc atcagatcat tctctaccat cttccggggc atgttcatca caactatgct     46860
     gtaatttcct tcggttataa gactttccca taaccacgga gactgttctg aaagatatgc     46920
     tttgtcggca tctcccatgt gcggaataag tgttgagaca ttcttaggaa acctctgact     46980
     aagaagcttg acaagaccct tcttgtcttc caactcccta aacagattga tatagtcaaa     47040
     gatttcccca tcgagattct tttcttcaat tccacaaaga gtcttcagag ctccgatctc     47100
     tatctcattg atcgacttca aagatagttc ttctctatgg agccacatca catagtcttt     47160
     atatctgctg ctgtctctca gaatctgtct gtcgttccca ctatcatata tcttcctaaa     47220
     aagtgcactt tcttcatggg gaatatcctc tttatgactt acctcttcaa gctttcttga     47280
     catcagatat tccttggcaa aatagggctc caacaactca acaaactcat caagaactcc     47340
     ctcgacatgg tctcttattt cgaagaaaat cttgactgct gcatcacttt ctccagactt     47400
     ggtgagatgg gatatcatct catagaactg catggaaaag tctttgtctg tattcttaat     47460
     ccctgaaact atatatccag ttacatcaag acaaaagtct tggatatact tgaaatgctc     47520
     aaaatatcct acaaagaaat caaaaaagtg cttctctctc aaacaaagat tcccaataaa     47580
     ctgatacgaa taggttggtt gaattgagaa gtagttgaaa tcagatctct gacttatgca     47640
     taaaacctgg ccatagtact tcttaaatgg aagaagaaag aaaatcatct cctttgggtt     47700
     gaaagtgtca cacatatatc ttcggacaag atattcaaac aaatattcga tatcctttac     47760
     attcccatat ctgaccaatt ctttcaaaaa ctccgaaaat cccctgttaa actttctctc     47820
     ctcctcctct gtctgcctct gtcggtcaaa aaataggctt ttggtttttg tgtatggtgt     47880
     ttggattgga atcagttcaa gaattgtttc ttcgtccatg tcctctgtat ctccaaatct     47940
     cactcttccc ttcatctcag agtgagcagc tcttctgcat ttcttcagcc tcagcaactg     48000
     atcttttagc gacatgaggg cttttggtat aaaataataa catcctttga gcatatccaa     48060
     gatagggaat ttattccatc aaacattcat aatgtctctc aaacgaggaa attctcttca     48120
     aatagtatcc gggcaatgat actccttccc ggggctcata gttgtcttgt ggcaccggct     48180
     cctcaacaag tttcacaaac tccgggtaca atatttttct tctttctaat aatctttttt     48240
     caaatcccgt gacaatacat ccctgggaga ttctttccaa gcaaaacatc gagctgcatg     48300
     ttccagatcc ataggagaac attaaaatct tctccccaat ctttccatcg tgtccgtcaa     48360
     gcaaagagat taacgaaaga tacaaagaag ccgaatatgc gtttccgttc tttctggatg     48420
     cttccaagga ttttagaaac ttctttctat ctatgtggtt tgcaacacac atcttttcag     48480
     ggagtcttgt gtatggagag tggagtacaa tataatcaaa ggtttcatcc cccatcttct     48540
     ccctaaactt cccatagcac acctcaaatg cagtcctata gttctctatt gattcctttc     48600
     ccttaacaac tggaaatgga tgcgtcttcc taggcttcat aaagtcaaat tggtttgtaa     48660
     agtagtgaat gatgcttgat ggaacgattc tgtagatgct atttggcccc accaggattg     48720
     caactgcccc tgcccctcct gtaggctggc aacgtttatc tttatacatg gctacatcgg     48780
     tagcaacaac tattgcaagc cttccatccc ataaggatga ttccatccat gaaactgcat     48840
     ttaatagtgc atttgttgca ctgtagcagg catgtacact atcacaaccg catatcgatg     48900
     tgtttcccgg gaataggtct gtaaggtacg acttgatgga cttggatcca tccggattgc     48960
     tttcggttcc gacttcaagt ctcccaacgc tttggggact cagtttatac tttttcatga     49020
     gtttactcac tgcattcaga gcaagagaaa tggaatcttc ccttctagat ggaaccccca     49080
     tctgttccaa tcctagccct attttgattt tgtcaacttc gaagtcaatg ttattagcaa     49140
     cctcctcctg gtcgatgtag agagaaggaa gttggtattc aagtcctaca atcccaaaca     49200
     tattctttgc cggcatcttc ggggtagggc cattctgtat ttcaataagg tcttcattta     49260
     cggttttacg gtggaattaa aatgagaaag gcttttgaag aggcaagaga aatacttgtt     49320
     tgctataata atgtttttag taaaagttgt ggaacgtcct tcgtatttgt atgctgccat     49380
     tttctgttta tattctatga atataaatac aactggaagc atatcataca cttctagaac     49440
     tcgtctaact caatgtaggt atttttctca accgacgtct gaaactttcc gttcaggtat     49500
     ttcacgatga aacaccaaat cacaattatg attccaacca gtaatcccaa cacacccgag     49560
     acaatacgga tgtcggttat atcccatatc cccgtcatga cagtgcacat tacagatccc     49620
     aaggactttc caagttttcc acaaagtcca tcgtaaatgg ccttgtactt tgccctgtat     49680
     agaggatcta tttgcattga gatcgcctcc ttcgaaacat ctgctccaag gtacttccct     49740
     atctttaaag atgcatttgt tataagtcca agggtgtttt caagaaaaaa tacaggttgc     49800
     tttcctttga aaaaggactt aaatagtcca ctcttccccg aatacactcc tacgttgtag     49860
     aaggcaataa gaaacacaga aaagaacgag aacacaacca cagctatggg aatcgaagcc     49920
     acatacttcc aataccccat cttaatcaaa gcagaatagg gggtgttgat gacaataaga     49980
     agagtcatcg caataattat ctgctccgaa ccattataga agtttgagaa tgtttccttc     50040
     gagttgtttg tatattttgc tcctgctgcc aatccacttt tgaatgttgc ttctattagt     50100
     gtagaagaca ctccataaag aagcacgttt aaggatatag ctacaagtaa ctttgatttg     50160
     gataagctct tcccagcttc ttttagtttg agttcctttt gtttcacggg cgtctctttt     50220
     atttccttaa taagaaacac aggcacaggg aggattttct tttctatgta cttcttcaat     50280
     acaagaaccc caatcactcc aaaagccagc agtaaaatta gtatttcaaa tcctagctcc     50340
     ttcgtctcaa acacaacgct atctctccac ctgttgaata tcaatgtaaa aacagcagac     50400
     agaaagatcg aaattgcatt tgatatgtta tagactgtta tgtatctctg ggattgcctt     50460
     cttgttgaaa tctcgtttgt aaagacgttg aagaagtacg acaccacaag agctccccac     50520
     atttccgaac acagaaagag aaatgaagat gtccattcgt tgaaaactaa aaacacagga     50580
     tataagaagt gaattcttaa agactccatt tttccgtctc cgaagatgtc tcttgaccag     50640
     taaaagtctt tttgtatata tgctttaaat ggccacatga ccagtccaaa gaaaaaatag     50700
     cacccggaga agagaatcag agtgatatcg aacattttgg atgggttgaa gaagttcagc     50760
     ccaaagtgaa tggcccagac aaaaatcaga gaacaaggag gaagaaaaat cgacttgatg     50820
     aaaaacatgg acatgggatc ttgtcttccc ataaggacca tttctcttaa gtttcccatt     50880
     atcgtatgca ccattgttat aactccgaat agaagtgaca agtagagaac cctgggccac     50940
     tcgtttcttg ctattcttat gtgtttgaag aaccctgtct tcttgtagac ctcctcttcc     51000
     agctcctctt ctgttctaaa gaggcaagag ttcttaggag atgttgatgg ctgaatatag     51060
     ctcatttagg gttgtgcaag ccgttaataa aaattgatta aaaatcgaaa gattctctgg     51120
     atgggcttga atttggacaa gggccgctta tcttgggatt ggagagcctc caatttaatt     51180
     tgttctttca aataaagtaa ttgctttata tggctactta ataatagtct ttggcacttg     51240
     cttctagagt ttccgatagt agtgcaatgg aaaatttctt gtagtctcaa gaaacaaaga     51300
     ttttaacgtt acccaggtgc tgggtataag accatctatc tatgttcagg atattttaat     51360
     ccgagaaatg tccatcctga taaaatgaag acggaacaag aaaaagaaga aggacatgta     51420
     tgctttagcc gggacttggg aaaagtagat gtgcgcaatg agaaggtttt tgaagggagt     51480
     tcccctcttt catcaggaaa aggtagtctt ggaaagagac agttgagcct ggacgatatg     51540
     ttttccaaaa gaaagacaac agcttcggaa attagtagcg gccggaaagt agactgggtt     51600
     tgtgagggat gcatcaatcc atgcgagtat tgtaagttag aggagaagat cgacccaaaa     51660
     tggagagtat atctgaagtc cgagtttgga aaagactact ttagaggaat caagaggttt     51720
     cttcataaaa acaaaaacca cctgcctcct atcgacaaga tattcacatt ttcgaagttt     51780
     tttccactgg aaaacacaaa ggttgttata atggggcagg atccttacca taacgaccaa     51840
     caagcaatgg ggctgtcctt ttctgtcccc cttggggttt ccattccccc cagtctcagg     51900
     aacatatatt tagaggccag cactgacatt gaaggattcg agattccctc tcatggagat     51960
     ttgacaaaat gggcagagaa tggggttctc ctgctgaacg atgttcttac agtcaccaaa     52020
     aaccaggcaa attcgcatgc aggaatcggg tggcgggagt ttacaagtag gatactccag     52080
     attataaacg agaaatgcac caatgtcgtg tttatgttat ggggacgcca tgcacaggca     52140
     aagggaaaat tcattaataa gaataagcat ctagtgctat gctgtgggca cccaagccct     52200
     cttagctcca accacttctt tggctgcaag catttctcta aagccaacaa atatcttagg     52260
     gagcatggaa agtcccccat caagtggcag atatagaagc aaagacttct taacccaaat     52320
     taaaataagg ttccctatcc gttttctaca gaagaacaca aaaacaacac tgggactaat     52380
     ggactggact gatttaattt tattcgagat ccttcttccc agagaaaaga tcaagatcaa     52440
     ttggagacga agtctgaata gattggttgt actttctatt cagatataga accgagtata     52500
     cccagacagg agatattatc agccaaatac caagagtaat cggtgctgca gctcttacgt     52560
     cattgtatcc catcaatgac caaaacatag catagagaga tcctattgat ttcccaagct     52620
     taccacaaag tccatcataa acagccttca gcttaggtct gtatatagga tcgatttgaa     52680
     gcgaaatagc ctcttttgaa atgtcgtaga aggcatactt ggcaatcttc attccactta     52740
     cacagtaaat acccatgttg cattccaaga agaagtttgg ttgatatcct ttgactagag     52800
     aagagaggat cactccttct cttccacttg gatagtttgg atagttgaag tatgctgatc     52860
     caaatatcac catagaagat actagtgtaa ctagtggtgg aacaatagcc attgttatcc     52920
     atccatgtgt ctggacaagg gtggatatgg gtgtcagtaa tattattgca accaaggctc     52980
     caacaaccct ctgctctcca gacacaatag aggcagaata tgctctcttt tccatgttct     53040
     ttgcatctgc tgcaacactt ataccgttct tccatgaaga ctcaatgaga ttggttcctg     53100
     cataataaaa aagggcgtta agaaccattg caactaggaa cttcgattgt gccataagct     53160
     ttatactttc tgaaaagcta gttgtaggct ttcgtccttt ctttttaatt ccctctgttc     53220
     ggataaacag ttgtttctta agaattctgt tttctgcata tttcttcata agatatgtaa     53280
     ttgctatcag aactccaaat atgacaaaga atgaatttgt tactaagcat gttgtcttgt     53340
     agtcccacat cttgactctt cttgagtaga gagctgtcga ttctgacgac agaagaagca     53400
     ggatgtttga aaccacatag aacaatggca tcatcctggt cgattggcgg atggtcagag     53460
     cctcatttgc aaacgagagg aacataaact gcactatcaa tgatccaaac agttctgcac     53520
     atacatagac aaagcttgtg gtccattcat tgaatatcaa aaagattgca aaaagaaact     53580
     caaatccttt gtataacatt ttgtcgtctg caaagatatc tcgagacaaa tagaatcccg     53640
     gttgaatctt actggcaaaa ggaagaagaa ctgttcctat aagagtatac agaaatgcaa     53700
     acgcaatcaa agtataatcg aatactttcg aaattgtgcg cgtcactaga agcttctgaa     53760
     caaccccagt agcaataacc gacatgggaa gaacaaaaca tgtcttaaga aatgaaatag     53820
     caacaggcag ttggcgtgat agaacgaacg aatccttcat cacccttgaa aatgaataaa     53880
     tataagctgc agatccaaag ataaatgcta aagtactcca aagcttccat tcgcatcttg     53940
     ctattctaat tctactcaga ggccatgttg ttgatgacag tgcttgtgcc tcaacctcgt     54000
     cttccgtcaa gagaggtctg tgttcatcta ccggagcaga aaatccgatt tcactcattc     54060
     ctttggggct tattttttct ttttttatat aggagatgta aaaatttgct tgatctcaga     54120
     cttttcaaga ccagggggaa ccaaaaaaat ccgttgagcc ttgcatattc ttctccttcc     54180
     ccatattccg tgccattcta attcctattt ccatctccca gatgtttaaa ttcaatcctc     54240
     tttaccctac catctcatat gctataccgg gcttatatgt acttcccaat caaataggag     54300
     gaacttgaat attacaagaa atgattttat ttctctgcta tgtcctggag gatcttatca     54360
     atatcttttc cagatagatg gcatagatcc tgccctgccc ttagataagc cacttcaatt     54420
     tccgagtatc cagagtcggt tccaatcgac tccagcagag ctccaattgc tagctcgaaa     54480
     agttctttgt cctccatatc tccatgatgg tttttctcaa tgaacttggt catctttccg     54540
     tgtttctctc cagctgcagt ggcatagcag ggatacgaaa tcccagacat gtctgtctgg     54600
     tatatcatag gctttttccc gtcaaatcca aatatagatg cattgaatgc tggagatctt     54660
     tcttccgagc tctggatcaa ctgctgaatc ttatcagcaa agcacctgca taggatatcc     54720
     ggtgtcactt ccattccaaa cgaaaacgtc ttttggtttg caaccatctt aatccttttt     54780
     ataacataat cgacgtctcc agaaagcccg gtaatcccca cataacattt cccggagact     54840
     ctgaagaagc ttgaagactc agactcctcg agcttgtctc gtgggatctt tttcgaagca     54900
     caaactatca tgctcttgga tttagctgtg acaataggta aggagttatt cacagcctca     54960
     agaccatatt cgatttgcaa taacttccca tcactattaa agatgtttga gatctcttcc     55020
     tgtgttgtca tttagggatg tcatatattt ttaataattc taaacaacct ttctatggga     55080
     aaaataaacc ttgaaggaaa aactgtctgt gtcactggag gaagtagagg acttggattg     55140
     gaaatcacaa aggagcttgc aaagaaggga tgctatgtcc atgtatttgg gaggtctcct     55200
     cagccttttt cccacaaaaa cgtaaagtat tatcagatgg acctactgaa ggaaagaccc     55260
     gccattgcaa ttccgtttga tatcgtaata tcaaaccttg ggacaagtgt gggcaataaa     55320
     gggtttgatg aaatggaata caaagaagtc acagatatgc taaagttgaa tgtggagcta     55380
     catctatggc ttctgaaaaa cattagctac aagaagtttg tttttgttaa ttctatattg     55440
     tcacaacaag gacttccggg atattccatg tattgtgctt ctaagtcgtt cattcacaca     55500
     ctgaatcagt cgttgaggag agaaggaaaa gacactataa tcatctaccc ttacaagata     55560
     aatacctcgt tgttcagcga gatcaaagac atatggacgc ttgatgcaaa ttatgtagct     55620
     caaagacttc tgagagacat agagaatggt acaagagaag atttcatcct ctggatattc     55680
     aagcccatca ctttactatc aaaaatgatc cctatgtttc ttcaagacat cctttccagg     55740
     tttctggaaa gggttttcta cataaccaaa agaaagagcg aataaacctt atctttcgca     55800
     tttccatcgg atgttacaga aagtcaatca agaaccccat caaatgtagc catatctcca     55860
     tatctttcta tagacctctg aagaatatat ggttccatat cctctgaacg tctggccata     55920
     tccgtttttt tgatcaggga gataatcagt tgtatagagg attctgagat ttgcaggcct     55980
     tgagaaacat tctttccttg cgatgttgaa cagaaatgga ggtttggact ttttctgaaa     56040
     aacttcttgc cattctatcc cctcgaagaa aggatgtttt ctgatagcca tacaatctct     56100
     ctccctatat ccaagtctgt ccttgggaga aacaacaaga agcttcgata ctaagtcccg     56160
     ggcattctta tcaaaaaatt ccggaaactt aattctattc ttcctgattc tttcaactgt     56220
     cgaggccata tcaggtgctg caaatggcgt agttccagaa agcatgtggt atagtaccat     56280
     tcccatcgac cagtagtcgg acacagggcc gatttcccca ctctctacat aatctaggga     56340
     tgcgtactct acgttctgct caagatcccc tattccacaa tctattctgt tcaaaaaatc     56400
     gtatttcagc ttcacatgcc cgtcgtcacc tatcatcata ctccttggag acagaaaccc     56460
     atatgaaagc cctttagaat gtaagtactg aaccgctaga agaatctctg ccatataaaa     56520
     cctggatact tttggtgaaa gtctttcctc ggaactgatc aaattgacaa gatagttctg     56580
     tgactgttct gaaagtagaa acaaatgttc gtaatcttga aatccacata ttgtgttgat     56640
     gagaaatgga tgccgtatcc tcgatcgaac gtaatattca tcttgtacca tctcttgctc     56700
     tccatatcct attatttttt tcttcttcat aacccgaagg ccataaagcc ctccaaccac     56760
     ttctccaacg tctataaaca caagaaactc ttcccaaaac ggcccaagcc ccgttttctc     56820
     aatacacatt atgtctttct ttcctatcat ttcgatgggt atttccctat tgattttgaa     56880
     ggatctggct ccggggaaag aaactaaatt tataaaaata gtttattcct attttgagtc     56940
     cgttagataa gtagtttgat aaccaaatcg aataggttac ccaaaacaga actttgctct     57000
     tccacacctc tcttttggag atctgcatcc atggtctttt ttgctttttc aaagtccttc     57060
     attcttttct cattgatttc cttgattctg cttctgtatc ttttttccac atcccaggaa     57120
     aacagatttc tctgtacaaa tatgcctttc tggacccttt caaaagcact gtagaagttc     57180
     tttcctaggt atgattttag tgtgccccga aaatcactta tcccagtgaa gtgaagattg     57240
     tgaagaaagt tcagaagatc cagaagcccg tattcagggc ctcctcgcca tttttcaagt     57300
     cttagaaggt tttcatcaaa gtccttgtga tattcgtttt cttttgttga aataaccaca     57360
     accttttcca gtggtctatt tagatgctcg ctgccaaaca tctttttgtc tttacaatac     57420
     accttataag aaatgcagcc gtagggatca attctattca acagaaacct gctaaatccc     57480
     acagacgact ccgaaacatg gaccagctca tatatatgag cactatggaa aagaaaaaga     57540
     tctgtaaatg ccctcttggt gactaggaag tcaaggttga aaaacgagaa cctcttcttt     57600
     ataagaaaat ccttacaatc aaatataact gtaggtttag gtcgttcttg gggaggtaag     57660
     acaggagttt ttggctctgg atcttggaga aacctgcatg ccttctcttt tgcccgttta     57720
     atgtatccca taatgctttt gtctttggcc ccatttggtc ttccaaggat agcaatccca     57780
     actcctagag acaacattga tgatgttata aagggaaacc ttttctcctc cattctgctc     57840
     cggaacgccc ctagaagctt ttccagatcc atcaagggtt atatccacac agtctgtaat     57900
     ctatcttctc aagaacattc ccactctatt cacaagatgc attatagatg ttttaaagct     57960
     ccctactgcg tccttaacct ccctttcaaa gagttctaac gccctttgct cggttacctc     58020
     catcttcaat cttcctcttg caaatgtaat aatctcttct aagtcaaacc ggaagatttt     58080
     gttctggagc aatacacacc atagaacaaa gatcttttgg caggacctcc ttatctggag     58140
     aaacacctcc cctgacttta taataaaatc ctggtagata agttcgtcgt ttactagata     58200
     gtcgcatatg ggcctggcaa ttgttatcct tggagagatg agctttggat cattcccaaa     58260
     cacatagcta aaatccacat gaaaaaatct tccatccctc gataccatca tattccctgg     58320
     atttctatct ccaaccccca tcatatagca agcaaccgag tatccacaga gagtatctac     58380
     aaatgttctt ttcttctgag cattctgcat ccatcttggg tcattttctc cttcaatata     58440
     cctttctaag tcttctctcc cctttatttg agtaaagtct accccgtcca caacttccac     58500
     aatcccttct tctctgctca atggaatcac cttgtatgct accagatcca tctccaccaa     58560
     ctccgatatg tatcttatag tctcaagaac aaacagatcc tttgtcaggt cgtctccctt     58620
     cttgtatatg atcctggaga tgcctttatc tgtattcaaa ggaacaagaa ttggaaatgt     58680
     agatgaggga aatatcttga tctctcgaag aatcatttcc tttactactg tatctggatt     58740
     gaacagagag gtacagtgcc taatacttcc catccttgga tggaggcata acgctccatg     58800
     taatttgtac tctcttatct ttgtcttcct aggcgatcct tggcaagtta tgctgtagat     58860
     tcctctaact tcgttgatca aggccatttg cccttccagt ttctccaata ttccatactt     58920
     ggagtccagt gctagaaagc tatttacagc atctctatat ttcgactcgt tgcactcctc     58980
     atgaagctca aacctaatct tccagaacct gtttatttgg tgctcagcag ataggttgtc     59040
     tcccgggtcc ttccctccca acgaggggaa gtatatatac agactgccca ctttttgaac     59100
     gcataaatac tctgcaatca tcttctcggc atcctcactt ctgcttaaaa gcctggaaac     59160
     acttctagca agctcagaaa tgtcttcttt ctctatcttg cattcaaaag cacttccgct     59220
     tagttgatcc atgatctatt tctcaagtgt tttggtacca ttagtatata tcagcatctg     59280
     aaacaatggt cgttggcata agtatttcaa ttacagagac aagtccccca tgaaacttga     59340
     gccaggaacg gttgaagccc tctataacag ccagactacc aatcctttgt ataagaaccc     59400
     cattctccag attacatcgc taggaaagct ctcggttgcc attggggaca agcagagata     59460
     ccgagtcaat ctctccgacg gtgtacacta catgaaagga atcttctcca gtgagcttac     59520
     agcccatttt gagaaagggc ttgtgagtag atatagtctc atcaggcctg gaaggttcag     59580
     tgtaaggtct aaggacggaa gtgtgtatat atatatccag gagatccagg agtacgagga     59640
     ctgcaatgtc gagatcggaa agcctgtgaa cataagcaca ggaaatgcgt ctttcaacga     59700
     caaccagctg agcccaggaa tccaaaaacg tgtagatgga gggaaccagc atggtaaagc     59760
     attggacgag gaagacaaaa aaagagtgaa aaaagacatt aaggacgaag gagagtttac     59820
     agccataaac atgttgaatc catttcacaa caaatggatg atcaagggga gagtggtgtt     59880
     gaaaggagat ataagaagat tcagtaatca gaagggagag ggaaaggtct ttaactttga     59940
     gatttccgac ggaactgcgc aagtgaagat aatatgcttt tccgactgcg tagatatatt     60000
     ctttccgata gttgaagttg ggaaagttta ttctgtttca aaaggtactg ttaagatggc     60060
     caacaagcag tactctacaa atccatttga ctacgagatc attctggata agaattctga     60120
     agttcggtgt actgtcgacg atggatcacc tcgatacttc ttcaacttca tcaagctttc     60180
     agatctatcg cttggaaatg catactgcga tgtgattgga gttgtcagag aagtatatgc     60240
     accttcaacc gtaatggtta gaagcaccca gaacgagctc ctcaaaagag atataatcct     60300
     tgtcgatgaa agtggaagcg taagactaac tctgtggggg ccaaaggcag agctggatat     60360
     tgaaggggga gtagttcttg ggctgaaatc tgtaaaggtt agtgagttta acggaatttc     60420
     aatatcaact acaggaggct cccaggttgt gatcaaccca gatattccgg aagcacatga     60480
     gcttgcaggt tggtaccagt cgaccggtaa ggacatgcaa gttgctctcc ctcgaaaaga     60540
     ggaaaaaaga agactaatac aggaagtcaa ggagaatgag ctggcatatt caaccattca     60600
     aggaacggtg atgtttttga aagaagatgc gctttggtat acatcatgca agggggaggg     60660
     atgcaacaaa aaggttgtga tggaggacag tggaaactac agatgcgaaa gatgcaatat     60720
     gacatatgaa gactgtaact acagatacat ggtcactatg catctcggag actttactgg     60780
     acaagtatgg ctgagtctct ttgacgaagc tgcagccagc ttttttggaa tacctgctca     60840
     ggagatgaag aggatgagcg aggagtcccc agcagagctt caagcattga tcaaaggaat     60900
     gtatttcaag gaatacctct ttagaatcaa gtcaaagcag gacagctaca atgatgagat     60960
     taggatgaga tacagtgggc tgagttcaag ccccctggac atccgaaaag aatctaaacg     61020
     acttcttgat gcgattgaaa aggcttagga gaataaatct tgtgggctaa ggatattttg     61080
     gtttgtctat gtcttcccat gcagtacaaa gggatcaaca gaatgacaag ggaaaagata     61140
     cttgcatctg aggaattcaa gaagatgagg tcccttacac aatcagatgt gattcggagc     61200
     atccagtctt tggattctat aggaggtctg gtcagagata caccccatcg atttctatgt     61260
     cttgttcaga aaatgggagc tatctccttg gatgaagatg ttattgctgc caatctgggg     61320
     gatttcaggc ctgaagagcc cctactctca aactcctcaa tggaaatgtt tcgcgggaac     61380
     gtctgtttca tagcggcttc tctcttatat ctaagacttt caaagaggtt ccataaatac     61440
     gagtccttgg ttaggtcgtt tctgatggac ttcaggaagg tacccatggt tgatggagaa     61500
     aataataaga cgtttatata cctcgatgta ctcgcagacg atttgcttaa caggaccagg     61560
     gtgttcaatg tccatttgaa gaaaaccttc taaagcccgg tggttaaagg caaacacagc     61620
     caaaatagac agaataaacg gtctttaata cttcatattt tctgcacaac tctttctcca     61680
     ttcagaactg cagagattga ttccttttga tggctagtca tttctgcaat gactttctca     61740
     gcataagacc cgactactgg agaagaaagt atcgaagaga tgtatccaaa aggctcaaag     61800
     tggtccaggg cagtctcgaa gtaaatatcc tcttctaaga tatccattcc gctgatgtcg     61860
     cttgcatcga gatcttcctc atcttccgag tctacagaag atgctacagc atcctcatca     61920
     tccttcatct ggtttcttag ccttatggct gcaggaagcg aggtaacagt tgctacaaga     61980
     gccttaccga ggtttctaac atcaagctca ggaagatccc cactctggag cctacagatt     62040
     gtacctataa ataggatgca tatcttcttg tcatggaccc tcttgaattt gcttttctgg     62100
     ctgaagagct tttcaaagaa ctcctggaga tacttctgct ctcgaagaat ctgaatggtc     62160
     tctctcggtc ttaggatgaa gcagttcatt atcaactcaa gcacataaac cattgcaggg     62220
     ccgttttcat caatcatctt ctccccagac accgcaactg aaatgaagaa gggcagtctc     62280
     gaagggtcct tgcaaagaac ttcatttcct atgttcagaa taatcgattc gataatcctg     62340
     catcctccta tgaagtcgtc gtcaaagaag ttctcttcgt tgcacaagca aagctttgaa     62400
     accacagaat agatgcttcc tagtatgttt gcatccatta tggttgcttt tccatatgtt     62460
     atgaagttat caattagatc ggcaatttcc gacgagtata ctgtgatttc atcgatcggg     62520
     aggttcagaa tcatctggaa aagaccccac atcgatccct ctatttcctt gatcataaac     62580
     acatagccgt tgagtatgtc caaggcctcc tggtagaagt ctgccttttc ctccttcaaa     62640
     atgaaggata tcacatcata ggagttgata taggaatgcc tgagagccgg ggacctttgg     62700
     ttaagagata gaatgagatt ttccatactt cgaagaaatc cagaaaccac catcagcttg     62760
     ttatcaccag agtcattctc attcataaga tgcgacagtg taatcctgga tatcgatcca     62820
     acgagttccg gtgcatattt ggatatctcc tcaggatagt actcaattat tgagtcaagc     62880
     agtattgtca ggggctccag atcatatgta ttcgaaagat tcagtatcga ctccaccgtc     62940
     tctggaatca gctccttgaa cttctcagag gctgtctcgt tgaacaggaa aaacgacatt     63000
     gcaagtgtcc cctctacctc caggactttg tgatttgatt tcatgagttt gtgcacgtta     63060
     gtcatagcct caaacaccaa gtctcccatg ggaagatcct cttctattgt tgatagaaaa     63120
     tagcaagctt gggacttcag aaccaacgag cttccttgga gagctggaat tacgtggttg     63180
     gctataatgt attcgagagc acttcttgct ttcttcatca gagttgattt tatgtttgct     63240
     aacagaaaga acgatccata tgccattctt atattttccc tgctagggct ttctttgtat     63300
     gctccaagga tggaaacaag gtaattaaca attccctgga aggcttcctg tttctgcttt     63360
     atctttgcca caatctcaca gaacaaagtg tttagactgt ttcttagatc attaccaaag     63420
     aagttgtact tttcccttaa gtatttgtct gggtcgtttt caaagtcatc ttcctctgaa     63480
     tctgacagag aataaagcgg cagaatatat cccgagataa aatacgaaag attcggctcc     63540
     atgtaacgga aaaactcaga atccgatgtc agcaacacaa aaaagtctat ggcatagagc     63600
     tcgatgtcaa ctgtatgttc cgatctctcc tgaatgatct tcaggaatgt cccatacacc     63660
     atctggaacc tgttcacatc tgtaacatat tcagaaagct cgttattctt gtagaacttc     63720
     ttgactcctt tgctgcaagc cttgtacata aagtatgcag cccatttctt actttcaagc     63780
     agattctcgt ctgtacctct tagatttaga attctaagag agagattgaa tacatatgag     63840
     aaagtactta tggcagagag aaagtctgga atggagtaat agccgtagga cttggttagc     63900
     acaatcattc ctgtcttcac catgctataa ttccctgatt ccaggaaccc gtacactttt     63960
     tccagaacat cttttccggc agtatcaaac agaagcccaa gaacttgctc aagattgtac     64020
     tttatcttct ctgcatcaaa tatcttttcg tacatgttca atgcggtaaa catgtggttc     64080
     gtgtccgagg atttcatgaa gctcgatgcc ttctggaaca gtccattcaa gtcgttcaac     64140
     ttctcgttat tgaatatatt cacaagaatc gcatcgtatg ccattctagt tatctcgtct     64200
     ccatacaaaa acagatccaa tacattctcc acaagatact ttcgaacttc ggaatactca     64260
     tcgcttcccc attgctttat tattgcattc ttgaagtaga tggttgcaac cctctttatt     64320
     gttgcatcgg aatccttcat gcatgtatct gggagagaca tcacaaagct tggctgcttc     64380
     tccaagttca tcagcatcga ctctgctgca ctcctctttc cagaatccgg atcaatggtc     64440
     tgcagaaata tttggcgtgt ttcttctctc atgagggcac ctcagatatt ttttgaaaaa     64500
     tttttgggat atcctttccg gctccctagg cggaaaaaga aaacttcaac tgttcgagat     64560
     ggttttattg gctcttctcg gccatgatgg tcgagtcaat cataatgata gaggctacac     64620
     cattgaagga tgctttgatc atgttcttct tgacctcaag ggcctcatat atcccaaggg     64680
     ccttcatatc ttgaacccct ttgatactga ctccttcata gagacttccg ctagcatgtc     64740
     tttttcggag gtcctgaatt gtgcttattg tatcaaaccc aaagttcctg gctagaagaa     64800
     gaggaatttt ttcaaatgcc tggcctatgg cctttgcaac aaacaccttc ttattaccgt     64860
     attccatcga cttctctcga atcactttgg acaactccat ctccatggat cctcctcctg     64920
     tgaccacttt tcctgtcttc agggcacttc taacaacaca cattgcatca tgtactgctc     64980
     ttccaatctc ttcgagaact tcctggccag gtcccctgag tatcatcgtg catgcattca     65040
     ttcctcctcc ctcaaagtaa ttgtatctga actttcccaa ctgtctctct tcaaagagtc     65100
     cgcacgaccc caagctttcc tctagatagt ctgtcgatcc caggatcctt cctccgcacg     65160
     acccaatcac cctattaaga tcttccttgg aaactcttcc tgcacagaat atcccatgct     65220
     ttgcaaagta ctgtgtggcg tagtctccta tcgataatga acttagaacc acttttgccc     65280
     cgctgtctat tatctcatcc agcttcctac ggattatttc ccactctgca tcaacaactt     65340
     tctgatactc ttcgactccc ccaaccctta tctcggcatt gtccctctcg ctcttccact     65400
     cgagctccac attcaagcag aggatttttg gatttaagat cttcttcggc tgctgctcat     65460
     atcctgcata agtaaagcac ttctcaaatg caaccccgtt tacaacagtc gaatccccaa     65520
     tacttcctcc ctgcactttc ttcactccaa tcgagtctac atcatctata cttgcctgtc     65580
     ttattgcatc aacaaccatt tgagaaaaat gcttcttttc atgccttatg ttcttggagg     65640
     taacacacgt ctcagccagc ttgtagagca tttcatcatt cagatccatg ctcatctttt     65700
     ctagatgttc gatacacacc atccggagct cactaaggca ttctctgatg gattcaagat     65760
     caaaattgtc cttaatcaac ggcttcaagc aacttaatat ttccgtggtt agaattatca     65820
     cactggttgt tccgtctcca acttcattgt cttgggactc agacagcgcc accagaagtt     65880
     ttcccacagg atgattaact ttcatgtgct tgagtatagt tgccccatcg ttagttacca     65940
     ctatttcctt tccagcaaat agcttgtcca ttccgtaagg tcctagagtg ctctccagga     66000
     attcagccat cttcatgcac acatctatgt ttgatataac ctggagcttt ccttctcgag     66060
     ggtctgctat cttctctgtc tgtacaaaaa gttgattcat gtctgggcct aaaattttta     66120
     tgctcgataa aggctctaag gaaaagctcc tcaccagtta cgagccaagg acatacctaa     66180
     gaagacctag gaagaaagag gatgaacaga tgtcccagac gcccctcaga agacacggct     66240
     ctctctttag agtcgatctt tcaagagtga taaaagaaaa ggagcatttt gtattttcaa     66300
     ggtttcttaa tagattcatc agataaagcc aagatttatt acacagattt acacatcaag     66360
     cctacttccg tacacaatag tcttcaagta ttccctgtcg cagtgcccca tgttctcggc     66420
     acagagcata agatctttta ggccgaattg gctattcctg ttggacattt ccacatggaa     66480
     tttcaccaga tcttcatctc ctccagaaaa agatgcaatg gcagtcccct cctgtgttcc     66540
     atagccttta caataaacaa ccttggtatc ctccatcaaa gagtgttttt tcccttcctc     66600
     aatcgtgagt atcagcctgc tatttccaga tttcttacag cttcccagga aatgtatgtt     66660
     ttttatcaag taggttctgt cttcctgaga ctcctcttcc aacatcctgt agatcttctc     66720
     attgttttcc ttgggccctg ccgatatcac agccgttatc gccatctttt cttcgataat     66780
     gtgtgttgcg atatcgcaag caattataag agtgtagtca aacggatgcc ttgacatttc     66840
     atgaattaag ccttcatatt catctttggt gtctggaaat gtgcttgagt aaaaggaatc     66900
     tacactcctc gaaatcacat ctcttaccaa gttcatatcc gcatctacca taccagccca     66960
     catattctcg aagttgtccc tgcacaatct actttcaaga atgggatata tcacgttctc     67020
     cacatactcc ctataaatcc tgaaagaaag atgtactcca tacgcttcaa agaagatttt     67080
     actctttcta ccaaacacta gattaagaat ttcatatacc tctctctttt tgctatgctg     67140
     tttgctgatg cttctttcct tctccaattt ctttttatgc tcgtagactt cattgagcgg     67200
     tgcatgttca actatcagtt caagaagtct ctcctccaac cgctctagat tccctgactc     67260
     ctctgtctca aatctctcta caaaactaca gttgtatgta tattccttgt aaggatttgt     67320
     ctttgtgctc gataccagta taatagagta ttgtggattg tccatctgcc gtttgagagc     67380
     tctatacacg tccttgtcaa accgatcgca tccataaaca atgacatcgt tcccatagta     67440
     gctgcagttg gacaatacct gcttgtagtt tttatcttca aggctggtcg agataaacct     67500
     tcttgccctg gtaagagccg aaatgccact gctatgaaca aatccgtttc ttttgcaatg     67560
     aagaacccag tcggtgctcg agagaatata ctttatagga cacaagtatt tcattcttct     67620
     ccatttctcc acctcatcag atagctctct tacaatctta tccatcagga gagctctttc     67680
     atctgccgac ttgatttcct tctttataga ctcaagctta agaaccgatg cattatattc     67740
     gtctttcatt gcctcaattt tcttttcaat ctgtaaaagc ttcttttcct cctcctctat     67800
     ttccttcctg ctcttttcaa cctccttccc aagcactgct atctcttgat ccagaggaga     67860
     aatctcctcc atagtcttgg catatttata tctcgccatc acccacataa agagtggccc     67920
     gcaagcacta cttgccttct gtgccttttc atagctgaac agaggattcg atatcatatt     67980
     ctcgagaaca tcaggtactt ttgtactcct gcagttcaga accttagaaa caaaatcctc     68040
     tcttttcata aactggatca attgtttcca ttcaatgctc cctccctttg tctctccttc     68100
     cacaatccaa tacactgcct ctacagtgtt tctaactatt tcaggcgggt tgatcatcac     68160
     tctgatctcc gacaagctac tcttcggcag ttcctctata cttcttctag actcagatag     68220
     taatgtcttt gccactctaa gccttttgtc tatcacctcc tgtttcttct gattcatcat     68280
     caacgctcct tctatttctc tcttcctgtt tccgattgct cctttctccc tttctaactg     68340
     tttctgggta ttgatgatct tttcgagctg cccgtctagc ctgtccgtga gcttttccag     68400
     atcctttttc tttcgagaag attcaagccc tagggctagt gcctcctttc cgaagtcctc     68460
     aatcttctgc agccccccta tcaggaattt ccttcttcta gattcctttt ccttgaactc     68520
     tcttgcaatc cttgcaaagc tcattccgaa cccaattgct ttacagagga aaccagttgt     68580
     caccacattg ggatgctggc attcccatgg atgtccatct tcctcgactc ccattgccaa     68640
     ggaagatgtt tccgaaggaa tcccttcatt ttccaagtca atgttgatac caacatttgt     68700
     tgtaaagcat tcttttacca tatccagatc ggatatgtct ttgcttctca ccatattata     68760
     gatcttaagt aggtccagag aataataagc tgttctcttc agcttgaaaa tcatacattg     68820
     gttggatata tctttcctta gagaagacac atcctctaca agaaaagcag tttgcccatc     68880
     aatcttcttt tcgtcctcat tactaactat ccttacattt tccttcatct gtctcataca     68940
     ctctctcacc acccaatgct ttcctgacat cctacctcct tcaatcacaa gattgtaccc     69000
     tctgtggaaa atagacccta cgtaggaaat atcgctgcat ctctttgccc ttctgaacct     69060
     tctagtctca agattaaact caatctcttc aggacgtctt ccaaaagccc tttgcatctc     69120
     ttcttccaaa tcctttgatt ctccaaagta aatctttgct tcaaagtaca tcagatcaac     69180
     caaatctccc tcctccatac acagatcccc tagtgtcctg ataaagctgg tgatttcctt     69240
     caggttgact ttgaagtttt tgtagataaa ctccaccacc tgtaagaccc ttttgtagtc     69300
     ctggaaatgc ttcgttgctt caaatctttt tctgatttcc gactcaaaaa gaagttccgt     69360
     atctctcggc tcttccacaa atatagactt tatctttctt ctcagtcttt ctgctgccgt     69420
     gttccgaatt gcatcattcc ctttcttttc attgattcca catattaaaa ccatgttctt     69480
     tacctctatc tctccaattc ttccacactc gttatattcc ctaactgcct ccaccagact     69540
     tacattccta cagtcaaaac cctcaatgta aaccaccgat cttaaatcat atatcttctc     69600
     ttctcctact ctctttatct tgtcttcccc aagactttga gcgatcatcg aggtctcaaa     69660
     tccgtttccc tcaatcacaa caaccttctc cttaaaaacc tcttcaacca acgacctctt     69720
     cccaactcct acttctcctc gcatgaaaaa gacttttgaa ccgtctttta ctagtgcttc     69780
     cattgccctt gcataaaagc tctgttcttc tgttaccacc aaacctctaa atgggaacac     69840
     aggtaccttt cttccatcgt atcttatgtc cataccagtc ccaacagtgt tttggagatt     69900
     ccctatctgg taaagatcgt cctcttccat gtgaacaaga aacaccctgg ttagggtggc     69960
     aggtgttata ttctccatag acgtgctttc aaacacaaac ctatagtggt ctggaatcct     70020
     aattctttct ccggaactca ggcatagtaa cttattttcg tctaatatag agttgaaatc     70080
     ttcaatccag aaggactctg caatcccatc aaatacaaac cagcattcct tgctactgtc     70140
     catgttcctt cttagatctc gaacaaactt gctatctttc cactctccag taaccttgtc     70200
     ttggaatcca aatatcttcc ctatatttct cgggttgtag taaaagcaca tcgctcctct     70260
     ggactctctt gctaatttta tcaatgtact cttcccagcc ccattccctc ctatgacaag     70320
     agctcctctc ctgttctcca acccatatag tagcatgtct ttgtgtgcta ggttctgctc     70380
     cactttcctt tcaaaaatct tctcaaattc tttaacaaat atagctttgt cttcccgccc     70440
     aagacaggcc atataaaagt agattgccga tctcataatc tccgcctctt ctcttccctt     70500
     tgtgatcgtt cttactgctc ttaacccaaa atcataatga tcctgcttac ttgccttgga     70560
     ctccacttcc ctcattagcc tgtagatctt ttccgaactt tctttacaat agtagtctat     70620
     aatgtctttt atgtctggtg catctattct tgtttccccg agtatggctc ttaggcttct     70680
     aggcatcctg taccgaccct tatatcctat gttcatcgta aggaagaact ttgtcttatt     70740
     tttgttaagg agaatcagct cagtcgcccc actcattatc tcttcactca gtcgattgaa     70800
     ctcgtcaaaa cataagtaag accctgtaag aactgccccc gaaataacat ttcttaaggt     70860
     ttcaagctca cacccttcgt tgcagcaaaa aacaaaaaca ggctttccaa taagcctaca     70920
     gtagtatttc accgactctg tctttcctgt tccgcttctt ccatacagaa tcaccccaca     70980
     taaacttttt agcgaaatgg ctatacttga aagtacccta catactaagg gtgtaaatac     71040
     aatgtctacc ggtgggtagt attcaaaacc atactctatc tcttcagtgg aatccataaa     71100
     gagctcccca ctcttcagta caggttttgg atatagcctt atcactccat tcggatgctt     71160
     ctcaatctcc ctttctagta ctctaagctt tggagtcatt tcaaaatctc ttttgttgaa     71220
     gtacttaaac tcggaaatca aatcggaaat aattgacgga catccctctt tgagactctc     71280
     cagaccatcg tggaaccagg atttgagggt tctcttgacc tcttcttcaa atgtatccat     71340
     aaaccctcca atatcttggt caatctgtac cttctggcga agcatcactg tctccccgtt     71400
     accttcaaat cccaaaatac tgccgttttc gacaataaca ccatctatgt tgaacatcat     71460
     tcccaacatc tccacataat aggatctact attcagcccc cgtataagat cgatgtccga     71520
     aacaagataa agcctaggtg ttctttccct acatctccta aggaatactt tgagaccttt     71580
     cgatatatcg tcaaagtctt tcttcatacc gagaaactca tctttatgag gtaaaagagc     71640
     cccaagctta acctcccatc cactggaaga acttggagtg ctaaatctat tcaagacgtc     71700
     caggaatctt ttttttatca tggagtattt cttagcttca aagtctaatc catcagtgga     71760
     aaaaacattt gcgaactccc ttattcctct ctggacctct tcaagacaag ccagaaagct     71820
     gagacaatcg tccatgcgct ccttaatccc attaagctcc tctataaaga agttcttttc     71880
     attgaacctc gatattgagt catgctccac aagaagctta ttaactctct cctcaacttg     71940
     gctcaagtct ggtataacta cttcctcctt ccgaagatgc ctcaccttca aactcactaa     72000
     gaatatttca gccctagccc tctctatata cctttcaacc tcatactcca tccttgaatc     72060
     ggctagcctc ttttctacct catctttatc ctgtagaaga aaaaattcct ttgtctccat     72120
     ctctgtgtca aagtacttct tttttacata gggacttttt gtatgctgta gacaatccaa     72180
     cccagatata tagtatttta tcttactctg aaactcctta taatattctg catggaatag     72240
     agatacatca atggacttta gaaaagagga aagttgctcc acatctacat cacatacttt     72300
     ttgggactca tacttcttga ggatagtctc aaacctacta aaggtggccc actcagcatc     72360
     caatcctcct attctttctt gtaaggaact gcaaatcaaa ggataatcca caataccaag     72420
     aatcttgttg aatcttttga ttttctcttc aagctcttcg tatcttgtct taagagattt     72480
     aaacataggc caaaacatta gtccgtctct ttccttggct gcattgtcta tcttttcccc     72540
     aaaatctcga atctcagaga ccaaggcctc tcgtcttgac tttatgatgc caaacggaat     72600
     atcatttaga aataagttca aggcttccct gtttgcttct agagcactat ccctttcact     72660
     ccggacagtc tcaatggcca cgcttggtct ttccagtcca tactcaatga cggccccatt     72720
     caactcttca agaattcgaa attcctcgga ccggagatat tcatcaacca gtatggaatt     72780
     ggatattccc tcaagcagat ctcttctctc catactgctt tcttgggatc cagaatctcc     72840
     catgccccca accatatcct tccttgcagc tagcatatcg tagactctgg agttttctgc     72900
     acttacaaac ctgcaaactt catcgcatac cgtctcaaac aacctcgctt gttctgaagc     72960
     atccatagta tgttcaaagg taaaaaatgg aattgtattc ttaacaaaca tctcgacact     73020
     tctttgcgaa tcccggactc tcagaaacct ttcgtaaagc cccaaaggaa ggtcccaagt     73080
     cggaatcaac tccaatattc ttgtgcaggt ttcataattt gccacaacca ttccaattat     73140
     tttttccact ttagacctta tttcctggcc tggcctgagc ctttgaagaa ccttttcaaa     73200
     gaaatatcct tctccttccg aaggaaatat cttctccaaa atcttaaagt actcagaaag     73260
     aggaggttca aaacaatgct ccacaccatt cccacatcct tcgatcttta caatttcttt     73320
     cttaagccta tgttttgagg aaaacagact gctgtctcct gcttctaagg cctccagtac     73380
     agattcaaga tattgtagga acactctgct catagaccta tttatccctc gcactacaat     73440
     gctcttttcg taaaacttaa aaaactccaa gtaagtctcg ctgtcgagag aaaacagcat     73500
     ctgcttctgg atttgtttgg aaaatattgc tttcatttcc tccttggcta tcttttttaa     73560
     aaggaatctg taggtgtaaa ccctgttctc aagctcccga actctgtcgt cgatctcttc     73620
     tatgtcttgg aagtcctttg catccttcca tcgcagcatc aagatctttt ccattgatcc     73680
     aaacaccaaa tctatctcct tgtgaaacag atctaggtct tcacgcacat cctccaatat     73740
     cctgttgatt ctcctgcatc catcatcaat tcttgtgtaa atagatctag cctctaatgc     73800
     taaagccatt gtctcatgga taggttgaga aatccgagac ctaacaccct ccagagatac     73860
     aatagtcatg tactcatcca gcctctttag aatggtaggc tcaggtgaca ccttgaactt     73920
     cctgtttcca tcggcttccc tactaatgct cactattctt ccccaggaaa atccatcaga     73980
     aagcacggaa ttttcccact catatattgt gtcacttacc tgtctttcta tgctcttttt     74040
     catccttcgg atctcccaca gctgcactat cccgtcataa tcctgcccaa aaaatagatc     74100
     tagaatcttc cagacttctc caaacatgtc gtgaaacatg aacagtctag atagcttatt     74160
     acagaaattg tcatccagag atggaggaca tgactttaca atagagtcta ggtatctgac     74220
     aatcatcatc ctattgttaa ctgtttttct tgcgaaaatc tcgaacaggt tgaagatgga     74280
     gaacattttc atgaccttgc atagcttgtg aaacttatct ccatcctcct gtggcaataa     74340
     tacccccaga acttcggttt ctttctttct cgccttcctc caggatatca gagtctatgt     74400
     cgcaaatcct ttcgaaagcc tcgttgaaaa catcggagac aaacccctcc tgttggtcaa     74460
     atacaacttc tagtctagcc ttaatgttga agagatcttt cttcatccat cctaccacag     74520
     gcctcaagtc aggatctcca atctcagata tcatttcttg tagcaggctt ctgtatctta     74580
     tttcatgggc agccttttct ggagaactct tcagtaactt aggaacaact gctccaagtc     74640
     ccttgaacga ccaagaaaag agaaggattt tcttgatgtc tttgaattcg gagtgaaatt     74700
     tggccaactc ctctcctccc ctgaattcat agaacaatga cgactctaag gacatggcct     74760
     cagattcctc gccctcccta gaaacagtaa gtgagcacat actctctata gagcataaaa     74820
     gtagttcttc acaacactta agccacccaa tcgataggtt ctcatgcacc ttgtcgatta     74880
     ttagccaaac tagtctatcc atctgggaaa gaatcagttt tcgagccatc ttcgactgtc     74940
     ttccaattct tctgccgatt tcctttatag cactaactgt agagtccttg aactcgtcca     75000
     agctccttgg aaaataaact cccttaaagt ccatgccctc atagaagcca tgaagccctc     75060
     ttccaagttc gaagtacttg tttgataaca tcaagctctc tagggttgct gcagaaacaa     75120
     accttttact cctcttcaaa acatcatgaa caaatccaaa tacttcggac tttccgaatt     75180
     ctcttatata gcacatctcc atatagaatt tgctccagaa ggtcttttcc tcatgaaacc     75240
     cacttctttt gaatcctacg gactcatgaa gtcctcttat gcagctggtc cactgttcca     75300
     cattcctatg aataagctcc agctcaccac tagaaagaaa cctttcgggg tcaagcccat     75360
     tctgaagctc ctcaccatgc ttcctataaa gccgatccat ttcctgggtt tccatgctaa     75420
     gatagatctt ttctttctta tcttcttcac ttacggcttt gctgagatgc agggcatgat     75480
     gctctaacaa ccggagagcc ttctctacag ccacagatac acccttcttt ttaatcctag     75540
     acatggtggc tggtattacg aagttcgaca ttgcatctac catgaattca catgagcctt     75600
     tgagtatgag aagcccatcc ttcctgtgat tgactataca gtctgctccg acctgggatt     75660
     tctctttaca ttcataggaa tgtccattac tatccgagat acatttatga aaatccgtag     75720
     tagacttcaa tttgtccaca attctgtcta tctcatcgca aagtgtattg tttgtgtcca     75780
     ttggagggtc agaagagcaa agatatgaga accttaacaa ttgatggaag agccctagtt     75840
     atggacatcc acatgctaag aaaggaaaga gaaaactgca tcaatgaaag agatcggctc     75900
     atttctgaaa tggactcttt catcgtaggg tcgatggggg aaataagaga agcattgacc     75960
     attcccgaaa ctactgtctg ggaaatctct caggaggatc tcttgctatt tgtctcctgg     76020
     aggatatcca agctgatttc tctaacaaga gataaaaaga tagaaattct cagcaagctc     76080
     gtttgggaaa aggtgaacta caaagacttg gagaacatcc tagtcgccga gtattgctac     76140
     aaaaaagtgt tggcaaacga cttttcggaa agttctgcct gggataccga tgtttacatt     76200
     gacataggaa atggggatgt ggacataaaa agcgattctg tggaaagaat aacaactggt     76260
     tcggatgggg tcttttacag atcactgaat ggtctatttt cgaagaggtt ccatgtgagg     76320
     gttagcaagg agctaatgag gtcttatgcc ctgaatataa aggtggagat gggcctggag     76380
     atcttcaaaa gcctctatga gaaggatgag gaagacctga aaaggctgtc atcatacaaa     76440
     cactacaagg agaaagggct tcccacactc gttatgagcg gtgaaatgac aagtaatctg     76500
     atggaagaca taagagcaag agtttcccag gaagttactg gaataattgc tgcagaaatg     76560
     ccagacagaa aaaaggcgct tctcatcacc tacctccttg tgatgtttgg aggaatcggg     76620
     tcggatcttg acttaagcta tttcaatggg aagaaagaat tatacatgct ggaatggaca     76680
     aaatccaaag aaaatatttt tatcaaaata caactcgaga gctaacacct taatacagtt     76740
     taagcaggga tccttttaca catcggtccc tggacctctg agctttctgc aactgctttt     76800
     cgctgtatgt gaaaataaat tcgtttccac ttattctcaa catcttgtat gcagaaagag     76860
     tacctactat gtcgtcctca gatatgtgag tttctttgga tatctcgttg atgcttgctt     76920
     tgtcgtgtct tgaaagatac tctacaacaa cctccatcca atatgctctg tagctaagaa     76980
     gcccaagatc actcagaggc ttttcaggcc cggaaatcac attttctctt ttgctgagta     77040
     ggtatgagaa gtcgatcagg actctcccat atccctttct ttgctcaaaa ggaagggtca     77100
     agatgcatgc aagattgtat ccctgctcag acaccttttc ctttgagaag tatcccacta     77160
     tctggtatcc gttgtcttcc agcctgcaga gcacataaaa cataaataca tctatatcgt     77220
     aatagagcga cttgtgatcc aaaaacagct ttgaaagtag agataagttc ctacagtagt     77280
     ttttctgtat gtgcccgtcg cattcaaaaa aacttaagtc tccgtcccgg tatatctctc     77340
     ttccgggagg atggcgaagc ttgcattgcc ttgcatgctg agtcaggctg tccattgtcc     77400
     caaaatagta aagacagaac tcgcatatgt aaaccacgtc gttctcggct attgcctttg     77460
     gatatggcga gaaataccat gcatccacaa gataattccg aagcatgatc ttcttgacgt     77520
     tcttcatctt gaactcttca tcctgaggcg gcttctccag cttaggctct tcatcccctc     77580
     ctccatcctc cttttccgag tctcttctcg acttctcggt ctttgtcttt tccgacttct     77640
     ttttcttagg aatctccacc tgagaagggt cgctgaggtc aaccatcgac gagtctatcc     77700
     actcatcaag ccttctgttc agctccacat aatggacata gaactcaagc ctggagttgg     77760
     ttgttcttgt cccaagaacc tctgctttga atacttcttc ggccccatcc acaatcttct     77820
     tgactggaac tttgaatcct atacaaacat cctcgagctt cataggctgg tggcttccat     77880
     gcaaattttt aggaaatcaa ctcttccctc cagatgaggg atttaaaaca ggaagaggag     77940
     gagaaggtcc tcaagaagct taagtttttc attggcgaca atgtcaacag gattctttct     78000
     ggagaagaaa agctcttttt gcacaaccag cgtgtcatgc tcctttcgga aaagatgaaa     78060
     gcggcaacat ctatgatatc caggaaaaat ctcatcatgg cagggacggt gatagggaag     78120
     tttaccaaga atgggaactt ccggctggga atatcgtctt tgaaccttct ctccaagtgg     78180
     gccatacaca aggtctggat caagagcagt gcagaaatga attatgtgta tggaaacaac     78240
     tctctgaaat ctcatatatt ccggagctct gagggaattc ccatcaatgc aggagtcttt     78300
     gtattcaatc agcatgatgt tcctcttggg tttgggatta cttccttgac gcctcaggct     78360
     tactctgcag caaagggaca tgcacttgtc cttctaagac agtcggatac aggagagtat     78420
     gtccgtaacg aagaaaaaat ataatcatat aaacgtttct tttactgaat tcctctgagg     78480
     aaatgcatat gtctgttttt acgattattt ctccctggac ggaatagtcc cgagtgttat     78540
     gtctggaaag aaggagagac ttctgaaaaa gtatttggaa aagaaaaaga ggcagaggaa     78600
     tagagatgag ctgtatgcac agatagctgc attatgtagg cctgaggagg atagaaagga     78660
     acaagaaaag tctgaaaaga ggaagctgga agaggtccgg agtgattctg aagacatctc     78720
     gttgtcagtc tcagaagact ctccatcttc ctcagaaaat gaggtaggcc attctttaca     78780
     aaccaaggcg atggatgttg gatgtgaaac catgaaagac tcgaatgagg aggaggcaat     78840
     ggatatgtat ttgtgggata cccacgcaag aaacatccaa gaagaagcca agaatgccat     78900
     ggtattttcc gaggataaag agtcttcgga gtgtgaagac ggcactggag attctgtttc     78960
     tgaagacaga aatacctaca tttctgaaga gacaggaaaa gatgtatcca aagagtatga     79020
     gacaaagact cttgaaaacc gacgggaaga catcgaagag tacagaaaga cattgccgat     79080
     ttactacgag aaggcggaaa tcatatttac agtccggaac tcctcgatag tatttattac     79140
     gggagcaact ggatgcggga agacaaccca aattccacag tttctctatg aaggggggtt     79200
     ggggacatat ggaatgatag gtgttacaca gccaagaaga atatcggcag tctcgatatc     79260
     cggaaggatc aacgaagaag ctaatgagga tatttgtgga tacaaaatcc ggtacgagtc     79320
     gtcggttact tctgaaacca agatcaaagt aatgacggac ggagtactac taagagaaat     79380
     acaagaggat tttctcttgt caaagtattc tgtcatcatc attgatgagg ttcatgaaag     79440
     aagcactaac atcgacctcc tagtctctat gattcctcgg atcatgaaga taagaaagga     79500
     aagaggaaat gagcttaagc tagttctgat gagtgccacc ggagatgtgg atgaattcaa     79560
     agcattcctt ggagacatta ctgtctttag atgtcctgag aagggattcc aggtgaacac     79620
     gttctatgag gaaaggaccg aaatggacta tctgaatgca gcatatgaaa gaataagaaa     79680
     gataattctt tctggatccg actctggaaa gagaagaaag atgaatggag aaaggtcgga     79740
     tgtgattggc tctgccgttt ccaacgacaa gtctgcttca attcttgttt ttcttagcag     79800
     caagcaagag atatatcagc tcaagagtag gctggaaggt tctggaatgg atttgactgc     79860
     tctccctctc cattcatctc tctctcgagc ggagcaggag cttgtgttta aaaaaactcc     79920
     gaataggaag gtaatacttg ccaccaatgt tgcagaaacc agtattacaa taccagacat     79980
     tgtctttgtg gttgattcgg ggaaagtcaa gaaccggatg gttgactccg agggaattac     80040
     aagatactct gtcgacttta ttacgaagtc aagcgcaacc caaagaatgg gaagagctgg     80100
     gagaaccggg cctggaatat gctaccgact gtattctgga aaggcttatg agaagttctt     80160
     tgagtgtatg gagccgcaga ttttgagaga acctcttgat ggagtagtgc tcggccttct     80220
     gtctctggga attggaaatg tttatggatt tccgtttctc tccaggcctg aaaagaaatc     80280
     catagctagt gccactatgc gcctccaagc actgggtgca attgatggaa acctaaggtt     80340
     aacagagctg gggaagaaga tgtcgatgta tcctgtagaa cctaggctgg caagactgct     80400
     ttgcgcacag ggatttgagg atatatttac tgaaatcctt gttcttgtca gcttgatttc     80460
     cttgggtatc gaagtgagga ggaaccacag caacggaaag tattttgaag gctccaaaag     80520
     cgatcttcta gttcttctgg gaatctacaa tgatttcttg aagagtagaa atagaaagtc     80580
     gttttgcaca gaaatgggcc tgggctatac aacagcagtt gaggcgatga agatgataac     80640
     acacctggca aaaatcactg gtggtacagt ggacaaagtt gggtccctaa acttgactcc     80700
     ggacacatgt tcccgaataa gaaacataat atatcgagga tttgcagatc acctagccat     80760
     gcctttatcc ggcactcatt tctttcaaaa agaagaagtc tctccatcga gggatagcgt     80820
     ctcggttgaa agcggggact ttgttgtctt tgggagcctg gtttctagca aagggaagct     80880
     atatatgaaa aacatcacca ttgtcgagga aagctggttt taaaatccaa agttttcttc     80940
     tttaaacctc tgctttatta cttttttctg atcctttttt taggtttagt cccctttctc     81000
     tcggtttttt caggcttaac aaacttttca aacttgacgt tcttcagctc tgccattcca     81060
     ggtattttct ccagaaagaa aagctcggcc aaagagttga agtccaagcc cttgtagtcc     81120
     aagatgtaag acacaaagtg ctccttgtat gaccttatgt aggacacaaa ggccttaaca     81180
     gaaaggttta ggagatcaga atcaatcttg ctctttatgt cgctatagga agtcgaaggc     81240
     tttatcttgt aactgctctc tgccacggga atccccttca gctttagaaa ctcggtatat     81300
     gctttctcat tcggcatcac aaagaggatg gactcccctt tgcatccatt tctggccgtt     81360
     cgtccacttc tgtggactat actgctgtat tcctttggga tgtcaaaatg cactaccaaa     81420
     tccacatcct gaaagtcgat tccccttgcc gccacgtctg tgcagaaaag aaggctgttt     81480
     cccttgaaaa actctctgta gaccctattt cgctcatctt gggggatctt cccatgtatc     81540
     ttgcagatgt tttgcagccc agctctcgaa agcagactag aaaagaagtc cacctcgttg     81600
     caagttgcaa agaaaacaat acatcttcgc ccagggacaa tatcaactag agcaaatagc     81660
     ttgtccatag gacttagaac aatatattcg agagcgacag gcattgcgtt gttccctaca     81720
     ttgatgctaa caggattcct tagagaagac atcgagagct tgctcacaga gtcgttgatt     81780
     gttgcggaaa ataggcctgt aactctgttt tttggaagct ttgcaagtag ttgcaggagc     81840
     ttttcctcaa acccaaagcc cagtagctta tctgcttcat caagtatagc atgtctgacc     81900
     cgtgaaaatt tctttgtgtc tctaccgaca atctccaaga gtcttcccgg cgttccaaca     81960
     acaatgggaa attccttctt cattctttcg tagtcatctt caatgttcat tccgccgata     82020
     aagcattcgc atcccacccc aaacagatcg gctacgtcct tgatctgcaa ggcaagctct     82080
     ctagtcggtg tgataatcat cgctacaatt cccttctctt ctctcctgtc gtatatcgca     82140
     ctaagtattg gtgcaagaaa cgccatggtc tttcctgtac ctgttggaga ctggaccacc     82200
     acatcctttc ccttcagcat ttccggaaca cacatctgtt gaacatcagt catcttccca     82260
     aacccgttcg cttctatttc cttcttcaaa atgctgttta taggaatatc ttcaattccc     82320
     ctgggacgca ttaaaaccgg gacacatcct agttgatcta aaaatacaaa attccgtaaa     82380
     acttatagct ctctctaaac ttttattctc agcttccaga aggtagaacc catgtcttta     82440
     gtatcgagtt gtatcttttg aaaacagagc gcgagatgat tccgtcctca accaataaat     82500
     agccgtactt gaagaccacg ttcatcttga tgtcaggtgg gcactccccg agcccctgta     82560
     tgatgagatc cataagcatc tcctgcttct ctatttctct catgtgtccg tcgagaatag     82620
     agaagaacat ggaggccttg atcgttgatc catctatgtc gttaaagtct atcatttcca     82680
     ctaagaacat cgaaaatgct tctatcagat cgagagagga agcgttcctc actattctca     82740
     ggagagttat ttgcttgaca acatcgtcca tgtccactct gtccagatcc tcccgctcaa     82800
     ccacagaaag cagatacagc acaacatcgt caaaaaaaga tgttcctctt cggggctcct     82860
     tctcctcgaa aacagcctcc tcagcctcat cctccaagta gttgtagtga ataactcttc     82920
     cctcagaaaa gactatgtgg tccataaagt cctcctttac cgaaatatca tcccatataa     82980
     tgcatctgtc tatgtttccc ccgataaagc atccatgccc aaccaccgag ttcttgatga     83040
     aatgattcat cttaaacttc aagtcgcatc cgataacagt atttgatatc ggttcatgga     83100
     actccacatc cgggatgtcg aagaaaaagt tgctttccac ctgtacaaag ctccgaaaat     83160
     ccccagagtt atggcattta aatctcagta ggtccacagc ttttccctcc ctgacatctt     83220
     cgttgaactt aaagtagtcg tacaatgtga caatctccct gctgtaaaat ctatttcttc     83280
     tttcaatgct gagttgctct atgtttccat ttacatccat catatctccc tgtctgcagc     83340
     acattatctt gaagttatat gcgttgaacc caagaatccc tccaaccaga tccccaagag     83400
     ttttgaagtc gaagttctct gtgaagagtg gaaaaattgc cgatgacaca actgctattg     83460
     tcggggagga tagatttgca gtgaattcga tcgtcccatc gctttctact gcctctctaa     83520
     ccttctcact gttacacttc tcattgatac atttgttgta gaagataacc tcattgtccc     83580
     ggaacccata taagtgcgac accctactgt tgctttcgtt agggtgcaaa aacagagtca     83640
     tcacaaagct tttgtcttct ctatgcctat tgataatact tctaagagga tagttcgtat     83700
     agtgatttgc atatatgacc agaagatcgt cgaactcaag tccgttgtca tcgatgtgtc     83760
     tcatcagatc tcccaacgat ttcccatcgc atccaagcga tatgatattc atcctccccc     83820
     caagttctgt tttcttgaca tgttttatca cctcttcgca atcactccct gcaagaacca     83880
     cattgaagaa tttctgatca caaaggctcg atagaatata ctctatcatg ggtatatttg     83940
     ccacaggaaa cagagacaaa tttttccgga ggctggtcat ctccgcaggg atctgctttg     84000
     tctcatagaa gtcacaaatc aaaaggatta tctctctgtt ttcccttata aagtttttaa     84060
     tgtccctgat ttccatcaat tgaagggtat ttagatttat ttttgtttat cgcctagaca     84120
     ctattgatac atcccaatca aaacggccac acgttcaggt atcctatttg tgttccccat     84180
     ctcaagcacc atggccatca agttcctcta cagtgtttca ggcctgcctg cctaacatgc     84240
     aaactatttc ataatcaaaa tttaattttc ataaatatta cttgcctctc ctcgccctgc     84300
     cgatctttgc agtgtttcct ttatcctttc agccctttca acaatttctt ccggaacccc     84360
     tgccattctt gcaacataca acccatggga gtcccaggac gtcccatcca tgagcttgta     84420
     caaaaacaca atgtcctttc ccttaaccgt cgaattcata tatccattac tgactccttc     84480
     aacctctctg atgatcctgt gataatgggt tgaaaacaga acatggcatc ctctctcctt     84540
     aaggtagtcc agaacggccc tggcaatgca ctctccgtct cgggtcgaag tccctcgtcc     84600
     aagttcgtcc atcatcacaa gggagtttct tgttgagtgc ttcaggatgc ttgccgtttc     84660
     ccctagctca accataaacg tcgattctcc ctttaccagg tcatcccgtg cccctatcct     84720
     ggtaaatatc ctgtcaaaga gaggcgtctc catcttctca cagcacacat ccattcctgc     84780
     ctggctgaga attacattga agcacaaagt ccttaataag gtcgactttc cccccatgtt     84840
     ggcaccagta agcacaagaa ttctcttttg tgcattgtag tcatttgcta caaaggtagg     84900
     atatattgga ttcgacattc cacagatgcg aagcccttcc gaaaaggtgg gggttgttgc     84960
     tctgttcctt tgcgaaaagg tagtaaacga aagataacaa tctacatttg caagttccca     85020
     gaacatctgg cggaagaaaa caacatgtgg aagaagtaca tctatggctc gcctaagcaa     85080
     cgaccccttg gattggaata tcttctcttc gcactcaaca tatctttcaa caagattttt     85140
     caaatctctt gtgtagtacc tattggttcc cttggtggaa gacattatga agtagtctga     85200
     tggaactttc gtctcctttg ctacctccat ttggaatatg tcctttccta cgtctttgaa     85260
     ctttatcgat tgacatttta gcctggcctt ttgttcccgt aaatattcat tcaggccttc     85320
     ctcaatttct ctcctttctt tcatcaactg gcacagttca tctccatcct cctctccagg     85380
     agatatttct gtctcgctca catcatagat tttacggtgc cattcaagca ctttgcttat     85440
     ttcccggctg aattcttctg cctttgcaac catagattct gcgctatcac ttttctggcc     85500
     cttcagtgtc tgtaccaaga catctcctgc ctctctacag gcatccagac acctaatgaa     85560
     tttgtttagg tccttagtac ccgggtttcc attgaagagc cttgtcaaaa gcctctcccc     85620
     atcccctatc ctcgccaagg cattctttag gttagaaacc tccacctctt tgaacatacg     85680
     tgctgtttct tgtctctttg caatgtcctc cctccttaca agtggtgctg ctatccatct     85740
     tctaaggagc ctttgtccaa agggtgtgct agagaagtca attgccttga agagagtctt     85800
     ctcccctgtt ccattgtaat tgttcttgaa tatctccata ttccggagag tggcgtcatc     85860
     aacaaccatg gttcttgcct cgtcctgaag cttcgagatc tttacattct tcaaagcatc     85920
     acttctccga agcttctcca tatactttgc caaatactgg aaacatacat actctctgga     85980
     gtttgaaaac tcatacttct tgcttgacac atatcccgtc ttatcaggca caacccgtgg     86040
     aatccctggg atggtgaagt ctgcaatcat ctcccggaca tcgtgttggg acagaattgt     86100
     cttgattcca tgtcttgctc tgtcatcaca gaaagacgaa aaatacactt ctccaatgct     86160
     tgcatcatac agcaaaacag atgtatgaat ctctccattg cacttctctg cataacaaat     86220
     ctcatctgtc gccacactca tcaaatacat aggaattgac gacttcatgt agtctatatt     86280
     gtatatcgtc ccctgtgtaa taatctcctt aagctctcgc cgtattattt tgtccttggc     86340
     catcctgccc tccactccct tgctcagctc gtctctttct cgtatctgct ttccaatcat     86400
     gttttcgctt tggtctactc tagcaatctt gtatccgttc tccagaaact ttctggtcca     86460
     gtagtcaaga ctactctcag ggaacccgga catcttcatg tttactctat ctgtaattct     86520
     cagatcaaat agttttgctc cgataagtgc atcgttctcg tatagctcgt agaactttcc     86580
     cttcttaaag aacacaatcg tatcaaaatg atccttcttt atgtcccaaa attgcttttc     86640
     aaagggtgta aatctattgt actcgctctt cggtatcaag agcgttgagg gatcatatcc     86700
     ttcttctccc actcttctcc cgtttctgtc cctaatatct tccagaaatt tatatctctc     86760
     ctctgtcttc ttctcttctt tttcttcttt tcctaatccc ttgttgcttc tataagatgg     86820
     ctccacatcc gagggtacta taggtttgga accatctgct gcctcttctc tttcctcggg     86880
     acttggagcc ttacaaattc tcttgtgctc cttgagatcc aaaataccag tggagtttct     86940
     gctgttctcc aaatcaacca tccggtccaa tgtctcccca gaatcctcct ttttcttcgg     87000
     agctttaaag tagtcaaata gtgtctttct ttctttcatt tcctggcctc ttaccaccga     87060
     aaatttatac aggcctgggg ctttttacag atgcacttgc aactagaaca agcacaacaa     87120
     aggctgctac agacatcagc tccaagctta catctggagt ccgcccagac agaagcacgc     87180
     ccatagttac tgtgagtgtg gagagaagat gcctctggaa cagcttcatg gagtctttgc     87240
     tgacacattt gtttatgcag ggacaatgat gatcaaaccc aagcacacat ctctcgcaga     87300
     tagagcaatg tttggttcca ccagctttcc gtactaggca cgtgtagcag aaatgctcca     87360
     ttgtgtattc gtcttgttct atcatcgtag acaccaactc ccttgcctct tggtatgtac     87420
     ccacaggacc gaaccttggt ctggtcaaga acaaacaaac cagattgaag aaatactcaa     87480
     gtgtgtgggt tgtatgctca aagtcttctc caagcacctt gtagctaatg tagaaagaat     87540
     aaaacagatt gagatacaca ggaagtcttg tgcgtgccac tcttccccag aagatcagaa     87600
     aaacagcaac aactccaact tgccatgcct tccctaagaa aaaagatccc cagtgcatcc     87660
     ctatcgatat tccttctatc atccagatct tatacctgtc cgtaactcga tttgcttcca     87720
     gaaacctctc cacattccta gcacgctttc cccttgcata tacacgcagc gttcttccct     87780
     tgaagtcttc gacacccgcg tctgcaccat agctcaagag aagaaccatt cctagcacat     87840
     cgtcaaatct ggcacacgta tgcaacagcc ccattccact tttgttcaca taggtgatgt     87900
     ctgcaccgtt ttctatcagg agtttcataa ccttatagtt tgagttgtaa agtgcatagt     87960
     ataggggcga gctatcaaga gctcctccaa cactgttaac aatcccagga tccttcacca     88020
     gtctatggca gacgtccagg ttgttgtaca tcgacgccca atgaataaga ccggttccat     88080
     cggaaaaact gtagctgttt ggaaccgaat ccagaaatac tgagctattt gccattaagg     88140
     ctgcctttat ttcctcatcg tccatccgat aaacaaaata gataaatata aggttgacag     88200
     gaggcaggag aaaatgaact cctggagcat ctgggaagga tctaataaaa acatattcgg     88260
     aagaccctat gattcatgac gaaaagatgc ttctgaagtc tctggaacac aaaaatatag     88320
     aggaaaaaga gatcttcccc tcaatatgct ctgttcttgg ccttcagtac ttctcggagg     88380
     agaacggagc cctggcacat acgcttgcaa gtccttcatt catcatagac atatctggat     88440
     tgagtgcaaa gctgactttt gttgacgaaa gcttttcaag gtattttaaa tatgtcgagt     88500
     tctacttgtg ccaacatctt gagaagagga acatgcggga cttctacttc taccttagga     88560
     tgtttgtgcg gatggagacg ggaaacgagg ggcttgagga aaaggactcg ggagacattt     88620
     gccaatgtgt ctttaatgga ggctactgca taaatccgtc tttcagggat gtggctaaaa     88680
     gtagtaccga tgggatttac gacatataca ggcacagatt tgaatatcac atgtacacga     88740
     aaagatttat cttccccatt cctgtgaatg atcctgtaga agatgaggac tctggcttct     88800
     tggtggccga gggtgtgaat ggaaagcaaa tgaatgcaaa ggtaagcctg aacctgtcca     88860
     gatactttgg gcccaaagcc tttgaccgtg aggtgctcag gatacttccc catataggct     88920
     tttattggaa aggaatggtg gatcatgagg aagtggttgt tcggaaggac cttggtgtat     88980
     atgtcaacgg agagctacgt agagatgcag cctttctcat gaagcttggg aagaacttgc     89040
     atctttctct taacttcctc agggactagt ctcccatggc caagactctt cttatcgcac     89100
     cctgtacttg aaagttcaca ggagacaacc ctcctctcat aatgctggtt gtgaacggga     89160
     ctggtctaag aagaaactca attatagagt tatgtgtgtt tccggacatg aatgttcata     89220
     gaatgatggt tgagctgagc aaacagacag acaatcctgt attcttcgac accgttggaa     89280
     acctaagagt agtagcagat gcctcgttta tcctgagcta tagaaaactt gtgaaggcac     89340
     ttctgtccct gaaatctaga agaggatttg tgctgttcat tgattccatt tcatttcttg     89400
     cagataaatc tgtggcaaat ctccagaggt tttacaacat tctgtggatg ctgatatacg     89460
     agaacgatgc cactattgtt gtatcgaacc actacaggat cgttagaaat cgaggagctc     89520
     ttgactttgc acttgagttg ggacagaggt ggaaaatgat ggtaagctac aggattatgt     89580
     ataaatatgt tggggacaag gttgttgcaa agatctatag cgacgagtta tttgagaaag     89640
     tttgaataca tgaaagttta taaaaccaat tcacacaacc cctgtcttag atgttttatt     89700
     ctaaagcgac tgccgatgat gagagctctt ggcttaggct tgctagtagg gattaaaccc     89760
     accctctgca atatccatat gatgagagca acaaagagtc tctgaggcct tcaaattaat     89820
     gtttattcca tcttccccca tcgctttcca gaaaggtcat tgaggccaag catcatgcat     89880
     caaactgctt taataatcgt cgcctcgagt aagaatctcc tttccattct cgcttagata     89940
     gacagtgtgc tcgaactggg caaccttgga gccgtcgatg tcgttgagag ggggatatgg     90000
     agtaaagagg cccatcatcg taagaagatt cacacttttt agagacccgc cctcaaccag     90060
     gttgtagtga tccaagtgtc tcggactgaa gggaagagtt ccaaacgagc tctttacaaa     90120
     ctcataaacc tttatcagat ccttattgaa gagcttcctg ctcttgtgca cattcagcat     90180
     gaagtgggag catggagatc tatcgtttat gaatcccttt cctgttgttg caaaagtctc     90240
     cacagcataa aacgtgtctc ccttgattct tgttgtgtct ctgttgttaa cagcaggtat     90300
     tgaaatcccg ccgtggatct tgaactgcga tatggaatgc ccatgaagat cagacaccgg     90360
     cctaattggc catgttttcc cttctatttc aacttcgtaa cttgtgatga cttcgttgat     90420
     atctcttcct atgtcgcaga cccttgcatc tattcctaaa gatcttattc ctgtctctgt     90480
     tccttccctg gctgccatca gcaaaggttg gagattctct tggaatgcca ctgtaaatgc     90540
     agaatccatt attcgcccgt tcgaatgtgt tccaaagtcg acttttaaaa catcgtcttc     90600
     tttgagaaca atgtcctcct ccccaggatt gactgtgtag tgtgctgcac atgagttcat     90660
     cgacatccct gccggaaatc ctattccatt gtttctttct ccctccagaa gtgttcttgt     90720
     cgagtcttct atggatctta caatctccaa aagcgttatc cccggcctta tgatactctg     90780
     gaccttgtac cgcgctcttc tgtgagcctc tgctgctcta cgtgcatcct gtaagaggtc     90840
     gcagtcggtg gtattttcaa tctcctcacc ctttggccca aacagtcttc cctttctgta     90900
     gcaatcgcct tttggaagaa attcaatagg aagctctggc gcctgatcaa tcagaataaa     90960
     cttcattcta tgggctctgg gaatcagaaa ttatcggctt gccatagcat ttcattggga     91020
     aacattattc tctaataaca ccaacagccc gaacggccat aggccccaac ctacaaccaa     91080
     aggacttcca aaccacataa acatattaat ttattcatcg aagaatccat tcagaaccct     91140
     ttcggtttcc agaatctcct ccatcttctc gttatacctt ctcctcccag cctccacaat     91200
     gctgtctgca atccttgtca gagaatggtc ttctccattg tattttctgc agttgctacg     91260
     cataagctcc aaatcgtcca gaaactcgtt gaatttccta tacttgttgt gtctggcctt     91320
     tgttttgatt gttgttaggt caattgggtt gtccacaatc aagggatagt ctggaaattt     91380
     cttgatagac acaggcctat ggaatgcaat agaatatgga atctgaaaga actgagcaag     91440
     aagatccagc atgatctcct gcagatacac tctggctttt cttttttccg cttcaatctt     91500
     cttcttcgtc atctttgctg cagatgcaaa cttaggacat gccttgttcg tcttcatatg     91560
     ccccacttgt ccacagcttc cacatgtcag cactcccttc ctttcctcgg atattttctt     91620
     cttccgtgcc ttcaaatacg ccttgataac acgaggatca gaaatccttt cagtttctac     91680
     ataggaagat tccccctccc cgtaagtacg tctaatagta aggaatgtct cttcagacag     91740
     caccgttgtc tcactcgcca catctgtatt tcttcttcct tctttatgtc tccgggcaag     91800
     gaaggaatca ttaaatggaa tctcttcaac agagcttaga gatgcaagct gcttgttcca     91860
     tatcctgtcg atctcttcct tgtatcttag ctgatgctcg ttaatgatct tccggttttc     91920
     aacctcgttc cctctcttaa gcctgatctt tctaaagcta aacccttctc caatccccgt     91980
     ggggtctcca ggcccgctca actcaagaag acctcttccg ttgcatgcat ttacaaagtt     92040
     ccggctgagg caccatggag gcggaaccat ctcctcctca ttttcctcat cgtcactttc     92100
     gacaaccatt ttgtatcccg agtcctggag ttttctttcc cctgccaaca tgctctcgta     92160
     ttggcatatg ttctcgggag taacaagctt tctgagatct tcttctccaa gcaatgcaga     92220
     gctcggcctc agaacccata cattatctcg tcctttctta acacagtctg catactcctt     92280
     cagccacttt ctcttgctac cctcgctgaa ataaggaaac atttcgtcca gctgcgaaat     92340
     cctcagctcc ttgcttcccc ccaccttgct gttgaacaag cggaatgctg caaccttaag     92400
     tctgtttttg cagaatatat tgagctttct agaatgcggt gcataaacct cctccagtgg     92460
     aaactgctgc cctacacaat agagattgtc aatgtttctg tacgtcagga actccccatc     92520
     agccgatgac tccacaatgc acaagtagtc tctggagctg tgtttgaaaa caggtgcaat     92580
     gaacaagttg tttgtgatgg cctgtataga tgtcccaggc atgacatctc caaacccaga     92640
     gaatggagaa ggatcctcgg ggtccagaat agtgtattgt gactggtcag gcgcatactc     92700
     gtctcttaca ttactctttc tataatagat attgagtaga ctcaccatcc ccggattcac     92760
     aaggaaaaac ggttcctcct cagaatattc aaacagcgag aacgggcctc catccttgat     92820
     tgttagctct cccgctttct ttatgatgct ttgccctttt cccctgttgc cttccactgc     92880
     tttgaacctt ataccactgc catttaccat aaatcttggc ctatggaagt tcctaagctc     92940
     ctcccttgta tgattgtttt tgtaaaacat cggatctagt cgcaacgcag gaagagaatg     93000
     ctgaacccca aacgtcccca ggctgttctt tgtcctcgac tcctgtccat aatacttgtc     93060
     aagtgaaata ttatactttc ccttcagagg tttgtccaca gaaaatacct ctttctgttt     93120
     cttcttgggc tttccttgct tcttctcgtc caccttttcg aagattaagt tggggtcctc     93180
     caaatagagt gtgagaaacg atttgtagtt cttcatgtcg ttctcatcca caaccacgta     93240
     cttttcccag tcttcctcca gaatactgtc caccagctcc atggtaaccg tatcagaagt     93300
     ccccaaactt ccaatcttgt cggtgtcgta gactacatcg ttctcccatt ccaccaaatc     93360
     aaaaggatac ttgatctcct caaccctctc caagacatcc ttggaaactt tccgcttcaa     93420
     aatctctttc tcaagctgct ttctcttgag atactgcttc agtcccgtgc ttcttgtgga     93480
     tcctgaaaga gcttgaagtg ttgtgttgct atcccttgca tatgtcatgc tgtttctgaa     93540
     cttgccctgg tcatccactt catagctcat cgactcgttc ggaaccttcc gccctttata     93600
     cttcctaagc ttgtattcat aggacttctc aatcaccagc aggtctagaa accccacatt     93660
     tgcaggcctt gtctccaaag tctcatcccc gtcttccgta gttctccttt ctccaccctg     93720
     tgctaccttc ctcgagcagt tgtcaaactc agtctgcatt cctggatgtt tagggggatg     93780
     tctttcaatt ccgaatcgat ggagaagcag atgttttttc aaagtagggg cccctcatga     93840
     gtatctccgg ccctcaagac attccccagg aatacataaa caacgagaat ccttttgcat     93900
     acatgaagga atactttgaa aatccatttt tggatccaga gatcaagctt cgcctcaatg     93960
     ctttgcagca gatgcagcct cggtttgttc ctcttggaat caacggttca gtactcaagg     94020
     cagagcaggc agccaaaact aaagccatag tcgagtccca gatagagaga ttactccaag     94080
     aaggaatgag tctaataaac agcaccgatc cagaaagaga ggctgttttg aagagcaatg     94140
     ccaacgaccc aagaatcctt gatatcttga ttagcatagg taggctgaag ctcttgagta     94200
     atcaggagaa gcttagagaa aaggtttatt gtgctttgaa gagcacgatc ccatccgatg     94260
     tggtggagtc cgttgactat tcctctcctt tgaaagaaga ctacctcttg ggtgcaatgg     94320
     agtatgggga actggaggag aagtccaata agacagagcc gttgccatcc ccaaactatt     94380
     aaatcttcag atgtatctct tttcgttgag cacacacatc gatgctgcca caaacccttc     94440
     tagatgatat atacttttca ttccaagcct tatcctctcc tcatacttca aagcatggcg     94500
     tgacaggaga agaaacgtct tgaagtcctc cccaagaaca aggttgcgca gtagcccgat     94560
     aagaatggtc ctgggagata tgcatgtgtt cagaagtgca tacagactct ttctaatttc     94620
     aaccagtcct tccgatgtcg gattacgctt aatgactcct gccatcgacc ccacttctat     94680
     ttcccaatca agcttcattg ccttacagtt gttcttcggc ctttttgctt ccttctcgtt     94740
     catgttaaag caaaacagct cgagaatgca gagagccctc ctcatgtttc cctccgactc     94800
     tctacatatc tcttcaagtg tttcctccgg gacagtatag ttttcctttt ccagtatcct     94860
     acgcatgtta gacataatat cttcgtcgga aaagcctggg attctcaaga agaagcatct     94920
     gcttcttatt ggctctatca gccttgagag ttcgttacac atcaatacga cacggagaac     94980
     attactgtac atttcaattg ttcttctgag ggctgcttgt gcctccaggc tcaactcttc     95040
     cgcagatgtt ataacaatga gcttgattgg ggttctttta gctcttgaaa gcatcgacag     95100
     tataggtttt gtctgcccca tctccttaat gatgttttgg atgacagcct tgtcgtgatg     95160
     cccgtactgg gatggagata tctcgacata ctcgtcagac tccatgtacg acacctcaat     95220
     ctttttggtt ccgcttagaa cctcaaccgt ccttatcttt ggctcagagt ttcctccata     95280
     caaatggttt atcagacaca ggagagtggt tttctttccg tgcccagact tcccatgtag     95340
     tatcatgtga ggaattgtct ccagagtata acttttcaag aggctcgaga tcttgtcccg     95400
     tccaaccacc ttatcaaacg acgttggcct atacttttca atccatatca tctggggtgc     95460
     atgttccaag agacctttta tctaagtata tggtcgggta ccttctggat tgactgttcc     95520
     tttacactct cttctgacac ttctctaaag acgggcttca gatttctatg cagtaaaata     95580
     caagtccatg gactttgaga gtaaagacag gagatatgga gatcttcccg ggagacagac     95640
     aaagattttc atgaaaaatg aaatttccga cggagacagt gcagcaatag aaaacacaag     95700
     cagacaaatt ccccacagtg agttcgaggc ttttcttaaa gattattttg cagaagcaga     95760
     cgagaagaag tttaatcaga ctgttttaag gacgccttta gacgaggaat ggcttgagga     95820
     gatagttggg aaggagactg aatgtgcaag agaggccatg ataaagggtc ttatgggatg     95880
     tcttatagac gaaggagata ttcttaatgg cttttccgaa gttctggagg aggaaggatc     95940
     tgcagaaatg gaagtggaag actgtattga ggtggagaag actctaagat ccttttccct     96000
     agagaatata agggatctgg ttagactgta caaagaacaa gtttcgatta acaacaagag     96060
     gaaggacctt cttcgcaaga agttaaaaga gagattggcc tactatggat actggatggt     96120
     actgagggcc attgactcgg aaattgagga tttggtttcc cgagagaagg gaagaaagaa     96180
     gggaattgag gaggaaagag ctcgggaggt tctagaaaaa cgttccgaat tcatggaatt     96240
     attcaaggat ttctcggtac ttgaggagga ctatagaaac tatgaggatc tatttgatcc     96300
     caaggagaat gtggatgcaa gtaggcatgg agtgtttcca tacgactact tttcataaag     96360
     agggaaggct attaggaagg aaaagataat gggccgggag cccctggaat gagtcttgag     96420
     gaaaagctaa tgaaaaggct agagggaggg atgtttcgga tactgaacga caagatgtac     96480
     catggaaagg gcttaaagaa gagggacttg aagctatatc atgagctgta tgatcagcag     96540
     gttaagcgat ggccagttaa tcctcttgat gttattattg agaagataaa gaagaaagga     96600
     aatggcatgg cgatagcaga cataggatgt ggagatgctc ggatttccag ggagtttgaa     96660
     aatgtaatgt ccttggatct gaatccttct cgaaaggata taatccgctg cgatatgaga     96720
     caaaggatcc ctttagatga caagagtgtg gacattgcag tttgctgttt aagtatgatg     96780
     gctgagaaca tttcggttcc tatgaaggag gtaaaccgga tactaaggga gtcggggtac     96840
     tggtatatag cagaagtcaa gagcaggata cctaatataa agcatctgga gaagaagttt     96900
     gagagctttg ggtttgaagt tgagcatacc gacatgtcaa atgcacagtt tattcttttc     96960
     gttttgaaaa agaatctaga taagaatccg aagaaacttc caccggtcag attgattcca     97020
     tgggtttaca agaagagatg aaggtggaaa gaggaaactt gatgtttact acctttggct     97080
     acttggcgga aactccgaag aagaagacaa aagctgttga atacaccgag tagtatatga     97140
     agaacaggat tgatacaacg atgtctggcg tggtcatagt gaagcactct ctgcagttct     97200
     tgtatcccat cctcattaca aacacattat tcatgatgat gaagaatgcc aggaggttca     97260
     ttatctttgc aataacatgg agagcttaaa ttaaagatag cacttaccat ttatgattct     97320
     aaaatacagc tttcctttct ttgccattgg ttttacaaga gacagagctg tggaatatgt     97380
     tattataact atgagaacct ggcttccgta gaaatatctt ggtgctaggg atgcagtgag     97440
     gatcagtccg aggagcgatg aaatctttga attagtaggg caaggcactt accatttcca     97500
     tcttgtcttt gaacatcatt gtggtctggg gttgggtgtt tagatggttt gttgatgcca     97560
     agaagggagg ccatggtagc ttgatgggct agagacagca agggttccct tggacacatt     97620
     gggaatggat ggctagaacg gagaagtaaa aaatatttcg ggatccctat gactcggaga     97680
     ttcaccatga cgccgaactc caggaattct attaagacac ctatttcagg ggcgaaggtt     97740
     gctctatttc caagacactc tgtagcggct gaggagatca agaggaggga tatgaggctg     97800
     gtgagagaga aaggatacaa gcagcagtgt gttgacacta ttttagggtt tttgatggaa     97860
     aatggatacg atggacagat atcacagaag atcatgcata acccgtcttc gaaggacttc     97920
     caaagtatct tcaagttcct gtatggattt gtggacgact ttgtgttctc ctcaaggttt     97980
     gaggacgaag ttgtgaatgt gatgaagaat ttgaggtatc catattgcgg ggagattacg     98040
     aaaagccagc tgagtgcaat aacaccccac acatggcctg taattctaag catgtgcagc     98100
     tggctagtgg agctgataag gcatggagca actcttctcg agcaggagga agagaagagt     98160
     gttgagagct gtttctttga gtatgtgtgt gatgggtata tgagatttat ggaaggagat     98220
     gaggatgatg cggctcttga ggaggaattt gagaggaagg tcacagagat atacacgggg     98280
     atatttaagg agatcgatcg aaagaaggag gaactttccc ggattgagga gatgataggg     98340
     aagtctcgaa ggatgtctga aagccttgga gagctggaga gaaagaagag agagttgaca     98400
     gatgatctga acatgctgat agcttctgag aaacagcttg aggggaagaa gaagaagtat     98460
     ctaggggcta ttgagcgtct ttgcgaagat attgcaaggg ttgaggagga gattgaaagc     98520
     caaagggtac aagaggaagg attgagggtt caaataacga aacagaagat caatcctgaa     98580
     gacgtaaggg agatgaatac cgagaagatg gagttattta aggagctaga aagaatgaag     98640
     ccggagaagg aggggcttat gagagaggta ggagaacaag aaagagaagc acaggaaaag     98700
     gttgaagagg ttgagaagtt gttttttgat ctgaagggtc ttcgagatga gatttcattg     98760
     aggatagtga aggacacaaa gggaggggtc caagtagtga atgaggtaag caacgaggtg     98820
     tttgacaacg gaatagcttc ggtgattgta cgtcttgaag aggagctaaa tggaagaagt     98880
     gatgttcttg tggcagggga gatgaacaaa ggtatgcttg aggaagcaag ggcagagaag     98940
     gaaggaatgt ctagcgaact aagcaacaga ctcaaatatt gcagtgataa gcttttgatg     99000
     gcaggaaagt tgtatctgga gaagaaggag atatctgaga acgagcaaag gaagagcaag     99060
     accgaaatgg agctgctgga gaacgaactt ctgaagctca atctggagtc caacacgtct     99120
     ctgctgatga gtgagcagaa gctacaaaaa gccaagatac ttcttgacag aacactcaac     99180
     accataaact atgagagaga ggagattagc aagatggtgt ttaacttcta caacacagtt     99240
     gttgatgttc atacattgat ccagtcacag gttggagacc tgaggacctt actgaacagg     99300
     tgagaaggct gggactaata aagttgtgtt tcttgttaca aagataagag cgaggaggag     99360
     ttttattctg gaattttttg ccctttcaaa ggaggcatga agaagaccaa taaaaagccc     99420
     aacggaggga aattccggaa ggaaagtaga atggctcggc ctgacaaaag aggggggaga     99480
     gaaaggatga ataacaagaa gaaggggagt gtacgggccg ggcttgataa aaaggtctta     99540
     gttgagccgc ataggaggtt tccaggggtt tatgttagtc gggggaagga ggatcttttg     99600
     cttacaaaaa gcttggcacc agggattagc gtgtatggag aaaggaggat tactgttgat     99660
     gttgagcaag aaagaatcga gtatcgggtc tggaatgttt atcgaagcaa gcttgcagca     99720
     ggaattgttt gtggggttga gaacatccac atgggcccgg gaagcaaagt gttgtatcta     99780
     ggggcttcat ccggtacaac ggtttcccat gtctcggaca ttgttgggaa ggacggagtg     99840
     gtgtatgccg tggagttcag tgaaagatct ggaagagatt tgatcaacat gtctatgaag     99900
     cgtcccaaca tcgttccgat aatagaggat gcaagacatc catcgagata cagaatgctt     99960
     gtgccgatgg ttgactgcat cttttcggat gtttcacagc ccgaccagac aagaattgtt    100020
     gccttgaatg cccagtactt cctaaaggaa ggaggaggag ttgatgtgtc gatcaaggcc    100080
     aactgtgtca actcgtcagt ccctgcagaa acagtctttg cagaagaggt gaacatcctg    100140
     aggaagcaca acatcaagcc aaaggagcaa gtgactctcg agccgtttga aaaggaccat    100200
     gcaatgatag tcgggaagtt taggctgtcc aagtctggag aaaagaaata gttcccccag    100260
     ggaaactcaa aagccctgaa gatgaaatca gaccttcata tccaaatctt tattttgacc    100320
     aaataaacga cctaaaagta ttatttcacc atttcatggc agtcttctta gttttcttgt    100380
     ccgccttctt ttctactcca caggattcct cttcaagaat tccatcgctt tcttccaact    100440
     cggcaacata tctcttcttt cgattctgtt tcttttctct ttctactgca gccttgtttg    100500
     ccaaatggaa tctgtccttg agctctgtcc catagattcc actctcaagc ctgagcatga    100560
     gctcgtctcc tatgttcttc tcgaagttga ttttgtttaa agttttgagt gctcggagct    100620
     tttctcttct attcatcttc tttcttctca ccatatactt tgtcttcccg tgctccttga    100680
     agcgctccaa ccttcggaga tactgcgtga gtttcgaaag cttctgctta catttgtgga    100740
     taatcttttc atcccagaac tcaagattct cttctatctg cctgagagct tcttcgtagt    100800
     ttgaagacag cttgatctct tcgtagacat ctctaggaac atgcacccgc tcaggctcct    100860
     tgataaacag gaaaagctct tcgcccattt cccggactgt tgcatacttc gagttggcta    100920
     gtgggcatga aaatctgtcg cacaacccag ttacattgtt cttgttcctg cacagagcgt    100980
     tctcttctgt cttcatcttg aacgagcaat agccttctcc acctatgttc ctccatatgc    101040
     tctcgtcgga catctatcgt gggtactggg tcatacaaat attaaccgaa tatagactca    101100
     aacatcccat gctgctaaag ggatgaagag aaggggtggc ttctcaagtg cttgaataaa    101160
     aacccatctg gaaatatctc tgctacacta gtgattccaa acttctctaa gaggtcggct    101220
     agcttacttc ggactaaaag atgtcccttg tgaagtcttc cctttatgtg cctgtctatc    101280
     ttcacttttg tatcacttaa aactatgcct gctccgcaca cagtgcatct ccccatccct    101340
     tctccgttgt tctttgcata atatgcttcc ttgattcttt ccagctccca ttttaccttc    101400
     tcgcattcat caaaggcgtg gcacgcttcc tccacttttc cttccatccc aagctgctcg    101460
     atactttcat aaagcttctt gaacaactcc tccttttctt ttattctctc aagcagagga    101520
     agatctgaag tatcagaagc agtgcatttc ttggcaacat ttcgaacatc caaaacaatc    101580
     tcaacaagta aacgaaggag ctcccattca tactcttcag ccctctttct tccatttttg    101640
     ttgtattcag cccggtaata ttcctcatgg ttaccatatc tgcactttcc aatgcttctt    101700
     ctcgtgttgc ggaacaactc aaatgggcag aacgaagcaa gcatgtatat gcaggtgtct    101760
     ctcctctccg aagatagctt gtcagggttg tagatgtctc tttcccgccc aagaagcatg    101820
     tcaagaactt cccttgctcg atctgtcatt ctaatggggg acgatacttg aacataggta    101880
     aagcgatgat gtctttctca gagagaaaca agctttgttg ctattctccg tttcccggaa    101940
     gccgtcatcc ttatctaaaa acaatcgcat agaacttctg gaggcccttt tagcctaacc    102000
     tggtaatgat acagaggatc tccccccaat cataataaac tcgccactct tcaactttat    102060
     ggagcagaag ctcaaggtct tcttcagaaa agaaacataa tcatgtggaa gtctggacga    102120
     ggtaaggtcc aaatatctta gagaaccttt gaagtgcatg atgacctcat agaaagaagc    102180
     cccatcaaaa gtacatccaa caaacccaag cccaaccaaa tttgggtatc tcaaatatac    102240
     cgtcttgaac atcctactgt cgatctccgc ctctgtcaca tgaagcagcc tcaaattagg    102300
     aagactttcc ctcatacact tcaagtctct tcctccaaca tacattatct ctgccatctc    102360
     gagaccaagg ttggtaaggc acttcagaaa gcccatgcat cgtacagcgt tcacaaaaga    102420
     acacagtctt acatccaaac agaccccttc atcaataatc ttaaaccata ccaactccct    102480
     tgagatacac aggtcaacga aggattgaaa gtcaattccc atgttgacaa gctctatctt    102540
     cttcaatttt ggcatctctt ggagcttttt cataaggcct tctctccact catggcatcc    102600
     taagacatca acattcacta gtgacacact tactagtgac cctacaccaa gaatattcat    102660
     aagatcctca tacgccacag tagtgtccct cataactatt tcctgcagca cagtgtctat    102720
     gttgctcctc atctttacat ttgcaacttt tagaatgctc agctttctaa tgcatgtatt    102780
     gttgatcgaa gccaaatcaa aagaacacga atcacagacc ctcaggaccc gaaggttgat    102840
     aaaggggtgg aggtcgacgt caaatgcagg ccttgcctca taatacacct tcctctcata    102900
     tggtttcctc cacggcgaaa gaatgggtac ttcccttgga ggcacagatt tgcacagagc    102960
     ctttagacgt ctatcgtatt ttccaatcag atataccaag tccctgggaa tctggaactc    103020
     aggcttgcat gtctctcttg gaatcaagcg cttcttgttc ccgatcttaa gatcagctat    103080
     tcttctcata cctcaaggga tctcctcatc ggcatatttc agcattcttg cttctcccct    103140
     gaagcagaat gagtctaaaa gagtctggag taatggttat gacaatagga gtgactgtat    103200
     tccttgctgg tgccattctt ctgatggaca gggcgctcat gatatccggg aatctcctga    103260
     taatcatagg aattgctctt cttgcccggt ccaggatgtt ctcctttctg cgcccagaga    103320
     aaatgcaagc catggtgatt tttggaatgg gaattctgtt tcaggtttac aagctccttg    103380
     tctttggctt ttttctggag gtcttgggcc tgttccttct tctgaaagac agcatcccca    103440
     cattcaggac tgtgctaaca accttactct ttggaaagtt gcagaaactt ataaagtaaa    103500
     gatctcgatt aaacaccaac gaatttattt catttacgag gaagaccaga gcccatctct    103560
     gtgtttcttt ttggattcct actccaatga agaactgctc tgaagttctc cccttaagat    103620
     tttcagccca tatgtattga gcattcttat agcatctact tcctcacggt tgcatcggtc    103680
     tgcatcccat ctatgcttcc tcttgaatat ctcaagaact ttcccaagac accgataggc    103740
     ctcctttaca tctataagcc caatcatcag cctgttgcag agcacatcgc atatcctgac    103800
     agccatctcg ttgtctatgc agtactccac ttcttcgaca aggtaggtgt atttctctga    103860
     taggtgatct ttcttcttcc cccttcttct atactttgca agcttcaaag ccattgttcc    103920
     gtagaatctc gtaagcctct ctgcagtatc ctttcccacc cctagtttcc tttggatcga    103980
     gacatatgtg tcttcggaat acccatcact cccaagtatc tgaacatatt tcgtcacaca    104040
     agggcccttt ggcttcaatg aaaactctcg gattgccaag tctatggcat cttctgctat    104100
     ttttctatat atcgtccact tccctcctgt gaccgttaga agtccattct tctcaatctt    104160
     gacaaaatgc ttcctaacaa tagaacttgt ttccgaaacc tcgtcatctt tgaccagcgg    104220
     tcttattcct gtccagatag cagagacctc gtccttgacc agctttaggc cctgcgaagt    104280
     gtatgcccta acctcatgca tcagaaactt taaatcctcc tttgttggag atggcgacaa    104340
     ctcattcttt gccttgatgt ccgtggcccc cacaagagtc ttccccatcc atggcatgaa    104400
     aaaggctatt ctgttgtctc ctgtaagagg gtccagaaac cccatttcct tgggtgcata    104460
     ttcctttgga ataacaatat gtgttcccga actctgggat ataatctctc ccgtgcttga    104520
     atcgctcttc ttccttagat catctgcaaa gctgcctgtg ctattgataa ccccaagtcc    104580
     cttaatctcc atttccgagc ctgtaatccc gtctttgcat cgaactcccg taatctttcc    104640
     acccgagctt atcaaggatt tcacagacag gtagttcgtt gccactgctc catgataaac    104700
     tgcagtcatc actagcatca cattgtttcg aacatcgtct tgctgcccat caaaataaac    104760
     cattgctcca caaagattct tcttgttgac atgaggaaat acatctatag cctccttcct    104820
     tccaataaaa tagcttcctc ccaatgattt cagccctgag atccagtcat agagcttcag    104880
     cccaatgtaa tagtaaggaa taagtatcct gctgtatacc ggaaccatta tcttgatgct    104940
     atttgtaaga tatggcgata ttctaaacat ggtacttctt tcttccaacg cttgccaaac    105000
     aagcttgtac tgagaccaat ctaagttact aactgcactt gcaagatacc ttactccacc    105060
     atggacaagc ttggtcgatt tcgaactagt tcctgacccg aagtcccctg catctaccag    105120
     agctactttc agccccctcg ttgctccgtc aagggcacat cccgccccac tgctccctgc    105180
     accaactatg atcagatcaa acacctccga ccgaagtctc tccatcatgg cctctcttgt    105240
     aggcacctcc cagttcttgc agggcttcct gatgcatttc agcctaccca ttacaaatat    105300
     cttcttgtag agatatctga aggccataag taccgaaaga aacaaaacca ccagtgcagc    105360
     cagcatctat gggcacgaac tccttcttct ctcttatact tccggacatc caattactgg    105420
     ttgacaggta cagagacaaa caagtatttc aagcctccta tgaagaggcc aataaaaccg    105480
     ggttcgattg gtcttctatc cctctactgc aaataaaaaa attcctagag gcctttgcag    105540
     atggaaggaa tcaggtttgc tgatgtgcta caatcctttg aaaagaaaac agaagatggc    105600
     gaatatgtga gtgtggaaag agattacaac gaaagaaagg tgatagaaaa cgatgtcaag    105660
     cgcacagagc tgctgggtgt ggacaagagg aatcaggagg caattaagat tctgaagagg    105720
     ctgctttttg tggagctaga caagattcca gttaagtaca cacaggggat gagtgaggtt    105780
     gcgtctgtgt ttgtcctcta ctactttcag gaaattgttg aggaagaagt ggccaaggga    105840
     atgtttatcg ccgagcggga agagaagcct gagggagaag cttcgacggc ggaaggcttt    105900
     tcggagcatt ttattgagct acctgaagag gaaaccacag agcttaagaa atttctttca    105960
     aggcacaagg acataatagc caagcttggg gtggtgctta caaacgtgtt caaaagaaag    106020
     ctggagccat tagttgcaaa cgacttcaag ctgtacaagg agaatatgaa gatatttgtg    106080
     gagatgatga agaagcgggg agtgaagatt ccagagctgg aaagctacaa gttcatggga    106140
     tctattctga cgtttttctt aagaaacctg acgaagatgg aggatgtcca caaggtgttt    106200
     gaaataatct tgtcatgtcc caacacctgc ccgtttcttt tgttagtact tttttatggc    106260
     cagatctcga gtggcaaggc tatagagagt ataaataaca agctgttccc gaaggtggtt    106320
     aagcttgagg aagagtttat tgagactcgg aaaagaatcg aaagcaagga ggtttgccct    106380
     tcaaaaagga aaatcatgct gataggcgga gttattagta taatcaccgc ggttgttgtg    106440
     tataagataa caagaaagga ataaagcctt tttctcaagt gctgtttgtc ttataaacaa    106500
     aagaattttg tatgtatcaa gccatggcgg gtagacaaaa atcaaatcaa gttgacacca    106560
     ttatttaatc ccaagagtct tgtcaatctc ctctgcaaag tacttctcca caagcgccct    106620
     tttcttcttc gctgtcggcg taagcagatc cgcgccctca aaactctcaa acccacgccg    106680
     cagcacaaca accttcgacg gaatctcaag cctcgtgatc ctcctctgct tcaccagctt    106740
     ctctccaacc tcccgcaggt gctccataat ctccttctca ctcctcttct cgtcaggaca    106800
     cacaacaatc gcaattatcc tctcgctctc agacctccgt ggaataaaca catcctgtat    106860
     aatgtctccg tcaatgtaca gcgtctcaag cttctcaggg tcaatgtact ccccctgtgc    106920
     agtcttgaat ccatccttca gatgcccaat cccagaaatc accttactta tagatatagc    106980
     caaaatatca tccgcatagc tgctcttcca ttcaagtata acctcctgtc cagacagctt    107040
     gacatggatg tttccaatca taagcccaga ctccacctca acaagctcct caaacccatc    107100
     cataagcact tgcttcaaca atacccctgt cgagttgtat gggatccttt gcctctcgta    107160
     tatgctcatc tccttgtatt tagattccat caaatcgtct ctcttgtata tcctaatgtc    107220
     gttctctgtc cctacgataa tcccctcaaa ttccccctca gcattggtaa atattttagc    107280
     ctcattatcc ttgactagat caaatcctgc ctcttctcca ttccgtagag tataaagctc    107340
     catctcaatc cctttctttt cgtttctctg ctgaatcaca ttcctgagtc tctgcatctc    107400
     attcatctct ccatgcacaa agaagaggtg ccgaggttgg cattcttcaa tgaactggct    107460
     attttgtgta aaatccacat gcgcactgaa tgagatgtat tccaccgaca tgttaagccg    107520
     aagcctcttt ccattcaacg cctctatctc cttgggctcg ctgagtatct cctttgcaag    107580
     tgttccgtct acacagtatc caggtattat cacggcattc ttactgtccg aacaccatcg    107640
     ctcaaagaga tctcttgaaa gcccgctctg cagcattccc gggctggcca tgatcacaca    107700
     tggaccctca tcatcaaaag agtctattcc cttcagattc ttgacatatt tgaatgcaaa    107760
     cgggtttcgg accaagctta gtttttgaat cctctcgttc atcattccta tgtaggtctg    107820
     atataccccc atacaccttt ttgccaatgc agatgcatag tagattggga tcttctgcag    107880
     agaagcattt gagctccaat gttcctcaag aataagaaga agctcctgtg cccttccaag    107940
     agcaaacacc ggaagtagac atctcccccc tctttgaaca acattctgaa caatgcttgt    108000
     aaatcggccc tccctctctg atctcggaag atggcattgc actccatatg tcgattccgt    108060
     tataagtgca tcgattttgc atccaggaga ctctgcagcc ttaagatgtc tgtcttcttc    108120
     cctactgaaa tccccggtat aaagaatctt gctcttctct atttcaacca aaaacatggc    108180
     tgcccctagt acatgccctg cattcaatgc cttaacctta atccccttca cattgacttc    108240
     ttgatggtaa tcgataggta tgattctgtc gtagcattta accaggtctg tttcggtgta    108300
     gaagtctgca tccgatgctg cattgatcag ccggatataa tcgttcagaa gccatttaag    108360
     aatggccttt gtaggatgtg tcatataaac ctttcctttg aagcttgtct tttccgttag    108420
     aaacggcagt gccgctgcat ggtctaggtg gaagtgtgta acaaatatgg catcgatctt    108480
     cgaaagatct acaagatcca gaaaaggaag ggatgccacg ccggtgtatg ccggatgaac    108540
     cccgcagtcc agcattatag tcctgccccc acactcgaca ataacgcatg atcttccaac    108600
     ttcgtttcct gccccaagag gcatcacttt tatcttctcg ctagagaaca ttctagggcg    108660
     atcagagcaa gttgaatttc ttgcaactgg tttctttcag aataaaagat aaatgtagaa    108720
     gtctattcat attaatgaat agtattacta taagcagtaa attggaaact atataataat    108780
     aaatgttata caattaggat gggaacaatc aggtttatat ctataatctc ttttcttagt    108840
     gatatgatga tttggtgcat tgatggacct ggtaaagaag ccaaggataa tcttaaggct    108900
     cctctattga caagtgataa taagcccaat gattttaagg catcacctat tccatgtagt    108960
     gaaagtaccg ttagaatgtc tcgtttcaag gatatgatga acagaataag gattatggaa    109020
     gatggatctg tgcaacacgt caacttccag agagatgttg tgtgtacccc agacggctca    109080
     aaaaccatcc tcgagctcct tctctcgcgc tgtgcaacaa tgggcaacga gcccttcctc    109140
     ggcacaatcg tcggcaacaa ggtcaagtac aagactgcaa acgacatccg cagagaggca    109200
     gagggccttg cctcgttcct ggcacagacc acaagccccg gagacatggt gggcatctac    109260
     tctgtcaaca gatacgagtg gatagttgcc gagatggcaa cttacatgtg cggatgcacc    109320
     aatgtccccc tgtactccat gttctcgccc gagaacgtcc agatgattct gaaggagacg    109380
     gggatgaagg tgtgtgttgc gtctcgggaa aaggccgagc agctggttga gactgtgctg    109440
     gagggcaggg agacgatgct cgagcacatt gtgctgatgg acaaggcgcc cgagctggtg    109500
     gcgaggcttg agaatgccgg gctgcgggga cattacctca aggaagtgat ttctcatcgg    109560
     ggagggataa ccaaggaaag gtactcgaag ggggaggatc ttgcaacgat atgctataca    109620
     agcgggacat ctgggtgtcc caagggggtg atgctgacac accggaactt tatctctggg    109680
     gtttctggga tattccgtgg gtctcggaag gaagagatgg tgtctcttga caaggaggat    109740
     gtgtatctgt cgtacctgcc gctagcacat gtgatggaga ggatatgtgt caacatctcg    109800
     atggcatatg ggtgcaagat agtgttctac agggggaaca tgaaggagat caaggaggac    109860
     tatcttgtgg cgaagccgac atttattatt tctgtgccgc gggtgctgaa tctgttcaag    109920
     gacaagattg aggagaaggt gaggcagaag aactttgtgc tgcgatggat tttccggggg    109980
     gccctccggt acaagatgtg gagagtgggg cgaggagagc tgaagagcaa gtttgcagac    110040
     tggcttgtgt tcaacaggat tgcaaaggag tttggagggc ggatttcgcg gattctgtgt    110100
     gggtctgcac ctcttcggaa ggaagttctg gtgtacatgc aggctgtgct ctcgtgccgg    110160
     attatccaag gatatgggca gacggagaat gtagggtcgg ggattgtgca gccgctggac    110220
     acgaacctgt acgacaatgt tgggattccc tttccgtcga acgaggtgaa gcttggagag    110280
     ataccagcgg agcttgggag cgagtatggg cgccggtatc ctggaaggaa gtttggagag    110340
     attctgttgc gcggggacaa tgtgacgcag gggtacttca agaggcctga ggagacggcg    110400
     gagctgttta ctaaggacgg gtggctccgg acgggggaca ttgggatgtt tgatgtgtcg    110460
     acggggatgt tttctgtgat tgggcgtctg aaggatggat tcaagactgc acagggggag    110520
     tacattgacc ctgagaagct tgagacgctg tacattgacg gagacattat acaggatgtg    110580
     tttattccac ggaggtctga gagcgagagg ataattgcga ttgttgtgtg tcctgacgag    110640
     aagaagagtg agaaggagat tatggagcac ctgcgggagg ttggagagaa gctggtgaag    110700
     cagaggagga tcacgaggct tgagattccg tcgaaggtta ttgtgctgcg gcgtgggttt    110760
     gagagttttg agggcgcgga tctgcttacg ccgacagcga agaagaaaag ggcgcttgtg    110820
     gagaagtact ttgcagagga gattgacaag actcttggga ttaaataatg gtgtcaactt    110880
     gatttgattt ttgtctaccc gccatggctc tgataatttt tgtctacctt aaaaccctga    110940
     aatggaaaat tcgttgaata gcaaaagagt caaatcggag aagcttaaaa tagatatggt    111000
     ccgaggccaa atagaagaat acaccaatct tctcaagctc caacatgtaa atgtcgatga    111060
     gctgatggaa aagatagcgt ctggatggtg cgaagacatg accagaaagg aaattgtaga    111120
     ttactgtagt gaaaccgcag cctcgatgat caccaaacat cctgagtatg gatggatctc    111180
     gtcccgaatc attgtctcat atatccacga tatcaccatg gattcttttg ttgaaaagat    111240
     caaatacata caaaagtacc agggaacgat ttctgaagag atgtacaaga taatagtgga    111300
     gaatgcagaa ataattgatt cgattataga ctacgaaaaa gatttccttt tcaactactt    111360
     tggaatactt accttgatga aatcttatct gataaaggtg ggggaggaga ttgttgaaag    111420
     accccaggat gtatttatga ggacagccct tcaagtccat aagtctgact ttgggaaggt    111480
     caaggagaca tatgaaatgc tgtcaagaca ctactttacc catgcaacac cgaccttgta    111540
     caattcatgt ctcaaggaag cacaattggc cagctgtttt ctcataacac ctcgggaaga    111600
     ttcgattgag ggggtatacc acatgatcaa ccaaacggca attataacta agtactctgg    111660
     gggcatagga ctcaatcttc atgggattag gtcgaaggga agccctctga aaagaactgg    111720
     gggaaagagt aatggaatca ttccgctgat ccaggttttg aatgccacaa agagatacat    111780
     caatcagggt gccgaaagaa gacccgggtc gatagccatt tatcttgagc cttggcatat    111840
     ggagatattt gactttctgg accttaggaa gaacacaggc cctgaggaat tccgggcaag    111900
     ggacatcttc attgcactat ggatcaacga tctatttatg gaaagggtca agaacaatga    111960
     ggaatggtcg ttgttttgcc ctagccaggc tgttgggctg aatgagacat ggggagagga    112020
     gttcaatgcc ttgtactgca agtacgagaa gacaatcagc aggacggtgg ttcctgcgca    112080
     aaagttgtgg aaggccataa tcgaggcgca gatcgaaacc ggaacacctt acatgtgtta    112140
     taaggatgca tgcaacagac ttagcaatca gcagcatctt ggaactatta aatcatcgaa    112200
     cctttgtgca gagatagttg aatattcctc tggagaagag acctcggtgt gtaatcttgg    112260
     atctatttct cttcctatgt ttgtcaagaa caagaagttt gactttgaat ctcttaaaga    112320
     cgtggtccgg atacttacaa tcaacctcaa caaggtgatc gacttcaact actatcctgt    112380
     ggaagagtcc aagagatcga atatgaagca ccggccgatc ggaataggag tgcagggtct    112440
     agcagatttg tttgcaattc taaggcttcc gtttgatagc gatgaggccc gtaatctgaa    112500
     caaagacatc tttgagacga tgtactattc ggcactggag acctcgtgca agttggccga    112560
     gaaagagggg ccgtttgagt catatgaagg atctcccata agtaaaggga tctttcactt    112620
     tgagctggca ggcaagaagg cttccaacaa ctgggactgg gaagggcttc gggaaagaat    112680
     taagaagtat ggaacccgga atagccttct gattgcgcta atgccgactg caggaacgtc    112740
     gcagatcttt ggaaacaacg agacatttga gccgttcata tcgaacatat ataccaggag    112800
     aacacatgct ggggaatttc agattgttaa taaacatctg attaacgatc tttccgagct    112860
     ggggctgtgg tcatatgaga tgaagaacct gattattgaa aacgaaggat ctatccagaa    112920
     catcacaacg attccaaaaa agatcagaga catatacaag acagcatggg aaataaagat    112980
     gaaggctgtg atagacctgg cggcggatag acaggtgttt gttgaccaat cgcagtcttt    113040
     gaacgtcttt gtggcaaagc cgacctactc acagctcaca tcgatgcact tctacggata    113100
     tcattgcggt ctgaagacgg gaatgtacta tttgagaaca aggccgataa catctgcaat    113160
     caagtttaca gtggacaaga agcttgcaga gaaaacctta tcctccatga atgatacgga    113220
     cgagccctgt tcgatgtgct cctcttgatt aaacttcgtt gctttctttt cagccttgtt    113280
     tttctgtttg aacgccgtac ctccagcaga tgtattgagg agctttaaaa cccatagatg    113340
     aactttttca aggaaggaga gagactgaag gcaatcttcg acgacctggt gaagcagcac    113400
     aaaaagagta agaggaaggt tgttgataac aagaacgtga gcaaggagat gctacagaca    113460
     tatgaagaga acaggatgaa gctgatgcat tttttcgaga tgcactcgag atttattagg    113520
     ccaaggaaga acagtattgg aatcttttct gtggatgact ttgtcaaagt caaaacctcg    113580
     gaatcgatga tgtttcccaa aaaggaagat tttaggaggg aagggagacc aggaatgcca    113640
     ttttctgttg gaaggcctat gcagtgggga ggaatgaatg ggagagagcc tttttacatt    113700
     caggatagga ttcccacaca aggatggaag gggtgtggtc gggatggaaa gccgatgtgg    113760
     atggggtttg gagggtaccc gggggctcct gggcaggaaa gcatattacg aggctggggt    113820
     cctatgaact tcctgcatca gaatagcaga gggttttttg gggccgggtc atatgaaatg    113880
     gaaggtggga gttttgaagg agaacatggt agctatggat atggaattcg gatggcaccg    113940
     gggccaggag ttagaagacg gtttgatatt ggaggagggg gcccaagtga tgggtacggt    114000
     atgtttccta agagaagacc acctgacatg gactccaaga cagcagaagt atctaaaatg    114060
     ggttttccac atgagagaga ggaaatagga aggaatggag ttccaccatc gatgagttgg    114120
     acgggtagta ggaggccata catccctacg gaaaggagag aggaaatgat aaggcctccc    114180
     ttctactatc cgattttagg gggatacggc tatcctgtcc atggaaatgg tacgtttcct    114240
     ggtgttccag tggaagagac ctttgcaaca gcatgctcga tatatccaga aacatccagg    114300
     aaagaacaac actttgtaaa atacccacaa agctttccag gtagtgatgt gatagactgg    114360
     atgccggaga agaaaagttc taagacgaag acaccaaagg aaacgaaagt gccaacctct    114420
     ccaaaagaaa acgaaagctc tatttcaggg aaagaggatc cctggaggct agacataaca    114480
     acagacttag agaaaagaaa gttgtgtgat gaagatcagg gcagagacga gaataaggaa    114540
     aaggcttctt tcgcagactt cccagatggc aagaacaact cccatgggga actttccaca    114600
     aaccacggga aggatctgaa tataatgacc atagaggatc taattggaga caagacgatt    114660
     gacaaggatg caaaagagtt catctatgaa ctttgcgatg gatttgtcga tcatattatc    114720
     catatgtcat gtgcattggc ttaccacagg aaaaaaaata ctgtggaggt ctgtgatgtc    114780
     aaattagcat tgaaaacaga ggttgggatc gagctcccct cggatgggga ttcggaagag    114840
     gagtcttcct taagtcccgg aagagaagtg aaggttgtaa gaaatgaaga gaaacagccc    114900
     cggatggcca aaaaagacta ggagagacga agtctttctt ttgggagaag gtatgttttg    114960
     tttctaaaaa gttttaaccc tctatttctg gagatggcaa caactaaagg caaaaatagc    115020
     aggctggcaa ttgagatgga gtctatgtcg agagacccac caccaggatg cagcgcaagc    115080
     ccaataagcc ccaacgaact agacaagtgg attgcagtta taacagggcc cccaggatcg    115140
     gtctatgagg atgggatatt tgaacttctg attgtctttc ctccatttta tccattcagc    115200
     ccgccaaagg tgacgttcaa gacacggata ttccattgca acatatttga aaagaatatc    115260
     tgcctagata tcttaaagga ccagtggagc ccagcactaa cgatagataa gatcctcttg    115320
     tccatagttt ccctgctcca ggatcccaat cccgacgatc ctctgaacaa ggaggcagcc    115380
     gatctgtacc gaaacaatag gatggagtac aataggaaag caaaggaatg ggtgcggctt    115440
     catgcctcga aacataagtc tgaggaataa gaagtttctt gatggaacag atgattctgt    115500
     tatattaaat tgttctgttt atttctgtac aaccaggatg ccaaaacaag gagcaaagga    115560
     aaattctgta tgaaaacaga gtccctatga tttttggaga agcaggcaca tggctcctcg    115620
     aggacctcaa gtcaagtgtc cttaaaccct atagacatgc agagataaag gcaatacaag    115680
     gagaaaatgg agatctggac aagaagatgg aggagattag aagggcagca gggtctggga    115740
     tatctgagga gctctcagtg aactacgtca tgatgaagca tttcaaagag cgtaacgaaa    115800
     gaatagtcag gagttacaag ttccatcgaa tcctgggtct tttcgactgc ttttttggca    115860
     gaaaggaaac ttctggaata ctttctcctg aagaggagga atgtgcagag gaatactacg    115920
     caactctcaa ggagtatctt gagccttttg ctgacatgga ctttaccacg gaaacaccgc    115980
     ccacacagtt ttttgtgcag gtgatcacgc tggaggactg tggagtggtg atggatgagg    116040
     gagacctcat agaactcaag aaggacagaa tatactttat caagaagagt tctattgctc    116100
     atctgatcag cgatggactt gtacgaatca tttaataaaa tcacctatgg gatgtctaca    116160
     gaagattccg ggcctatctt tttactgata atgcacattg cttcctctga agtcaatcct    116220
     ccttcctctt ctccaatggt atggtaatta tctccaaaga ggccctcaac ctcctcttca    116280
     acaactccga agatctcgca ttcaatattc tccttgatct tgtcttcgtc gtatcctctc    116340
     tccttaagtc tcttgtaaag aacttcaaca ggagccttca tcagaaagac taaatcaaag    116400
     gctatattgg ctgccatccc acaactgtgg gtgtctatga tgtatgactc cttgccaagg    116460
     agatatcctt ctagagattt tctcaccact tcatcatcga agagaagcga tttgtatgtc    116520
     tcgctgtact cctcatatag gttgttttcc tcgatgtacc ggctcatctc gacatgggga    116580
     atcccaaatc ttttcgatat gtccaacgaa aaagttgtct ttcctactcc aggcgtccca    116640
     gtaactagaa tcttcattgg gaggagtgtg gagacattca aataaattca gcctttaatc    116700
     ctcgattcta caaagtcctt gaaccagatg gactcctcaa atccctcgca gaatctcttt    116760
     actatctctc cagctccctt cttgtcaagc atgttcagga gataaaaaga tctatacacc    116820
     tcaaatgcgc tgtctcctga cggaaggcaa aatctgtttt ttccgaagct cttgaaatcc    116880
     tcgagaaact tcttatggac tggagaacct cggatcctgt cgttgagtat cacacagagg    116940
     agcttcatca caaggccgtg gtttggaggc tgcacctcag aacactttga aagaacttca    117000
     aacgaggtct cgaagtctcc actgcggaac gaagacaatc caaactcccc tagaacttct    117060
     tgctcaatct tcccctctcc tattgtgtcc ttgatcgact catagtactt ccttgactcc    117120
     ccatatcctt gggttcgatc aatgtagaga agcctgaaca acctgtcctc tgtttttgcc    117180
     ggccttccca gcttgaaaaa ctcaaactgt agaactcttc tttcgacaag cttcgggtct    117240
     atttccaaaa gccttttaag aaggccattg taagtactta tcttcggaga gtcaagaatc    117300
     tcatacagag tctcaagata gaagtctatg ttttccagaa gcgtgttttt ttctctatcc    117360
     ccaaagcaat caagcaactc gttgatcgtc ttcatgatct ccaccccatc cttggacttc    117420
     atgtggatag acaggagagt ccttaaggct ttggccttca tttctttatc ctttgcacta    117480
     tccttgaact cttctaactc ttttcttctc tcctctgtgt ctttgatgac cagtatcttg    117540
     cttagatccc tggacagcct ctcctcgtct ctccgatcct cttgttgccc attctcatct    117600
     tctttgggct cgtgatgggc cagcagctcg tcaattgtct tcttgtgggt cttagtgtat    117660
     actctcggcg actccaagaa cttcttcaaa aacggaggaa ggcccctgct caaatacccc    117720
     tccatctttc ggatgtcgac aagtatcttc tttagttgct tgtcaaaaat cttctggttt    117780
     tcttcctcct ccagctccat cactctgcac tggagatcat ggagtctctt ctccttcttc    117840
     ccctgcttct cagatgcctc ataagtcttt tcttttatct ttactcggct actttcctct    117900
     ctctcctcgt caatcgactc aaaaaatcta gacatcaggg gatgaatggg cttcttcaaa    117960
     ttctctccag aacactgtat ttattacaca tctttcaagc atcatagata tcgccagtcc    118020
     gagtccacaa tcccctcctt catccagaac tccagcgacc tactgttctt ggtcagaagg    118080
     tcgttcagtt gagtaaacga taccaccaga tctcttccat ttatctgtac atcggcatga    118140
     gaaagcggat ggaacagctc tgcacacacc tccgagctta aacgcatctt gtccttgagt    118200
     tgggggaaaa actccatggc atcctcacac ttttcttcat cttcgcacca ataagaagat    118260
     gtaatgattc tccctccctc aggaatgcat cccgaaaatt cttcgaagag ctccagatct    118320
     ttctcaatga tgtcaaagca ctgtaggttc ttatggagtc tatccctaag cgccttgagg    118380
     atcttcttct tgggagcttg ttgaaggacc agagatctca caaagtattc tttatacctt    118440
     tctagaagat caggcatcag ctcgagaaaa aagcttagga catcagatgt cttcagcccc    118500
     ggataccatg agaagagctc gtcctctatc acttccatac tttctacctg gtccaagata    118560
     cactcaaaga ggtcgtctct tttggtcagc tcctccttga ttctttcaag cttctttatt    118620
     atctttttgt tgatattccg aaatgattcg gaaactgcaa acagtatatt tctggtgctc    118680
     atgtttctta tcttcaagct aagcatccca ggccttgcgc tcttcttcgt ggcttctgtg    118740
     ctattcattg caacaagatt tggaatgtag ctgatccttt tacttttcaa gctttcgttg    118800
     catgcatctt ccatcgattc cctgtcaaat ttcttcatcc tccttacaat ttcccgatct    118860
     ctttcaatct cctccatccc aaacaaagaa tttataggat agatcaaact cgttattttt    118920
     acttgtttta gatgcagaga cagttatcaa aaggctacaa gacatggaaa gaaagagccc    118980
     gtagtaacaa ctatcaaaag aagacaattt aataagtaat tatccacttc cccccaactc    119040
     ttgtgatctc ttcttttgct gatggcgtga aatacctggc tttgacaaca atcggccttt    119100
     ccaaaggcag ctttcctcca ataacaatgt gatatccaaa ctccctgaca tcgatcacag    119160
     gaaccttctc aacgttatcc aggaactcgt atctttgctc ctttgggatc atcccccaca    119220
     gccttgcaga gctgattggg cgggcatagt tcgagttctc cttcctgtgg taaaccctca    119280
     ttcctctctt tccatggtag tccggatgga atcttgtgaa aagagtcttc atgtggctga    119340
     atcctcctgc cagccctcgg cctccagagt gttttctatg ctttcctaca cgtccatgtc    119400
     cgtgcgatac atgccctcgc atctttctag tcttcttaac cttttctgcc ttcaaattag    119460
     ctcagatagc cacttaccat ttcagggata aaatttttac ctcgacaaat acaagcaatc    119520
     caattttctt caatggccat ccattttcca ctcaagccgt tgtacaggcg cctgatgcag    119580
     gaatgtgaaa ctgtcgtttg agcaaggttc aaaagaagtg caagcacact ctgaaatgca    119640
     ctccacacac aagaagatca aggtcagcat aaggctaagg ccctctacag ggaacagaga    119700
     gatatggaag acctctgaag acggtttgtg gcatatccgt ggggagagga gagtgaaata    119760
     cagcgggttc caaagcatcc tgtcgaacat gacaaacgaa gaggtttaca agctgtgtgt    119820
     gcaggaggag gtttggaagt ttttgaacga agagaactgc acggtgtttg catatggaca    119880
     gacaggctct ggaaagacat acacaatgct gggaggagat gaggagggga ttataaagct    119940
     ggcaataaga gatgttttga agaagaggtc tgtggggata tcgtatctag aaatttacaa    120000
     cgagaagctc tttgatcttt cgaacaacaa cgaggttcag atgttcagtg ttggaaacaa    120060
     gaatgtgatc tcgaacttgt gggtcgagca tgtggataag tgggaagatg ttgtgccttt    120120
     tattgagaag tgtgagaaga acaggaggtt tggaactacg gagttcaaca caaagagtag    120180
     taggtcacat actgtggttc aagtgacata cagcagcaac aaccgagtcc ggactttgaa    120240
     tatgatagac cttgcaggga gcgaaagagc aagccgatcg aatgacagga ggaaggaagg    120300
     gtcctttatt aacaggagcc ttcttgcact ctgcacggtt gtcaacaaca taggaaatgg    120360
     gaagtatctg gggtttcgga actcgaaact gacaagggtg cttcagccgt cattggacgg    120420
     acttacgaat ctgattgcaa tctgcacgtt gtcaccttat gaagattgtg ttgaagagtc    120480
     tgtaagtaca ttgaagtttg cggcaaggct gtgcaatctc gagctgaaga cggaagagat    120540
     gcagatatca agcgatgggg atggaagatg tggaggagat ggattggaag gaagttccag    120600
     atgcgaggtg aaacacagat gctgcagaaa gtttcatcct gaagttagta aagaaacaag    120660
     cgatgttctg gagaagacag agtccatgac ctttgagaag tactttgaag gatacggctt    120720
     ttcggaagct cctgggctgg aagagcatag agagcatgac aaggtgtgta gtgagaagga    120780
     ttctgtagca gggatactcc ggacctttgg aagggtgatt atggagaatc tggagtggaa    120840
     ggtaaagctt atggaggagc tgaacataat taacaacgat agaatacatt tgctagagag    120900
     aatggtagga gagttacttg gtaagaaccc atcaagaaga atgaatgaga tcttcatact    120960
     cgagaagtac aggttcaacc ttcgtaggaa gatggttgga agaaaatgat tatgcactgt    121020
     tgattttacc catagaagga atgggaccga agatcaaaac acttgtattt ttgaaagtaa    121080
     tggttcttgt tatacttctg cactttcttc ctgtggtctt gaaggagata gggctaaaga    121140
     agagggtgga aatgatgaag agggacttca atagaaggct tctcgaggga agtgagagct    121200
     tggagaggct taggatgctg aagacgctaa taaacaatgc aagatactgc aaagacggag    121260
     atataccgct ggacggttcc atggccgaaa ccaagagggc ttatgaaggg ctaagggtat    121320
     ggagcgaccc tgttttcctg aggctttcga atatatacaa tatttctatt ttttttcctg    121380
     tgtttgcgcc tgtggtgata cagagcataa agattctgag gtatagagac tcttggggga    121440
     gccgggggga gaaggttgaa ccataataaa tgtaatatgt tttagatgtg tttagggctt    121500
     tctgaactgt gtctgcagaa agaacaaaat ggcaactacg atgcccaggg gatgaatgag    121560
     gagagtggaa aggaatgttc gaagcagcag aagaggctgg cagaggctct cagaagaaga    121620
     gatggcctga aggaggagat ggaaaaagtc agacaggatc ttcaaaagct ggagatccac    121680
     cggagagtac tattggacat ggtaaggatt ggaaatggag gaatggaaat agacgttaac    121740
     agatacagac cgatctataa agcagaagtc gagggagcaa aaggcctgat acatgttccg    121800
     ggagagcgat accatctagc aatatataac ctcgggagga ttccgatggc gagtatgaag    121860
     cccttttata accagaagaa catctatcca attgattaca tgtgtaagag agcctactac    121920
     aaaagtagag ggagccctgg aggagacggg tatgccctgt atacatgtac aataaggaat    121980
     gtttgtagca agcctctgtt tgagatatct gagagggacc tatgcataag agggaaggct    122040
     ggggaggtct tcaatgcatt taaaagtttg ttttcctggg agattgagtt tggaagcata    122100
     acggagtttt ttgggctgaa caatctgtat gttcggagac tgatcagcga gcaagaagga    122160
     tttagagggc ttggaattgg agatagatgg gaaaggaagg cctgagagtg ttagcctgtt    122220
     tatattaaag gttgtgacaa tttttgcaga gtattgtttg tgaagactaa ccccaaggga    122280
     tgattctaga tgagattgtg aaggaagcgg cagcgctgca gctgaggaag gaagacgaga    122340
     atacatggtc tcgggtgaac gatgtactca tgaggctttc cggggcagtt gtggggccgg    122400
     aagatgtgcg aagagtgtta gagagtgttt ccgacctgat tgtaaggtcg atgcagagtg    122460
     acagatcgag gcttgcagga acagcccttg gatttctcaa gaactgcatt tgcatcttgg    122520
     gaaatgagtt tgggatggca gggcaatatc tagtgcctct agcgaaagta tgtggaaaga    122580
     gcagtaaggt gttttattca aggggagagg aagtgcttgt agaactttgt aagagagtga    122640
     atattaaggg acatgcaagg ttttttagcg aatactgtgg aagtgccaat aagaatgtta    122700
     ggcttgctat tttccggggg attgaagcat gggggagtga gtctggaaag atagaaggat    122760
     tggagaatct tgttataaag ggaagagaag atgcattttc ggaagttcga gaggtgtgca    122820
     aaagaatgat ggagaagttc agtattgggg agagaaagga aggatgcttt agaagacagc    122880
     gtttggaaga gagtcttgag agtggggtaa agaaagggcc tgttagaatg gccaggatgc    122940
     cggtgcgagg gggatatgga ggaatggaag gaatcggggc aagagagatg gaaaagaaag    123000
     agcttgcacc caagttttct ccggctagaa agcaaacaaa aacaggagat aaagactatg    123060
     acaagataag ggagctttca agacaggtca aggacatagc cgaagacata aggccgaatg    123120
     tgggggctga gaagagctca agcggtagaa taagaaccaa gataaaagag atgttctcca    123180
     gaggaagtga taaggcaggg actgtgtatc cagaaagtaa ggttgagata ccaaaggagg    123240
     tgatgaacca tgaggatcta actccagtga ggttggacaa gtatctcagt agatatcgtg    123300
     aagagtatgg aaggcttatt cccaagaata taactggagt tagcaatgga tttgaagttg    123360
     aggataccga gctaggggaa gaatttctag aagccaaaga agtctctgat gaagacaagg    123420
     cgaggattgg agaaacaaag gaagaagata agcttaatgg gtcttgcgaa gagaagaagg    123480
     aaaggattgt tgttgggaat gaaagctttg atgaggagat gggacatgat ttagagggag    123540
     gagatgaagt gtgtgcagag cttgagatcg gagaactttc gaagagctta gcgaacatct    123600
     cgatcaatga aggagatgtg gaggataaac cacattccga tggagatggg atgttgtcgg    123660
     aggcttctgg aaatccctac gagaatcttg ttgaaggaca agagatggaa agctctctta    123720
     aagagtacac cataatggat tctgggaagc tagaagaaca caaggaaaat aacagggatg    123780
     aatcccggct ttgtagagga tctggggcct cgatcggaga gtcaacaatt tcgattgact    123840
     cggaggttga gaaccaaaga aaggagagaa agaagggatg taggaatgct cttgagatga    123900
     tgaagggaaa tcgatttgca gggtttcttg agttgagtga aagcagcgag gaagagactg    123960
     tattttctag aaggcagggg gaaaggaagg aaggagtgga gaagcaagat gcagacaaca    124020
     caggcgactt tacggcgatg gactcccttg tggaggttag aagaggggtt tttagaaaga    124080
     agtaagagcc taagggcgaa gaaataaagt ctttaagtta gccaggtttt tgtgttttat    124140
     gtgtgggacg tagaaaaaga agacatactt tgaaggtttg tttaaattgt cctgaggaag    124200
     aactagtggt tagatggcaa gtcgaccgct ctgggcagta agcgcgggtc tagagatctc    124260
     cttgtgggta gttggggagt ctgtagggac tctgcaccta ccattaaagc ggaggggaac    124320
     gcatgagggc ggaaacgcag caatgagtac ctcctgcaag gcagagtctc cagccttccg    124380
     cgccagtcct ttttgtggag tatggctttt gcttttgaag aagggatggg gatattgcta    124440
     aaaaaaacaa agatccctac atgcttgaga acataaggat agagccgaag atgagctaca    124500
     ggaagatagt gggggtcaat gggcctcttg tgataatgga caacatcggg tttctaaagt    124560
     atgcagagat agtcagtctg acgcttcctg atggaagtgt taggcaggga caggttctgg    124620
     aggtgtgtgg aaagaaggct gtggtccagg tgtttgaggg gacgtctgga atagacatca    124680
     aggagacaca ggttacattt acaggagaaa cattgaagat ggggatttcg gaagacgtgc    124740
     tgggaaggat attcaacggg agcggaaagg tcattgacgg aggcccgaac atcattgccg    124800
     aagactactt cgacatccag ggacagccct tgaatccata ctccaggata tatcccgagg    124860
     agatgatcca gactggaata tcatcgattg atgtgatgaa ctcgattgcc aggggacaga    124920
     agattcctat attcagtgca tcggggcttc cccacaacga aatagctgca cagatatgca    124980
     ggcaggcagg gcttgtgaag agaaaggact cgatagatag tagtgacgac aactttgcaa    125040
     tagtttttgc agcaatgggg gtgaatgtag agactgcaaa tttcttccgg aacagcttcg    125100
     aagcatctgg atcgattggg aggacagcat tgttcctgaa tctggccaac gaccccacca    125160
     tcgaaaggat catcacgcca cgactggcgt tgacggcagc agaatatctt gcatatgaga    125220
     aagagaagca tgttcttgtg atcatgacag acatgagttc gtatgcagat gcgttgcgtg    125280
     aggttagtgc tgcaagggaa gaggttccag gaagaagagg atatccagga tacatgtata    125340
     cagaccttag cacgatatac gagagagcag ggaggctgga gggaagaaac ggatctatca    125400
     cccagatccc gattctaaca atgccaaatg acgacataac gcatccgatt ccagatctca    125460
     cgggatacat caccgaagga cagatttacg ttgacaggca gatgcacaac agacagatct    125520
     atccacccat aaatgtgctt ccatcattgt ctaggctgat gaaaagcgca attggggaag    125580
     ggatgacgag aaaggaccat ggagatgtgt cgaaccaact ttatgcaaag tatgcaatag    125640
     gcaaggatgc ccaggccatg aaagctgttg tgggtgagga ttctctttct ttggaggaca    125700
     agatctcgat agagtttttg gaaaggtttg agaaggagtt tataagccag agacataacg    125760
     agcttaggac agtgaaccag tccctggaca ttgcatggga tctccttcga acgtttccac    125820
     gagaaatgct taatagaatc ccatcggaca tattggatga gttccattct gtggcgccct    125880
     cgagatcgga gtagatccac gttcttgttt ccggggatgg ataactcgga agaggggaaa    125940
     aaggcgattt ccagcaaacc ccgatgaacg gaatgggcac agaccagaaa gtctttacat    126000
     atgtatgcat acagtgtccc tcgctgaggg agctgaaact gaaggatccc atcagatgca    126060
     cggaatgcgg caacagggtt ctccgcaaga agaggacaga caatgtggtg cagctggatg    126120
     ccgtctagtt tactcaataa atatgttctc tgtcagtacg actcttataa tagtctttat    126180
     aaaaaagtgt gttggaaacc ccaaatggaa gagggaagga aaagaaaggc aaaggaccaa    126240
     ttgtcgccat attccaatcc ggttgaggag agtgaccagc atagtggtgt tgtagagcct    126300
     cttccattga ttcacaagaa gagggccaag gcaagggttg gggattcatc aatgattgca    126360
     aactccgaat ctctgaaagg ggtgctgagt tctgtgaata tcctaaagcc gaggggagga    126420
     ggcaacgata gaataagcgg tctgaacaga tgctttgtca atgctgtgca gaaggtggtt    126480
     gagaaggaat ccaacaagag tcttttgtat ttatttaggc aatacgagaa gtattacagg    126540
     gagttgacgg aatcgaatga ttgaattcca agttgaataa atgacgatat tatttaagaa    126600
     gttgtaaaca gatagatttt tgatgagaaa tgtgtgtttg gtggtgatag acggatgggg    126660
     gcatttggaa tcaaggacgc aggggaatgc tgtgtcggag tcggagtgcc gttggatgag    126720
     ggctttaagc tggggacgtt gcagtcttct tctgcatgcc catggtagat atgtggggct    126780
     ccctgacggg ttaatgggga attccgaggt agggcatcta actataggga gcgggaggat    126840
     tatcgagcag gacatactaa ggatagatcg agccattgag gagggaaggc tgaagaaaat    126900
     agtggatgaa gtgctccagg gaggccgagg tagaatacat gtggtgggga tggttagcga    126960
     cggaggagtc cactcacaca taagacatct gaaggggatt ttggagtctc tgaaaggacg    127020
     taacgaagaa gtgtttatcc attgtataag tgatgggaga gatacagagc cacaggtgtt    127080
     tttaaagtat cttgaagaaa ttaagaattt ctgccgggat attggcacag gaaagattgc    127140
     ttctgtggcc gggaggtttt actcaatgga cagagcaaac aacgaggaaa gaacagagct    127200
     tagcttcaag acaatgacaa gtgggaagga gataggagaa gatgccgagg attatgtcct    127260
     tggaatgtac aaggaaggtc tgggagatga gacccttagg ccttttcttg ttgataaggc    127320
     cggaaggata agtagagaag ataccatcat cttcttcaac ttcagagcag acaggatgag    127380
     acaaattgct tctaggtttg ccaagaacgg aaacaacata gtgacaatga ccgagtacaa    127440
     gaaaaatctt aagtccaagg ttctcttcgg gaaggtctgt gcgaagaaca ccttggcaga    127500
     ggttttgtca gaccgcggaa taagacatac acacatagca gaaaaggaga aggaggcaca    127560
     tgtgacatac ttcttcaacg ggggtaggga gcagccattt ctctggcaaa agacgataat    127620
     acttcccagc ccagacgttg aatctttcga cacagtacca tcaatggcct cgaaggaagt    127680
     gacagagtat gtgattgcag agattagaga cggagtaccg atggtaattg ccaaccttgc    127740
     accccccgac atggtaggac atacaggaaa ccttgaggca acaaagatgg ctgttgaggc    127800
     agtggatgga tgcataggga caatatacag agcctgcata gagaacaaat atactctaat    127860
     cgtaactgca gaccatggaa atgccgaaag aatgacggat ggaagaggaa actgctgcaa    127920
     aacccataca acaagtaagg ttcctctaat agtctgtgga gaagaagtgg gagaattctc    127980
     ttcctcatgg ggatacacag acaccgacta ctcgttgaga gacatagccc cgactgtatt    128040
     agaaataatg ggaattccca aaccagatga aatgactggg aggtcggtgt tgggagcctt    128100
     cggccacacc cttccagcaa gagataatca gtaaaaacta gttttcgttg gaagaaatcc    128160
     tttaatcaga acattccaaa gtcgatttca acttcttcct cctcaggctc ttccttcttt    128220
     cctgcgtccc cagggacatc agctgaagcc ttggcctcca caggggctgc tgcctcctgg    128280
     gtactactca tcaacagagt cttaatctca agtgcgtcca tttcaaaaaa ctcactgatc    128340
     ttcggatggc tttccagtcc aaagaacttg aacacagagt caatcttctc tttggtcact    128400
     tgctggttag ttgcatatat aagcaatgct gctagcgggt acatatcgtt tatcatgttt    128460
     tcttgtgtca ttctacttta agcaatttaa cgatatcggg cccaaagttt ggtagccctt    128520
     ctgttgcttt tgcttttata cttttccctg aaaattttgc ttttcaaggc agccaggcat    128580
     tggaaggatc ctgtccacac ccataaatcc cttggatgga ctttgacagc cagatcttta    128640
     ggaagctgag cagaaggtac agcaccaagt cggacataag gatggtgcgc cggccaagga    128700
     tatcaaactt ctatctcaaa aaaggcgaca agtacgaata tgtggcctac agacttactt    128760
     cgatgaagcc atacttcctg gagcttctcg gcatagaaga cttttcgcct gtgaatagca    128820
     tttcaagcac ctctttttac acatatggca tcatcatgaa tccgtttgga cacaagttgg    128880
     actcccaaaa cacatttatt gcatcgaaca ttgatggaag caacgatgtg gttgtgaagt    128940
     tgaatctatc gcatctaagg agatattctg tgttccctgg gcagattgtt gccgttaagg    129000
     gaaagaatat tacgggaggc gagataacag tggaaactct tcattgcata cccgttgtgg    129060
     atatcaatga ggagaaggat ggcaaggaag aaaagcataa ccaaccgtct attgttgcat    129120
     tctcgggccc ctacggattt gcatctgagt ttgatgttct cgacaggatc cttatggaag    129180
     aagctgatgt gttgatactg gttgggccat ttataagttc ggcccacgga agtgaagacc    129240
     attctccagc ctcgatgatg gagaaagagt tcgttccaag gatcaggcga tggctgaatg    129300
     aaagaccagg aagtaaagtt gttcttgtgc cgtctgtcaa cgacataaca tgtctgggtg    129360
     tgtttcctca gggcccaata gacattgatg aggaaagaat tgtatgtaca agtaatccct    129420
     gcgagttctt tttaaacgag ttcctggtgt gtgtttcttc tctggacaca cctcttgaga    129480
     taagctcgga agagtgtttc catgactcag gcctggagtc ggaggatgat gcctgtggaa    129540
     atcttctttt tggaggagat aggctgaaaa ggatagcata tcatcttatc ttccaaagaa    129600
     cttttcttcc ggtctttccg tctcggaatg ttgtttcgta ttctgtgcca gagaatatgt    129660
     ccatggacac ggcgccagac atatacattg ttgtgtccag gctgaagcat ttctccagag    129720
     atgtaggccc ttctgtggtg gtcaatctgg gactgcagac agggaagaca gagaaagtgg    129780
     catgccatat aagacttcct gaggcagagg agccgaagaa gttttctgtg gaatttgtag    129840
     atttggagat ctccatgcct agagaaaata aataagactc ggcccatggg atccatgcag    129900
     acgcattttg aggtttttga caagatgctt gaagagatcc aacagctgcg tctagacgcc    129960
     atctacttta caaaatcgac atccagaaca gaggggaaaa tagaaaagct gagaggaaag    130020
     tgcaagagat ataaggagaa gtttgtacgg aagccgtcgg aaaggtattt caaaaagatc    130080
     gagaaatttt atcgagcaat aaagaaacat ctagtgaata ataggaggtg tgaagatgcg    130140
     ttccaagaag tcatccatga gcttaagaag aaatgcgagg acctttgctc gagatccggg    130200
     gtgtcctttg acctggaatg cccagaaata ccagatgtaa actgcgttgt gaacctggga    130260
     gagatgggaa gcaacgagca actatactgc aagtgcaaaa gacctgcatt caaaaatatg    130320
     atagcatgcg attccttgga ctgcaagggg agatggttcc attttgagtg tgttggaatt    130380
     tcaactgttc caaaaacact ttggatatgc ccggaatgca gaaaagctgg aacgctgact    130440
     aggtaagcgg agttgataca ataaaagatt gtttagttgt ctaggtatcg ggaagagatt    130500
     acattgccat gagcaccagc atgattatta ccagaaaggt aagtattttc tgtgtgtcag    130560
     gatcgtttgc agtaggtggt ctcctccgat gatcgaatct cctgtacatt tgggaatata    130620
     aatattcgta aaaatcgtta gagtaaacaa aggactcttg atatccttgg gagtggaatg    130680
     cattgaagaa gacatttggc atgacgtctt cgggagtaga gaatctgggg ctggctctga    130740
     atgtgggagc ctctctggcc atgtcatatt tccttctctt ttctggattt ccaagtgttg    130800
     agtatgcatt ctggatgatt ccggaaacag cactagactc atccatgcca gtcttatcgg    130860
     gatgaaactt catgattaaa gtgttgaagg ctctttttat ttctgcctgg gtagcattct    130920
     tgggcactcc cagaatgtca tagtagtcct cggacttttt cttaagaaat gcctcgatat    130980
     ccttgtggag agaaagagtc cttgttgcct tctccatctc tctcttgtcc tcgggggatc    131040
     ctgtgagctc gtactgcttc ttggcatttt ccaagtatcc cgaataatcc ttcctgctta    131100
     agcatgatct ggcagcctcg gaatagtcca tggaggggtc cttgatgcag agatacttgt    131160
     tgaatttgaa ggaatatatc cagagtggtg agagaatggg aagagagatg gaagagaatg    131220
     gaaaggaagg agtaacaatc tgaaggatct gaggagagaa tagattctag aaaaaaagaa    131280
     aaaattttac ccttcaagag gagtagtcca tggagataga cgaaagcaag agagcaagca    131340
     gtgattcatt aacaatatat gtaggagatc tctcgcccaa gacccttgac tcggatcttt    131400
     ttaggatctt ctcaaatgtg ggaaaggttt tgaatgtcaa gctgattaag aggggagagc    131460
     ctgtttcatc ctttgcattt gtgacatttg aaaacgagga ggaggcagag agggcaatca    131520
     gggagtataa gcactatgaa ctgcataata gacagataag ggtaatgagg aaggacgaaa    131580
     gacccccgga gacagggaac atctttgtca agaatcttcc tgagaacttt acgagcaagg    131640
     accttgatga tgcgttttcg atgtttggag agattaccag ctgcaaggtt gcaacaacat    131700
     cgcatggaaa gtcgaaggga tatgggtttg ttcagtttaa ggagaagaag gcagcgaaga    131760
     aggtgatcaa gaacttcaac aacctcaatg ggcttatgct tggagaaaac aagattgttg    131820
     tggagctgta taacccggag atgaagaagg gagagaacaa gaagacaccg acgatgttta    131880
     caaactgttt tattaagaat tttcctgttg atgttgagga agagaatctt cgagagcttc    131940
     ttgagaagta cgggaaggtg acgtccttgt tcttcccgac gaaggaggat ggaaaaccaa    132000
     aaggatttgc atttgctaat tttgagagcc atgagtgtgc tctgaatgct atcaagaatc    132060
     tccatgagac atttcccttc ggggacggcg agagtgggga gccgttctac atccagaaag    132120
     ggcaaagaaa agaagagagg gcagaggaac tccgaaagac gtttgagcag ctgagcatgc    132180
     aggggcagag ctacaagaag aatctctaca taacaaacat tcccgagggc tttggggctg    132240
     aggagcttaa taacatattc agagagtttg gaaacatcac atctatgtct gtggggactg    132300
     acggagccaa cagccagaag cagtatgcct atgtgtgcta ctcgacgccg gaggaggcca    132360
     gcatagctgt ggaaagaggg aatgagatat atcttgatgg aaacaggctt caggttgcat    132420
     acttcaagaa taagctggaa agaatgaaag agaaagaatt tggaagcatt ggatacaagc    132480
     cgaatatccc atacatgtat aaccaggggg ttaattttgt acccaatgga ttcaagcgtg    132540
     aaagaaaccg aggaggatct gcaaagggat acagcagcga actcgaaaag ctacatggtc    132600
     ttgtgcttgc agaagcacca tctttcaaga gccaatggaa gagcttcggg gtgaacaacg    132660
     aggccgagtt taccagcaag gttacaaggg cctttcgtaa caaatccgaa gaagaaatca    132720
     aggatatgat cgacctggac tttgtgcttg caaaaagcat agcagcggtt attgagaacg    132780
     acaactctag cgactaagtt ctactataaa cattaaagcc tttttaactt tgaacttgaa    132840
     tgtgttcgca cctcaggaga gtctgggagg aggcgagaga caagggggat tatcttagtg    132900
     gtagaggatt tgcttcgcat gtgaattgcc cgggttcgat tcccggatcc tccattccat    132960
     ttttcaaaga gcaataattt caacagactt tagtcccgag ttcgatgctg ttttcaaagg    133020
     agactctcaa gtcttttgca caatcaaagg ggatttccaa cattgacgac gacgcactga    133080
     gggttttgtc ccaggatctg gagtatagaa tcaaggaggt gtgccaggaa ggaagcaaat    133140
     tcatggttgg ctcaaagagg acaaagctgt cgatcgatga catcaactat gctctaatca    133200
     gcaggaatgt agatccactg tttggatatg atcctcagga gagccttgtt ttccgcggtc    133260
     ttccctcgaa tgtatactat gttcctgacg aggagattga tcttgaggag tatcttgaca    133320
     ggcctcttcc caagattcct cttcggccgt cgattcaatc tcactggcta gccattgaag    133380
     gagtgcagcc ccagattccc tacaacccga tacttcttga aaagccagtt gcaaagaagg    133440
     acacactagg aacataccaa gaggaggccg agctgaagtc ccagaatagg catatgctca    133500
     caaaggagct gagcatgtat tttgacaagg ttatccaggc catggaaacc gacgaagaga    133560
     tagcaatgga gtgcctgcac aacgaaagtg ggatccagca gcttgttcca tatttcattc    133620
     accatttcaa tgagcagata gtgaagaaca taaaaaacaa agaaaagctc atgacggtta    133680
     tgatggttta taactctctg ctaaggaaca agtacatctt catcgatccg tatctccacc    133740
     agatcctccc ctcacttata acatgtgtga ttgggaaaag cgttgacgac gaggtcagga    133800
     gagtggccgc agatgttgtc aagtatgttt ttagtaactt ttccagttcc tacaagacac    133860
     ttgcgccaag gatcattaac accctcagca aggcatggct ggacaaggag aagacagagt    133920
     ccacgcagta tggggctttg ctctgcctaa gcctcctgtc aaaacatgtt gtagagactg    133980
     ttgtaaagcc taaggccgac tactatgtta aggaaatcaa caatccacgg gttacggagc    134040
     ttctggatga cattctgaaa aagaacgata tttaatgtct ggactggcct ggaaagcctt    134100
     cagtccaagc tacccagctc ctttgctact tcctttttct cggcggagga catgcagact    134160
     gtaatctccg agccgtttct aacctttagg aggccatggt caataaactc actgatcatc    134220
     gaaagaacag atgtcttcga tgtgagaaac aattttctct ttattctctc aaacaactct    134280
     ccaaggccta caacatctga attgtacagc aggatttcct tgagcacgag tctggagttc    134340
     cttggaacat ttctaaccac cttggacgaa gcctctgctc ttgtttctct gaaatggatg    134400
     ccagctattt cttcttcata tggctcgaag gtggtgagat ctctgaagat aaagttgaac    134460
     ttctcggcgt cttcaaaact gaactttatg ttgatctctt caatagttcc cagaatcgca    134520
     aagttcctca gacccgagaa gtctgtcata ctgaagtcga agtttgccat gacaatcttg    134580
     tacttttcct ttctaaaccc tattgcctcg tctatgtcct ttattgtcga tacttttgag    134640
     atgctttgag ctgcagacct cgacctgcgt ctaacggcat ccatgatttc caaaagaatc    134700
     tcatgccgac tcatggctct gcagttgagg tgaattgccg aaggaaacat tttcctcagc    134760
     aacggcatct tcgagccata tccatagaac aagatgttga acgactttgc taatgcattg    134820
     agttccttct tgcagttgaa atggaagtcg ctgagatccg agctcatctg gacgggtgtt    134880
     gtgaaggagc agataatcta ctttttgccc agggtagtta ggctctcatc gagagatatc    134940
     ataatcccaa accgatagcc catggatgag tccaaacaaa agctcgagga ggtgcagatt    135000
     cttctgaaca ggctggcggc ttcgtctaac aaggagatta gaaggatttt ggatgggtta    135060
     ccctcatgtc cgacatcaaa gtctatcttg gatacctttt gccttctttt tagcttaggg    135120
     aggtacagta acaaggaatt gctttgtttt ctagatgcat tccaaaggtt catacctatc    135180
     tgcagggcag acctaagcga ggttggggac aagatagtag agcttaagtt tactccttcg    135240
     gagaaagaca ccgatcttgt gatcctcaag tacttcgaaa tcacgaacac catagccgag    135300
     agtatccagt cggaatcctc gagaagtgtt tttagtagat atatgtttgt tctctcgaac    135360
     agtgttgtaa gcagaggtgc gcaagtagag gtgcttggga gattcaggga gtttctcaag    135420
     aagaagaaag gtcttctaaa gctctttgca gctcgaagaa tgtatagaaa cattggatgc    135480
     acagaagatt tgatcataaa cttcagcgag cttcttagtg acgaggagat ggttgaagtt    135540
     gcactagagt gcaccaccct ccgaggcttt ataatagcca aaacaaggag taggtatctg    135600
     ttccagatgt atcacaacga acttccctgg tggtatgtga tggggatgca tgagtcgctg    135660
     attccgtatt tatactacac tttcgatgga gttgggcttt acaagaacgt ctccaaggaa    135720
     gtgtatggca gactagatga acaggacata ataagggcga tggacgagga tatgaagagc    135780
     aagatctcac cagatgaatg cgatgtgctt gggaatgtgt ctgaacataa gaatatggcg    135840
     gatgatgaag gaatggtcgg agtgaagaga gacataagaa gattcaacga aacgggatgc    135900
     ttgaaagaga tgcttgagaa gtatggagag cagatgagct ttgagttttt gaggtatttt    135960
     gaggaaacag acctccggag attgggggaa tttctgtgca agctaaagaa cgagccttta    136020
     ctaaggatgt ttgccgagac atttgatttt cttgacatgg atattctcga tggtttgagg    136080
     atttttctcc tttccttcca cctatctcca gagggccagg taattcatag agttgtcgag    136140
     gcttatgccg ataagtacta tttggataat gcaggaatat gcacgtttat ggacatggcc    136200
     aaggacaaga agacaaagga gtttgtgttt aatctctcat tctcatttct cgtccttaac    136260
     acgaagttcc ataacccgaa tataaaggtc aaacctacat tcaaggacta catgaaggac    136320
     tttacacctg aggagattcc tccttcgttt ggagaggagt atcttgagtc catgtaccaa    136380
     tccatcaaaa aaaagccgtt ggaattcccg gccaagaacc agcctggaaa agaacactat    136440
     aaagtattca agaaggtgtg taagaacctc caagagatgg agtcaagaga atccaagctt    136500
     agaattcggc tacttgagcc tgaacttcca gagggactga ggatatgtac agcatgcagg    136560
     atggaggccc acaggaagtt gttttcgaca gatttcaaga gatttctttt cctggaccct    136620
     aaggtgttct accaaatatg cagtaggcta aggatgacac atatatttga agagtatctg    136680
     aatgcccata aagaagatac ccaaaaattc attgagtcct ttgtctatta tctgggaatg    136740
     gaaggaaagg ccagcctgta tgcaactcta ctcgatgttc ttgcaaggac cgacaagcaa    136800
     aggagcagtg gaatgctttc ggatcttgga atttcgtttc taaagagctc accaggaaaa    136860
     gacagggtcc agcaacaata tagagacgca tacaaagaac ttttgaattc ggaaatccct    136920
     aatgtcggcc tcctatgcga aggtttgtgt ctctttcttt caagagatgt gtctggaggg    136980
     gtgtctgggg aggaagagat ggcttcccag aagagaaggc agagatctat agggtttgta    137040
     aagggtgtgg ttgttgacat tcttaagagg aacatctcga aggtggagga tctgtcgatg    137100
     ctggacgacg agaacattgg ggtcttactg agggaatgtg ttgaaacagg aaacaggaag    137160
     aagttctgcc atatatccaa gtttgtctcg gaagaaagac ttctttttta tttccggcag    137220
     gttttggagg aaagcccagg gtttttggac gatgagattc tggaggtatt caagaggatc    137280
     tccatctata atgaaaatgg attccactgc attctgcttc tacagagtaa tggagttgat    137340
     atgtttgact ttgtagtcac agtaaaatac gaaagtattg tctgcagagc tataaatgct    137400
     cacgaaggag aagatggaga ccaatctgaa cagtcgaggc tggagttttc tggaaaagac    137460
     actttgaatt gttacactgt tgaagaaaag tatggggaga gcctgtctgt tccctcgaat    137520
     ctgtttcact tctatgtatc ttccaattct gttctgaatc agtcaaaggc aagatcgatt    137580
     cacaagtctg ggtgtcctct gaaagaaaag ctgtttaacc gcgaagaaat ggacaagaga    137640
     ttgatataca tgataaagaa ggcggactcg atgaacagta aggacataac caactatgcc    137700
     ctttggattg tgaaccttct atcttcaagc cttccgttgc tgtctaagtt ctttgtcagg    137760
     aattttgggc ttctccttac cttaaaggac cagacaatga caaacaactt catcaagata    137820
     ttctactcga gaatatgcaa ggtaataaat gggtctgagt tgtgctgccg ctgcggatat    137880
     tcctatctgg acgatgtgga gaagcttatc gagatgctgt tgaagtatga ccttgcatcg    137940
     gaaaaggact ttgaattcta ctttaaagga aaatccgaaa tgataaagag cggaagggtt    138000
     aaggttggcg aaaggggtgt gcagctggtt aattccaagg agaagaatga cggaagtgag    138060
     aacaacagtg gagaacctgg agaggtagcg gtggttgggg agccaaatat caaaacaaac    138120
     cctgacttca atctataatg aattattata agcatatgaa aataaatggg cagtatttgt    138180
     acttgtggtt cttcttttcc aacctgtctt ggaaaaccat tttggaatca acaaatcgct    138240
     tgttttcggg accccagaga tatggaaata tttgccaatg atcctttcct ggaggaaggg    138300
     atgtgcaatg cacccatagg gacatttgac aagcactaca gactttctag gaacttcatt    138360
     gcagaccttg tgcatctggg gcccattctt gtatctgttg ctgttgaaaa ggatttttca    138420
     agagcattgg taaggtctgt tctggggttc aaggagtaca ggttttacag taagcatatt    138480
     gaagagtgtc catatttttt cactgtgaga aatagccttt ccaggtattt tgtagatacc    138540
     atcgacaatt ggagacatgt agagattgct ccagagcaga gggagtcttc tttgatggga    138600
     attttggggt cgatcttttc atttggggcc tggccgttga gagatgagtc tgggggagga    138660
     aggaaaaaga tgtatgatgc aatctcctct ggaatgatgg gatgcccaga aaggtattct    138720
     gccaaggaga taatgaataa gatggcagag gtgagggtgg agtatgccag gggcgtagat    138780
     aatgaattct atacgaaacc aatttatgtc gatttggttt gtgagagcag caagaggatt    138840
     ccgcgggaga tgcttgggaa gaggtttatt gatcctgagg acaccctttc tgtatcctcg    138900
     gatgatttag aagacataaa gtcccccacc cactctggag agaaaagact acggcaggca    138960
     ctcctcggat ttcttttcaa tgaagttgaa tacttttgcc aggtgaacgg gttctacctg    139020
     gatattgtct ccaaagcacg gaaatccgag ataaactttg aggatgtgtt caaagggttc    139080
     tacaaggttc acagcttcga ggctggattt atagaatcaa tgagagatat agtggaagaa    139140
     gcagggttta agatggatag aatcctttct gatccccaat actttgcaga tacaatgagg    139200
     gataatgggg ttggagagat taaaatggat gacgaagaga ttctggagaa ggtcctggac    139260
     tcatttgaaa ggcatctcaa cggattccga tgctatgaag atatgatgtt attccatgaa    139320
     gaatatattg aaaccttgga gaaggtcagg agttacgact gggcaccgga ctacagggtt    139380
     gtaaacgatt gcttctgcaa ctgtctgcag cgaattgtga ggtatccaat tcttattgat    139440
     gacattcttc agaacctcac cttctctctg catgagaaga gagtaaagaa gatctatgca    139500
     aaaatgacca agctcatcaa cataatcgac aagaagaaag aaagacatga caatatccga    139560
     tgcgagcagc tgatcaggga aaaggttgag gagattcctg gggaggtggc tgaaagaaaa    139620
     gcgaactttc tttttcaatt gaattgcgag gattcgaatg gagatcctat tgcattgttc    139680
     ttgttccgtg aaatggttat tattgcagat agagaaggcc cttccttacc tatccaggac    139740
     cctaggtgtg gaaggtactt tttccggcat tccctgaggc tagaggatat agaaatagtt    139800
     tcttttggaa caactgggat aaagataatt gggaagggaa gtctgaaagg aaacgagatg    139860
     tacgagatga aagaggttta tagtgacgtc tctattggag tgatgtactt ttcaaaagga    139920
     tctcctcatt ctgtgaaatg gttcatcgag gagtaccaca aagcgggaac cgactctgga    139980
     aatggattgt atgcatcggg aaatgtgttt ttcagagttc tcaaggactc cgaagaagga    140040
     ggccaagaaa gaaaaagaga tttgataata tatgtaggag atgtaggatt ggatatatct    140100
     tcagattcca attccgcaca ccttgatctt gaaaatggag ctttcacaac aaagggacaa    140160
     agtattcaac actccataaa ctacggaaaa gacgagataa agcaaaagtt tggagagatt    140220
     gtaggaaatg gggtcagagc caggaaagca tggatggcct caaaagatac acctgggaaa    140280
     tgtcctgagc tgtttgccat gtacaggata aagcttaggg agattgtaga ggaatgtggg    140340
     gactcttcag ttgttgaatt caatggaaga ttttccaaat gcaattcatc caccataacc    140400
     cggaagattc gtgtagcaga agggatcata agatatctat caagatcttt gccatatgta    140460
     ggatgcagaa gctctggtgg aaaatatctt ttttctagtg cagggctaga tagaagcaga    140520
     cttaaagaag aagagatggt gaacttccta gaaaaggccc taagcacaga ggaactagaa    140580
     gattacgcct tttccgaata caatgcagaa gacatcctat acctgctgat gtatttcata    140640
     cgtacaagca tgtacacgtt ctttagaata gaagacatag aaacattgca cagaacactg    140700
     tttgtagata aaattcattt tctaggagca gttgttccaa agatgagcaa tccttcattt    140760
     gtctcgtccc ttttcgaaac catagtcaca gcccgagaca agctttgtat tgtgccaacg    140820
     ctggatatgt ttctagttat gttttcccca ttccaggtgt ccgagcagga aatggccgaa    140880
     attgtgacta agatttgctg gtgatgatgt attaaataaa cgttctgtct aatgtttcag    140940
     aattccaatg gaagtgttta cttgaagatg attgttttcc attcctatgg atacagagga    141000
     ggaaaaggct ttgagggagt cttcaagaaa catgaagacg accgtccaga taatacagga    141060
     gaagatggac cagcaagctt taatatacga atccattgag gccgaaacag aaagaaatgg    141120
     gaagattttg ttcctgaaca ttcgaaggtt cgaagaagca atcaggagaa tgaacagcga    141180
     tccaaggaac aaaataatat ttatgttatt tctggtgatt gtaggatgca gtggatatct    141240
     attcttttag ttgcccattc ctcgataaat tatggtgttt tacacgctat gtttttcagc    141300
     atttcaacat caagcaaatt atcgctttct gcatacttct catagaagtc tgtcagtatg    141360
     tcaatgatga atttcttgtc tgcatccgat gcttccgaat actccttcag gaagatctta    141420
     ttgattctgg acatgtccct ccttagtttc cttcggcttc ttttgttggt ttccttcagg    141480
     tactttactg tgcttttgaa tccctcggga ttctccttca tcgatagaag aaggaagtat    141540
     ctggtcatgt tgaagtattc ctgatctact ggagagattg gaaagcagat gaagaaggta    141600
     gaaatcacat ctagaactag atgaaaagtc gatgcaattt tcaaagttcc cattccgcaa    141660
     gtcactatcc caagacacat cttgtatctc tcaatgtctc catacctcat agagagctgg    141720
     gcttcttgct tacatctact ggatgtaaaa aagaggtctg tctgttctcc cagggacttc    141780
     cctgtttctg ttgctttgat ctgtctcctc aaaatcctga tggtatcaag gttacaagat    141840
     gaattcgata tcaacgaaag agacacaaga gatgcatcaa atagtatctt aaactcatcg    141900
     ttttccctca tggctctttc tgcaaaaaga cacacctcta gaatggactt gaaaagactt    141960
     ccttccaaat ccaccttgat tcctttatac agaaggtaaa gagacacata taataatctc    142020
     ccagatcccc tgtaaagctc ataaaaactt gctgctcggc tctttttggc cacctcctcg    142080
     ataatagaat ccagttgttc gttcatttct aatccaagca ggaacaactc cgaataaaaa    142140
     acctcttcag gcgtacttgt gtccgatctt ttaaacttac ttcggaatct cgtctgcttg    142200
     cttccgaaaa gaacaatccc gttggtaagg agctcacaga gagaatcttc cagctcgatg    142260
     aacttgaaca tgtcgaggct agttttcata tacaccatcg aaagcgaaat tgatgacaaa    142320
     actctgtatg tgtagtcgta ccatatcttg tttcctttgt tgtattgctc atctccaaag    142380
     actccttttt tgtttgcctc tgagcttaaa acgttcctta taaacacgtt tccgcttcct    142440
     gcatatagca ttccaagccc aacaatacac ccagcatgga tatacaatgg ctgtggagac    142500
     ttgaggcaat gtagatacat tttccctaac aagtcatctc tcttgccaag atgactcatc    142560
     cccattcccg ccagaagcgc catggacact acaggatact ttgctgtgat aaactcccca    142620
     accttctggg gatgaactcc ttccaaccgg ccctggagcc caaatgcgaa tattcttcct    142680
     gccacctcaa actcgtttcc ctctcctgtg gatgtaaatt ccaagattct cgactctata    142740
     aaatcatgtg aaatctcatc aaaggagctc agcccgcaac tcctagaaac agagtagtta    142800
     aacataggcc aattcatcca ttccggatct ttaatttcaa tctctcctaa ttccccattc    142860
     ttgtagatcg ggaatcttag ttgtcctgga ctttgttctt cctttgctac ccccagtcca    142920
     taaaacaaat atgctcctcc tatgttcgat atcttccgaa gaacatatcc tttttccttc    142980
     ttgttttcaa ggtcgtactc gtcaatctca aatattattg gcttctcatc aaacaaagaa    143040
     atcacttcct ctatccgaga gtccccaaag tgctttttag ctattctgca cagtttattg    143100
     atggaccttg tgggcttggt acttcctagt atcctacttt tcttcatttc catataaatc    143160
     actctgtatc caagattctt cacatccgaa tacttcaatc ctgtaatggc atctagattg    143220
     catctcatga tcctcctaaa ctttatattc atcacatctt ggcctacaga gagcgaagga    143280
     caggtataat taatcaactc cttgcatctg gacatcgtct ccaaaccttt aatcggagct    143340
     atctccattc ctaaaaactc ccatacgctc ttgcatcgag ctagccattc gtccagaact    143400
     ctatcaattc ctgccataac atcctcggtt atctccagaa ggtcaaatct cttctctttg    143460
     ctttgaagaa atgcccccat aaacactctt tgcatcgccc ttggatagca tgaaaggata    143520
     ttcttctcca cctcatttat ccctgaccag aaaggcttgt aatagttctg catccatttc    143580
     tttggaatcc tcgactttgg ccacagatct tttctaatcc tagagcacat aatctcgttt    143640
     cccataaaga gcacatcgtt tatccttaaa aactcgagat atttgtctct tgtaagcctc    143700
     attcgatatt ttatgaggtg tttggcctcc ttctcgaacc ttacattggt ttcggataga    143760
     agcttacttc tcttcactct tcctttactt cccccaaccc ggacaaacaa tgctgtattc    143820
     ccataaatcc caaccatgaa attttcgtac tcagtgatcc tcatctttat tcccccctca    143880
     tttttggtat cttcttcata gtcctcaaca aggcatctta ttccttcctc tatcttataa    143940
     gcaatcagca ttcttgttct gttggtctcg tcaaagttgt cgtctcccat tccagagcat    144000
     gaggactcta tcggatcttc cagtcctatt tcctttcttc ctgtattcct aaggagatat    144060
     cttcccctcc cctccagaat catctctcca gatatgactt cccggagaac aaatccgtga    144120
     tgaaagaaca caaattcctc gggttcaaag ggatgggaaa taaacatcac atggttgttt    144180
     tccttgtgat ggtaataaac accttcttcc ttcacaatag ctgcttttat tggccgtgac    144240
     aaggtcatgt cctcatctcc aaagaagtga atcctcgact gggtacaaac aacaacccat    144300
     ttcttgaaat tccccacact aataatctcc tccctaaacc ttagcttctt tcctttaaac    144360
     acaagctctg tacttctcca tttaactacc atcaaagggt atactcatca aagttttata    144420
     ggttccttgc ctactgctct tcatagctct tcctcctcaa cagacattcc acatctacat    144480
     ctacaaactt ccccatcatc ttcaaacaca tgctcatgct tcttggtgtc tccaacttcc    144540
     atcctggttt ttctcctaag atcctttata ttctttttca acttcctttg cttccgatct    144600
     ttagttctct ttttcctctt ttccttgatc tcctcaatct tctcgagcga tccccacttc    144660
     cagactgcaa actcttcaac ctcctccttc agatacagat gcattcttga ccatgttccc    144720
     ttgcgaggat tgggtctctc aagaaaccgg agctccttaa gctcgtcatc tactagaaga    144780
     tagtcggaaa ggcaagaagt ctttgttaca aacttaagag agctgtaacg gcacgatctg    144840
     cagaccggaa ttccaaatgt cttttcaatc tcatcatcga gaggaatctg gagacaatac    144900
     ttgcatctct tgccaggaag cactggaaga agtatggact catcttcctt tagctccttt    144960
     ttcttgtctt ccttttctgg gaaaaatcct ccgtcccgcg aagtattctc catcctaccc    145020
     aacggagggc atctgcttta cgtttatgct tcctttaaga catgatagaa cagatcttgc    145080
     ttgagagaga aaggataatt ggttctccag tagccccttg tatgcttctc gatttgtttg    145140
     gactgttcgg aggaaagcct tcatggtctc taagtccaaa aaagtttgaa gggtgcaacc    145200
     agaacaactt cggaggaaaa gtgatagtcc cgcaatccgt tctggttgat cttgtatcgt    145260
     tccagatcca acctccattt acatttgaaa tttcacactc cgacggggtt ttcaagaccc    145320
     attgtggagt cttggagttt actggcgagg aaggccaggt agttgttcct tcatggatgt    145380
     accagcaact ttctatggga gatgtagaca aggtcgagct caaatatatg acttttccac    145440
     ttgggaggtt tgtaaagctg attcctcact ctgtagactt ccttgaggtc gaaaacccaa    145500
     agcaagagct ggagctgtgt ctgagaaact accaggtcct ttccgaggga gatgagatct    145560
     tgttccagtt tgatgaagtt ggatcgatga gattcacagt tgcacatata gagccatcaa    145620
     gcagtgcagt atacattgta gacacagatc tggctgttga cttcctggaa ccaattggat    145680
     ttaaggacaa ggtggagaga gaaaggactg ttacaaagta catcgaagta gtaaattcaa    145740
     actatgacat aaagccaatc cggatgaaga agcttgggct gtatatgtat aagtcagcag    145800
     attaaatcca acaactgata ctgtttattg ggaaatggaa ttttgattaa gaaacaccgt    145860
     tgaaagagtc caccacggat ttatatgcca aatacaggcg gtcttcccca tggctgcttc    145920
     caatgttatt cacaatctgg tcgaaggaaa agatgccttc tgacataagt atgaaattct    145980
     ccacaaaaca tctttcattg tctggagggc acagaaagat cttaagatac ttttcaacaa    146040
     catctatcag aggaagaaca ctcacttttg tccttaggta tcgctttatc tctgcagtct    146100
     cgagtaaaag agcctcggaa atcctaggtg tgactttgat ggagtagatt ccagaaaaga    146160
     catgagaaac cacgctctcc accaatgtga ttcggatatc ctcgtatatt ccctctatct    146220
     cttcattcat tatgtctttg tctaggatct gtatgacttt cctagaaaga ccctctggag    146280
     cagaaaagtc caggcctagg aagtagcttg agagaaaatc atcaataaat gtgttttgaa    146340
     gtctttcggc ctttctcatt tgcatgtgaa tctttggaat gtcctcttct acttctgact    146400
     tttctatgat ttggtccaaa aaatctagag cagtttctct gatgtaaagc atagtgttta    146460
     gtacaattat agactcgttc agacatccag ggaggcgtgt tcttttgatc agaagactca    146520
     aatactcgtc gaaataatgt acgagatgcc tatgcgcaga cttgtcatta aggtactcaa    146580
     cccttttaag aatcttttct actccacgaa agaagtccag aaaccccgag ataatgcata    146640
     gtttaacatt ctcttggttg aggtcggact ccataagctc tttgaaggat ctttctagat    146700
     atatctcgat gtttggcaca aacaatgagg atagcattgt cttgtgtgga cagaaggttt    146760
     ccttttgact caagcctttg gatttacatg ctccatcttc cagagatgta gactgtacac    146820
     atgcactgca tccctgtttt tcaaacagct tcccaagtct cttctcacat ctgatcgttg    146880
     catcaaaagc ttctatgaaa tcctcttcat cgacctcgtt gtaaaagaag taatcacata    146940
     cccgttgctt cgtcataaca tagtacttga gcaatatttc tcgtggtaag ctccagtcgt    147000
     ctgggacatg ggaatatttg aggcttactc tgcttatgct ttcttcaatc catccaagac    147060
     agctctttaa tgaagatagt ctttgaaagt tacaattcaa gaactcctgg taactcacag    147120
     aacatagtga tcctaggtaa gaaatcgcca acgatttcat cctggcctca aagctttctc    147180
     cctgcagtaa cgtgatgttg accagtggct ttggaattcc cttttgctca tggacacatc    147240
     ttcttatttc ttcctctatc gaggactgaa gaccttccaa gtcattggtg cacagcttgt    147300
     ctctaagaga tagcttttcc atttcttccc tgataatatt gtaaatctcc tcgtagtttt    147360
     tcgagctgtg caatgtcctc agctcagaag catgcataaa ctatgatgat tctcacgatt    147420
     ttaggccaga actgaaacat ttgtttcaga caggactctg aatgagaaaa aggatggaga    147480
     agtccgtcct ggcattcaga cagaaggact cctctaccga agcgataaaa ggcaaaatgt    147540
     ttttctagtc ttacaaaaac aagcctggag atggagaatt tgctggaaga tgactcggag    147600
     aatttactaa ggatgagtcc agatgagtat tgggtaggcg acttcatgca cagaagagaa    147660
     aaccgcagca tagtccgtgt tccagacgag tttcttgaag atcgatttaa cattattgga    147720
     ctggacaggt acataaaaga cctcgaaaag gtatatagtt cgatacttga caagggacca    147780
     aggagtagtt ttcaggagga gtcttctcta tactatctga tacatcagaa atacatcttc    147840
     acaaagcctg ggcttgagac tgttctggac agggtgatga gcaaggagta tggagcatgt    147900
     ccaagaatag gatgcaagtc agttggaatg atccccattg ggctgagcga caggcctgga    147960
     gtttcgtcaa caaaagtcta ttgccactgt tgtgtgagtg tgtacgaggc caggggaatt    148020
     ctccggcttg tagatgggtg tgcatggggg aaatcgttcc cgcatttcct aattttgact    148080
     cactcgtacc atttcccttc aggaaagtgt gaggagtatg tcccaaggat atacggcttt    148140
     cggatatgcg cccacgacga caacgactct ctctccgaag acaactaaaa taaatgccta    148200
     atatggaaga cagcctgaat ctttggttat tttcaaaaga catcgaaacc gcaatgagag    148260
     acgagcttct agaggagcaa tatggattta tatctcacca tgaaagcaga agaagagagg    148320
     gatgggtcct gaactacatc actactgtat tcaaagacgg gagaatggaa gcaaagcttt    148380
     atctgattga tgacaagaga gccgaatttc ttgtgaagat tccatatttt ccatctcttc    148440
     tccttaaagc ttcggattat gattctgttg aagaatatct caggagaaaa tatgcagcag    148500
     agatttacag catggagaga gtgcatagaa ttgactttaa cgaatacaat catctgaaca    148560
     aagacccagg agtgtttcta gaggttagat tcaggaccga gtctgggttt tcaacagctg    148620
     tgaaggactt caagaagata gtggcaagga acaaagtgca gaagaataat gaatatgatt    148680
     gctttggaaa ggatcgaaca ctctgcgcag aggaacttat ggagggaatc ttcgagtatg    148740
     atattcctgt agaggtttgc acggccaaca acctgaagat cagatgtgga aagtggtata    148800
     ctttctacta taccggagag acatatgtta tagagaagag cgaaagagtc gtgtttccag    148860
     atcttcggat acttgcattt gatatcgaga cattcaaaaa gccgctgaaa tttcctaatc    148920
     cagactatga tgaggtgatg atgatatctg ttaaaacaga atgcagggga gaattgattg    148980
     tgaaccggag gctggtttct aaagacatca ggaagtttga gtacaatcca agagaagaca    149040
     tggagtgtgt gtttgatgtg tcgaacgagg gagacgaaga aggggtgctg attagatttg    149100
     ttgagttgat tcaaaaacac aaaccacact tgataacaac gtttaatgga gcattatttg    149160
     actttccgtt cctggagaaa aggatgaaga actatggaat aagcctgagg gagacaactg    149220
     gatttactct gaaggatgaa tactacattt caccgtttat tgtgcatctt gattgctaca    149280
     aatgggttaa aagagactcg tatcttccgg cagggagcca gggtctcaag gaggtcacta    149340
     aagtgaaact aggatacttc cctgacgaga ttgatcctga agacatggtt aggcttgcaa    149400
     tgtccgaccc cgacaaaatg gcatcttatt ctgtttcgga ttcggttgca acatactttc    149460
     tttacaccaa atatgtccag cctcatgttt tttccctatg ctctcttgtt cctctctctc    149520
     cgacctcggc actttgccag gggtctggaa cactgtgtga agctctgctt gtctctgaag    149580
     ccattgaata cggggtgctt atcccagaaa ggaggagaga aagcaaaacc cgagagcaca    149640
     acggacacat agcagaaagc atcacatatg ttggaggata tgtcgagtgt ctccggtccg    149700
     ggatttttcg gtctgacctg gagcatgaat ttaacatctc taaagaattc attggagaag    149760
     tggtttcaag ccttgacgaa attctctatg agtacaagga agaaggaggt tttgaagaga    149820
     tgaaagcaca gattcttgcc aatcttcagg agaacaaggg aagacttcga aaggaggggc    149880
     ttatatatca tctggatgtt ggagcaatgt atccaaacat catacttacc aacaaactgc    149940
     agcctgtgtc aattgttaac gaagagatct gcataagatg tgacttttcg gatgagtcga    150000
     acaattgtaa gaaaagaatg gaatggagcc ttaaggtcga gtacattccg gctggtaaga    150060
     gggaaaccga gatgattagg aggcaggtag agaaggaaaa gaactttgaa ggaaatgagg    150120
     aagaagaggt gaagaagagg gtcagaaggt attcgaagag tatgtacgga aagaaaaggg    150180
     aaaagaagat ttgtactaga agttcgacag tttgtcagag ggagattcca ttctatgtgg    150240
     aaacagttag aaaattcagg gaccaaagat atgtgtataa gaggctgcaa gcccaggcac    150300
     aaaaggctgc tgaggaagcc acaaccgatg aggaaagaaa gtatgcgatg aagtctgttg    150360
     ttgtgtactc ctcgctccaa gtggcacaca aatgtgttct aaactcgttc tatggatatg    150420
     tgatgagaaa aagctcacgg tggtacagca tggagatggc ggcgatagtt tgcaatgtag    150480
     gagggaacat tattaagaag gcccgagaga ttgtggagaa gatagggatt tccttggaac    150540
     tggataccga cggaatatgg tgcatagttc catcttcatt ggtatcttca tatgtactcc    150600
     cgtcggggaa gaagttttct ctcttgtcag gcctcctcaa ccactttgta tgtaagaaat    150660
     ttacaaacaa ccaataccag gagaagattg atggggagta tgccacaaga agtgagaatt    150720
     cgatattctt tgagattgat gggccgtaca gggcaatgct tcttcctacg tcgaccgagg    150780
     aaagcaaatt gctgaagaag agatatgcaa taatcgatga caacaacaag attgccgaat    150840
     tgaaaggatt tgagatgaaa aggagaggag agctccagat tactaagaag ttccaggagg    150900
     agctttttct acacttcctt gatgggagta acttaaacga atgctatgag tcgctggccg    150960
     aggtgtgcag atactggcta gacatactaa agagcaaggg agaatatctt gatgacgata    151020
     cgattcttga gttactgtct gagagcagaa gtatgtctaa gggatttggg gaatacagag    151080
     gaagaaagtc gaacctcact gttacggcgg ttaggatgtc tgaagtcctg ggagaaggaa    151140
     ttcttgaaga gaaattgaag tgcgagtata ttgttgcggc atacccagag aataaatcgg    151200
     tggcagagag ggctatacca gtggtggttt tccggtctga gcaaaaggaa gagtttctca    151260
     ggaaatggct ggaaagagac tattctggag acattagagc cgttattgac tgggaatatt    151320
     atagagtaag attggagtgt gtgattcaga ggatggttat actgcctgct ctatcgcaag    151380
     gaatcaagaa tcctttgagc gaggtgggga ttccagaatg ggccaaggcc aagacccagc    151440
     ttaggggttt tgatctaaga aacgtagatg acattgagga tgccttctgc aaagcaagac    151500
     taagcaagga cacagaagcc gggcgtgaaa agtgcaagga agattttgaa gaagacaaag    151560
     agaattgcaa agatgatgaa aagaaaatga gggacctgat ggaaactgat gttagggagt    151620
     atattcttaa gaacaggatc gcgtggattg aaagaataaa aaggattatt gacgtaggcg    151680
     acatcattaa gatggtttgt agcaatgatg gatatatgga tgtatatcgc atgggacgga    151740
     gtgattctgt ggaaagaatt cctttagaga ggagaatcta tatgcaagtc aatgactgga    151800
     gatactttga caagtctgga gatatcgaga gagtggccgt gtactttcct gagaattccg    151860
     agacaactga agtggggact attagtataa aagaacatga gtttgtgaaa gactattcat    151920
     tgtacaggaa gtttctcagt cacttttcga taagaagagt ttttgaagac aagattccga    151980
     ttctgtacag taatttgaaa gaatgcgaag gacatgatgt cgagtttgta acagtgggca    152040
     gctttatttt ccttggaaaa cctgtttaca cagtgggaga agaagaattc cttgtatttt    152100
     ctgggaagga agggctctat gaccttggaa gatatcttct tagaaacttc ggaaagtgga    152160
     ggattggagt tatcggatcc agcgacccat gcaagaccga actccggaag atactgtgca    152220
     aatatcacat tcttgaaata caagttagga ggaatctgtc tttgaaggaa tattctgtaa    152280
     tgtgcaatga acagaaagag ttccacaagc agatggccag ggaagtggag ctggtgtgca    152340
     agctgagcaa gtatagccga attcccattt tcaatgtaaa cgaaaatgta atggatgttc    152400
     tattttatag ggagttaaag aaaaacagag ttgtatgcgg aagacaagaa tgtgaaatga    152460
     gctactcccc gcgtctgagg gcagagagtt tccggcctgg cctctacaag aaatacgtgg    152520
     ttgagataga gtgtattgga acattggtgc tttctattat tgaatacgag gcatttctgg    152580
     ggaaagacac cttatttaaa ggtgtggaaa ggaaagactt ccatatcctc agaagtcttc    152640
     tgaagcggat agtcctggac tcgatcaaag gagaagatgg agctaagctt ttactaagaa    152700
     atattggaag atggataagg agtgattcgg ccataatttg ctcggagttg aggagcattt    152760
     gctgcatgct gcagaaaaga tacatgatgc atctggccaa aaagctgaga gatgaaaagt    152820
     acgatgtgat ttgtgtggcg ggagatgtgg ttttgatcga cacagggaag acaagcgagg    152880
     aatcggcatt ggactttttt cagtatatct gcaagaaggg gctggagctc tgtggatacg    152940
     agatgatgaa gatgaaggct attagaatat tccaaagcct tgcatttgta gacccaagca    153000
     cctacttctt tcttgacagg ggagaatact tctgtttcag tgagagtaag gttcctacag    153060
     catttcttca ggcctatttt aatgaagaga aggtggattc ggagtttgtg tacagccttg    153120
     taaccaaaat tcctcttgag agctccaaga tggttttgaa actcctctcg ttcagacagg    153180
     actcgcaagc ccttctgtct aactgttata aactcttaca tttgagtgag tttgcagaga    153240
     aggaaagaaa agagatatat cttgacattg tgtgtccttc gtgtggaatg gaaagtgctt    153300
     tgagagccag atgtatcaag tgctacaatg catatccaaa aagcgctgtg ttagaagtgt    153360
     gtatggctta tgccaagcat cttctttggt tggaactttc aagggatcta tcctgcacca    153420
     tctgtgggaa atctaatgaa gcaaggctgt ctagtttttg taaatgcggt ggtgcgttcc    153480
     aaaagacaag ttatggaaat gagttggaga gcctaaggga aatagctggt agcccgattt    153540
     ttgacggttt ctacaggaga atctcaaagc atttcctgaa atgacttcct tttgggagtt    153600
     aagaaataga tctatcaacc catgcttttc gatgtgttcg gaaatcaaag tccttgaaag    153660
     gaacaatgag acacagatag acactcttct ctatgaccat acattggtac atataacttt    153720
     caacacaaag gaacacccgt tatcaccaag agacctttcg attaaccatt tgggaagaag    153780
     ttcaagcgga tctgttaaag tgtttgttaa ctcaaagaaa gtcgactttt cgtatgagct    153840
     tgtgttcgga tatgcgttaa gctgcattgg gattgaagaa tatgattgca aggtctattt    153900
     atttgacgat actgatgacc tgtgtgtgtt aaagaaccta atgtttgcaa tagacgagaa    153960
     gtttaaggcg ggccttcgtg tcttttcgga tcacagcaag acaacggtgt ctttaggcgg    154020
     aaagataatt tatgaaacaa ctatagtact ataatagtcg atgcatgatt cgaaacagca    154080
     tccgttaaat atacctccag ttctcagtat tttgacttat cgataataaa gtcgtcaaag    154140
     gaattatata ttttaacctt gttgtcatgg aggccaagta tcttatcaaa gcctctgaga    154200
     aggtcatggt catgcacaac cagaaacaca gtcttgtctt ccatcttttt gagtattgtt    154260
     tctacaagct ccttttccga gtctgcatcc aaattcgatg tcggctcatc caaaaccact    154320
     atgtcggaat ccttgaccat tgctctcata aagctaaccc tctgcttctg ccctccactc    154380
     aggaactttc cattttctcc cacaagggtt tgatatcctc taggaagctt gctgaatatc    154440
     tcatgcacat tgaaatgcac acatttcttc ataacatgat cgtattcaat ggaattgtaa    154500
     gagtagccta tgttttcaag aatggttcca ttgaacaaat gatggttttg aggaacaaac    154560
     gatatgaggc cccttacaga cgacttcctg atccttctca gctcaattcc atcaatgtaa    154620
     acttctccac tatagtcgag gaacctgagg agaacgttaa caagagatga cttcccgcat    154680
     ccattttttc caatgatccc tatcttctcg ccctttttga tttctccgct gaaaccttct    154740
     aatatgagtc tgtttcctat gtgcacagac atcccgttga accttatggt atcaccaaac    154800
     ctctctattg caagcccaag gtcttcttcc tcaagtgcat cctcaatctt cgagtcaaaa    154860
     atatctgtca aattctcatt cattacaaat gtgctttcct ttagcttcat tatcccactc    154920
     cgtagctcgg aaaagaactt ggagtactcg atgtatctgt tcccaattct catactctta    154980
     aacatatatc ctccaatgat catcaacacc ataaatgcat ttgggacaaa gagtaaactt    155040
     ttctggaaaa actcgacaaa tccattgatc tgatcatatc tcctcgagtg tcttccgaca    155100
     tcccgaaaag tgtcgatgta tttctgcagc tcgttttctt ctttattgta cgatttgatt    155160
     atgtcatagt tctgcagaat cccgtacagc ctgttggagg caaagttgta tgctccattg    155220
     tatttccttc tgaagtggtt tctaagaatt gttccatacc atgacacaac aacatatacc    155280
     agtatctgga taacagttag aatcacaaca cctgtagaac agcgggaaaa gtacaaaaac    155340
     ccccacagaa cataagatgc attgaaaaag atatcggcaa acaatatcct caagaaacta    155400
     accattccgt tggatctcct ctcaactaat gagtgtatct gtccagaccc aaggtgatgg    155460
     aaccgatggt agttggtcaa aagatactct ctcaagcagt gatggaacga cttccctata    155520
     agcagctgga tgacataggc cgaaacaagc ttgtagagaa gactcgacat gtaatgacta    155580
     atgggaagaa gcataaacgt gataagaagc ctgctggaat ctgtctcatc aattgtcttt    155640
     ctggcaatat attgctcgat ctttgttaac gacttttgaa attcaaagtg aaacttgctc    155700
     gagagcatta taaagaatac ggttgttaaa attcccaaga gaactgcctt gtccttgaca    155760
     agaaagtgta ttattagcga tatcatgtag gagtatcttc cagatacttt tttcttcatt    155820
     ttgggatggg tttgaacttc ttttatatgc aatgccggga aaagatggtt gaaagacttt    155880
     gatgctctcg cctctgccta atacagaaag gagatcaagc ctgagccaca tacaatgaga    155940
     tggacgctgg atttcatgaa ctagaaaaaa tcaccccaac atggatagaa gaggattaga    156000
     atcgtgtctt tatgaggtac tgaaatccga ttccacttca gggaagaggg ccgaggctaa    156060
     gatcctagag ctacagtcaa gcgattttga aaggtttata tcgatacttg tggaggtgtt    156120
     ctgcgacctg aaaagcaatg accagcttcg aatggtttct gggatcatcc ttaagaatag    156180
     ccttcatgca aatgatccgg atcttcagaa aggttgtttg agtaggtggc tggggatgag    156240
     gcctgaatcc agagaatata tcaagaacac gattaagaga gccctccggg ggcctactcc    156300
     aaggttttgt acaatggcag gggcggctct tgggcaaata tccaggatgg agattccaaa    156360
     cagtttatac caggggtttt ttgaagagat gaaaaggatg gtttgcgacg aagagacggc    156420
     gtgtggagtg tgcgaagctg taggaacatg ttgtagttat ctgacaaagg aagctccgga    156480
     catcctccga atgcataatg ctactgtgtt tgaaatatgc atacatcctc ttaagagagg    156540
     aactacgagg gaaagtaagc tgtcaggctt aaaatgccta atgaattgta tggaagtcga    156600
     agggatattc tgctatgagg agaatgtaaa catatttctt aattcgacca ttgaaatatg    156660
     gaacggtgat gacgaagaac tgatacacaa gttaatgatc tgctttaaca gacttgtgat    156720
     gctcaactat aagtttattc ggaagagcat attagagaat atacttggcc agtatctggg    156780
     aagattcttt aaatcgaagc atgacgaaat taagatccaa gcaattgagt actggtgtat    156840
     ttttgcagag aaaagagacg aagagatggc caacaagtac atgtctgttg ttcttcccga    156900
     aatactgagt cttcttaaga aaggtcccga ctattatgag gaaatatggt ccccgcataa    156960
     agctgcctcc tcctgccttg agatttacac agagttgaag ggagacaaga tgatgagaaa    157020
     cggaatgata tggggattta tagagacctc tctaaaatcg gagtcaaagg ctgatgtgga    157080
     cataggtgct gttgcactag gaagtgtaat gcatgagaaa tgtgaagatt gcttggtaaa    157140
     gattgtccca gaccttgttg ccggaatagg atttgaggag tcaaaggact cttgtctgtg    157200
     ggcattgtcc agaacggcag aatgtaactt ttatgcatta gtagatcatc ttcctatcat    157260
     tttgagcaga tgtggatcgg tagttcttga gagttccaag tcttcgattg gagcagcatg    157320
     ggcgatggat tgtatattcc gctctgtagc agacagcaag agaaaagagg gctttgccag    157380
     ccatatacca agctccacca agaagagggc agacgatttt gtcgaaagct tccttgtaaa    157440
     gcagtatctc gacattctca atgtattagt taagggaact gaactggcga acttaaatga    157500
     ttcaagccta agggttgcct tattttcggc tcttgatgaa ttgatcctca tatgtcctca    157560
     gactgtcttg gacatcctta ttgggtttta tgactataca tctaaaaaga tcgatgagtg    157620
     catcagtgtg ttgggatatg ccacacagga tcaactacta gtagttgagg atgtactttc    157680
     gaactacata ggacttattg aggcaatagc cacagcaaga aagagagagg atgtagagga    157740
     ccttctggag ctgttcataa gaatcctgga gtcaacaccg acaatagcct ttggggaagt    157800
     ttacacaagc atttcaaatc tctctacaaa atttgcaccg cacacgtctc gaatactgcc    157860
     ttacatgaca agggacatga ggtgcacaga ccgatttgtt ttaaattcag tgataaacct    157920
     tgttggaagg cttgcaaata caatggggac agactttaat atccttgcaa cggttcttac    157980
     atcatctctg gttcaatgtc tcagctcgga agccactcat agagatctta agcctataat    158040
     actgtctgta tttggagaca ttgctttggc gctggaaaga aacttcgaat catacctgga    158100
     tatggttgtt atgctattcc agcagatatc agagcttaac aggcatgggg acgaagaata    158160
     tgtggacgac cttcggaaga acgcagttca gcttgtgaac tgttctttgg tagccatcgg    158220
     ggacagttcc aaggttagaa atctcctccc cagaattatc agcatagccc acaaaatggg    158280
     cattgaggat ggaagtggca agacacatga agacatcctt ggccttatcg atgatcttgt    158340
     tggaatgtat ggaaagaact ttgggctgga cgagccatgg attaaggaat ttctgtacgg    158400
     aatgatgaag tccagtaacg acaggaatag aaagaaggct agccatgttc tggaggtgct    158460
     gagataatat atgatgaacc tgaattaaaa tgtttcattt aacttctaag ttgctttagg    158520
     gcagaagctt cggttctggg tctttctata tcttccaagt tcttgtttcg tgctatttag    158580
     gaaatcagac agtgtcgtca atatctctct caagcttttc gtttcttcct ctccaaactt    158640
     gcgcttcacc atactagaat ggagatgaaa ttttttaaag ctgcagctca tctcctcaag    158700
     tttactatat gcgaatctga agaactttgc atattctttc ttggcatctt cttccagcag    158760
     gttcagaagg cctaacttct ctgtatatat ctctatgaaa tggttaatct tttcacgtat    158820
     ctttggtagc tcttcgtttt tcagatcatg gagaggagaa agctcttcaa gcagatgttc    158880
     tactctaacg ccattggcct ccagtacatg gaacagaaac ggaaagagag atgtgttgtt    158940
     cttccctctg taattgctaa atacatataa gctggaaagc ttgaatccgt ttgccttttt    159000
     cctgctaata gaatatctga aattcattgt gtttccaatc tcaagaatag tccggaggac    159060
     gatccttagg ctttggctat ccaagatcct gttgcatacc tctagtagcc cgagaagagt    159120
     tttttctata agaaatattt catcgaaaaa ccttctttca aaaatcaata tctcaacaag    159180
     cttacggaca tctagaagct tcgaaaactc cagcatggct ttctcaacct ttccaaggga    159240
     ttcggggggt gtggatatca gatccatcac ctcttcctgc ccagggtaca tcttttcaat    159300
     gttcagcagg tcctgaagcc caagaggatt gtcgggtgtt ttgagtatag aatacacatt    159360
     ctccggagtt atgttccgaa gctcaaggtg cttcagtgag agggatgcca gaaatagtct    159420
     actttcctct attatgctcc ttttggtttc tttgctcgtt ttcttctgct ccgagaatgg    159480
     ctcgcagaat atctcttcaa acttctcgta atcgatgtca gtactgatcc cagaagtctc    159540
     actgaatatt gtttcctcag cccttgacaa tggaatccaa tgaaagggct tctttatgac    159600
     aacgtttggt tgtgcatcgc atttttcagc ctgtctcttc tttacaacaa tcttctttgg    159660
     ctttacctta tatctgttct ccactctaga aaatgaccct ataagctcta atggttttgg    159720
     gttcccattc tccatggtgt acagagcctt ccggtcgatg cctactcctc cacagacgcc    159780
     ttcaccggaa atctcttcca cctctgcatc cctgtgcttc ccccagcact tctccttgtt    159840
     ctcaaaaact atgtctgcat gcttgagagt cttggcttca aggatactag ctctgaagcc    159900
     ttttgcttct agagttctga cgagctccga ggtcttctct gaaaaatatc tcataaatgc    159960
     acagaacttt gctactattt cattctggcc ttcggagaca agtctttcgt aaatctcccg    160020
     gtcaggttct ccccagaaac cctcgtttag taaacggagt ccctgaataa gatcaacctt    160080
     atggatacac tgtggcttct gcacagcctt ccctgactca atcatcacaa gatcaattgt    160140
     aaattcctta tcaaacctat tctctggcaa aaagcactcc acatcgtcaa gagcaaacct    160200
     gtacaagccc tggcgataga aaagagtgtt gattctcaga agaaccattc ttttttcttc    160260
     ctcttcaagg tagtagtaca gaaaaacctg tatgtcttcg gatatgtcgc agtccacccc    160320
     actaaacact gcataatcct tgtctcgata gaccctatca tcatctccct ccttgattgc    160380
     acacaattct tccccttttt tcattatctt cattccaatt aggaaactct tagtagacgc    160440
     tgagggaatg gtggttacta tcagctgcct caagataaca gtgtgagcca attctccctt    160500
     tagagtgctt gccgagtcaa aatacttgat gtatctttta accgtattga tgttggatag    160560
     agatgatgca aaagcacctt caagacattt ctcccagatc agctccgttc ggtctgcaag    160620
     ctcacaatac cttaaaacac atcctaccag aaaccttagt ttgtcttcat ctccattttg    160680
     agtctcaaat gcagctatgt tgtttggatt aaattccaac cagcatctta cagcacacga    160740
     tattctgtag gcaagtccaa gatcgaagtc aagagacggt atcttctgga cattagggta    160800
     tttcttgagg ctttctccaa gactccaaac catgaatctg tctttgtaat tggtgttaag    160860
     aaattcaata agctctccgg tgttgtttct tcgtgttatg ctctctgtgg agttatccca    160920
     gcactgtcca aacaccagca cacgatggct gatcctccag acgttaaggt tggctccttg    160980
     tctccgatcc cctctctctt tcttgatata tacttccttg ctcccattgg acaaacttgt    161040
     agaacccacg catctgaaat ctcccccttc gctattcttc acaagagcct gaatcttctc    161100
     aagaatccta gagttgatcc ttgctccgtt cataagagtc tctccttcca ttcctggcag    161160
     acttgagctt gatgttataa aaaacatgaa acaggtctaa cggataggtt ctcttccgtt    161220
     tcatggcaaa acaagactgg aaaagacagg atagcttcca aaaacctctt tattttgaaa    161280
     aaagtcttac aatccatcct attaacagcc ccaaattaag agtaaacatt atatggaaga    161340
     aagggcccca tggagaagag agctctatct ccatgtctct atactcctca ttcgggtcgc    161400
     tcaacaagtt tgcaatcatg ctgaattcct ctattctcgt cacacacttc tctccattct    161460
     tttccttgaa tctggatatc attttctcct tcttctcaaa ctgctttagc aaaaaactat    161520
     cctcgtccat actgttgtta ttgggaatat agtccaaaaa gaacataaaa ttcacctttt    161580
     gtgacttgtt cactatcaca tcccagtaag aaaaggtgtc gttgggatac ttcacataag    161640
     ggtttcccat cattgtgatg tctataatcc cctccatgtc atcccgtatg ttctctctca    161700
     atatcttgaa ccctgtagtc ctggggatca aaacctcctc aggatcaaag ctccttccat    161760
     caatctctac atctgcctca gacgaccact tatgagattt aggatgggac aacttgtcta    161820
     tgtaggtccc ctctgggaaa ataagaagat catacttccc ttcgctccta agcctcgaag    161880
     ttccagatat gattagctcc ttgtccttgc ttatctttct gttcaaaaag ataaattgaa    161940
     aaaacttcat tccacgtcct agtagtggaa tgtccttcaa ggacatctta agaacaatgc    162000
     atatatcctt gaaccttcca aaacaatgca gcacacagca aacaaatagc cagtcatatt    162060
     ccgtcaagtg atttgaaata ataacatttc tgcttctctt gagaatggct ggattgtacc    162120
     tgataaacac ttttttgggg aagtatcctg aaaatactgc ccgtgtaaga tgaagccacg    162180
     taatctttgc cgatcttcta agagcacgtt tggcaacctt cccatagcac acaagccata    162240
     ccacagatac aaaggcaagc ccgacaatta tatatgaaaa atatactatc attgctacca    162300
     gaaagaatat ggcattccaa gcccttttca tcactctaat cgtgcaattt actctaaata    162360
     tttttttcta aacatgtttg aatcatgacg cctcaatcca gctttcaaaa gatctcaaaa    162420
     aggggtctga tggatactcc caaacatacc atcttcgtga atctctctta ggaatttcat    162480
     gatcttgagg agggaatcgt catccttttc tcctgtatat ggaggaatat gaatcccatt    162540
     gtggggctgg aactcatatg aatgggggct gtcgtcaacc agaatcacct cattcaaggg    162600
     ctttccaagc ttacacagat ccttaacata ttttccgtta acaagtgtac atgagtctct    162660
     gtatagagaa taggctattc tcttattcgc atcgataatg ccgatgactt tctcggcata    162720
     ttccttcttc gctgctgtga agataatcac ctcgtatata gccccaacaa tgcttataaa    162780
     ctcgacagca tggggcctga ccttcacata gatctgtaga ttctttttcc cagggacttc    162840
     cagacaaaag tcataaagtc tgggcttctt aaaagttgag tacaccagag tattgtcgag    162900
     atctagaacc actgttctcc ccaagtcgtt tttctgaggg gaaacaagtt gcataaactt    162960
     cttttctttg gattctcgtc ttgctttctc actgcctacc atggacatct ctttcctgtt    163020
     gcaacgacaa aaatttctta gagtcctaag aagccaggac attgatgtgg cgaggggtat    163080
     aagtcgcttt ccaattcctc cccgatgact gaaaaccctc tcgatgtaaa gtaccagtcc    163140
     atgcttgaaa atatccggga ctcgctcctt ccttcaagag aagatgttct agtattggtg    163200
     gaagaagttc gcaagatatt ggagtctgag ccaaacgtcc tgtatataga cacaccagtc    163260
     aatgttgttg gagatgtcca tggccagttt tacgatgtac taaatatgat gagcctaatg    163320
     gaagatccat ccgaaaaacc atatctgttc cttggagact atgttgatag aggatacaat    163380
     tccgtagatc ttatccttct cttgtttgta tacaaaaggc tttatagaaa taccttacat    163440
     cttttgaggg ggaaccatga aacacggatg ctttcctcgg tttacggatt caaggaagaa    163500
     tgtgtgcgca gatacgatct tgtggtgtac tggagaatct gtgaagcctt ccaatacctt    163560
     cccattgctg cagtggtctt gggaaaatac ttctgtgttc atggcgggct ggttcctgga    163620
     atgtctctgg actttctaat gaaacatgac aggatagggg agattacaga gataaacgat    163680
     attctctgga gcgatccaga tgaaaccctt gggtttcgga aaagccaaag aggggcagga    163740
     tatttatttg gagaggatgt tctaagaaac ttccttgatg aacatggtct gttccatttt    163800
     gttcggtctc accaactggt taatgatggt tataaagtat attttgatgg gaagttgtac    163860
     actgtgtggg gagccccgaa ctactgttat tcttctggta acattgcctg cgttatggct    163920
     attgatgaga acggccatga ttttagatta tttgatagat gcgaagaaca atttaaagaa    163980
     atcccggtga gatgtgattt ttttggaagt taaaaaggtg ttacttgggc atatccagta    164040
     gctcaccatg tctaggcagg cattccttca taaggtcaag caaagtctcg ttctccattg    164100
     cagcaaggac tctatctttg tcatctaact gcttgttaag tgccttgaag tttatatgtc    164160
     cgtcgtttac tatgtggact tgaataaaat gattttctat gtattggttt atctgtgcct    164220
     ttatgcacag ccctattatt gctgccatag agcagtgcgg tatggttggc ttgaacatta    164280
     cttttatata cttaattggg agtccggcac taggtgcaat tccatcggaa tcaatgagtc    164340
     caatggttat tccctctctt gacaccactc caagctgttc caaggtataa gaatgttcgg    164400
     gatctcttat gtccctgata agctcgaaca cactgtattg tgtaatctct tggagtattc    164460
     catcggatat atcaatggga taccttctct cgagtgagct tgaaacaaac ggagacttgt    164520
     tcatggcagg ggtttctaat cgctcaaaat gcgttagaaa aaaacttcaa aagaaacttt    164580
     aataaaccaa tgcttctccc tttgttttct tctctccgcc aaatatcacg tgcttggccc    164640
     tcttcagagg cttttggtgg gaaaacttgc acttggtaca ctccaacttc aaaacaagct    164700
     tcttggtgac tttggccttt cttcggagaa tcggctttgt ctgaccacca taaccccgtt    164760
     gcttcctagc atatctccta tttccctggg ctctaggatt gtctttggac ttcttggcct    164820
     gagaaacctt gtgtggagag tagccgctac acttcttaca aaatgtattt cttgtcttcg    164880
     gaatattcac catctttcca agggcaggct caacgaaagc aattttttca tagagtgcaa    164940
     gtcttagaaa cgaggtataa gagaattatt tcaaagccaa ctaagcatgc ttcggacatg    165000
     cggcaaagta tagaaatata agcatccggc cgtgcccata aaatgtccac cccggcaaag    165060
     cggagactga tgaaagactt aaaaagagta aagaaaaact catgtaaaac aatatttgca    165120
     gagccattgg aagatgatct gatgacatgg gctgctgtga tctttgggcc cgagtcgact    165180
     ccctttgaag ggggaacatt cagtctggtc ctagcatttc cagaaacgta tccccaggat    165240
     cctccaaacg tgagatttgt ctcagatatg ttccacccaa acatttatcc caatggagaa    165300
     ctctgtttgg acatccttag taaccgctgg agcccaagct atgatgtgat ggggatcctt    165360
     atatcaatcc agtctctcct gaatgatcca aacactgcat ctcctgccaa cacagaggct    165420
     gcaaacctct tctcgataga cccacacttg tatgctgaaa aagtgaggaa ttccgttata    165480
     aaaagctgga tggatgtaga aaaccttaga gataaatacg gaagtcctca gtaagcttcc    165540
     atttaacaaa tttactatta aattaaagat actcagatga tatctctgat atgccactgt    165600
     ctatgctttg atgggatctg tgtccttggt ctccttacaa tacttggcca gtgcagagat    165660
     aagatggttg atatgcttct ggatgtcgga gtttgttctc gacagaaggt aataatcaaa    165720
     tttgtactcc ggtaacttca agatgtcctt tcgtatacat tccacccagt taggatgatc    165780
     aatgtatttt ctgtaaagat ctatcaagag agggttgtaa tccccaagtc ttgatcgagt    165840
     cttccccaat ttcgcactaa tgctatcgaa atccccttct atcatctccc tgatcttaga    165900
     tctcctttcc attttcttct ggcttttctc aatggaactt attatcttct cagcatctcg    165960
     tagctcattc accctctccc aaaaaacctt atgatatgcc tccacatcat tcttatgctt    166020
     cataagcatg gcaatcttag aaacatcatc ctttccaacc ttctccatag cctttacata    166080
     cgattggaag tccttctttg tccaatcaaa cccctgggat tgaagctcct tcttcctggc    166140
     tacctcatct ggagaaaggc tttttccctc ctcgtagagc ttaatctcct tttcctggat    166200
     ctccataagc tcccgaggat aaaattgata ttcgggatat tcaataatcc ggggcctcgt    166260
     gcggaagaga acgcttgttc gtgaagatct cccataagca tcctgattgc tctcaataaa    166320
     attctcgatc ttcttgatgt tgtagtcctc tccctcccag gtgtaacaat caatgtttgt    166380
     gttcaacgta tcgcttatct tgaaatcaca tagcttcata ttcatttccc gtgtcttttc    166440
     ctctcctctt ctaatcaagt cttcgatatt ctcgtccttc tcctcatctt ctgtaatttc    166500
     cattccattt gctagtatgt cgatcagctc cgattgacta accccagagc ttttgtagca    166560
     tcgtccttga agcagaatat catccagctt gagcttctgc aatgacctat agacaattct    166620
     ttcctccaca gtgttttcac ttatcagtcg gaagaccaca acctgctttt tctgccctat    166680
     tctatgggcc ctgtcctgtg cttggaggtc catctgtgga ttccagtccg agtcaaacag    166740
     aatcaccgtg tctgccgtcg acagattgat tccaagtcct cctgctcttg tagtcaagag    166800
     aaatataaac ttctcgcttc cctctgcatt gaatgcatct atcgcttctg tcctgtcttt    166860
     gtacgacgta gacccgtcaa ttcgacagta ttcatactcc ttgaacatgg catagtcctc    166920
     aagtatgtcc agcatcatcg acatctggct aaaaataaga acccgtgacc ctctagcccg    166980
     gaggctctcc agcagcttgt caagcactat catttttcca gaattctcga ttatatgctt    167040
     gtcattcgta tagggttctg gctctgcatc tggaaacagg tacgggtggt tgcagcactt    167100
     ccggagctgc attacaacat tcataagcat ccccttcggg tctctcgtgc ttccaagcgg    167160
     cgacaaatcc ctcttcaaaa gcatcttata ccattcccgc tgcataggac ttagcttcga    167220
     atacaagttt ataatcttct ttggaattaa tcctttttca acatcaattt tctctcttct    167280
     taggaaaaac agctgcagaa catttctgat ccttttaatg gcttccccat cctcttcttc    167340
     tatgctcatc acatagtttt caaatttctc ggcatcgttg aagatttccg gaactataaa    167400
     gtttagcagt gcccatagct cgtgcacatt attctggaga ggtgttccgg taataagaag    167460
     acgatggtca caagagaaaa tccgtactat cttactaaga agactatgct cgttctttat    167520
     cctgtgtgct tcatcgataa ttatatatga ccagttgacc ttgctcagaa tgttctttgc    167580
     atttatacac atctcatacg tagtcaagca agcatcccat ttcgaggaca taatctcttc    167640
     tgcctctctc ttcatctctt tccgagagga gtagaatatt cgggctttgt aatttggcat    167700
     gaacttccgg aactccctct tccagtttgc aagtgtagac tttggaagca caattaaatg    167760
     tctcttccgt tctttcttta catatcggat gtatcctaga aacgctattg tttgaagtgt    167820
     ctttcccaag cccatctcat cagctagtat acaatttatg gaattttcat gcatattgat    167880
     caaccaattc aatccttcaa tctgataatc tttaagttca tgaataataa atttagggct    167940
     actaataaat gtatacggct caataggctc gtcatctccc ttcatcacat cttcatagtt    168000
     gggtataaac gcccggaaaa actcattgtc cccgataaaa cttttatact tccttaagag    168060
     ttttacattc atctaagggt ctttctttct catttttttt gctaaacttc catataagga    168120
     aatacttctc ttactcaaat tgcatattaa ggtatttgat gatatcttcg gattttgtct    168180
     ttcccaggcc cggaatcttt tccatctcct cagaagactt cccgaagaat ctcagaagcg    168240
     ttccattgta tttaagtatc tgctgggcat tgctcttgtt cacttttgga aaggctgtca    168300
     gaaatccctc ttcatcatgg cttccccttc ttattgcttc aatcgacctc tttcctgctt    168360
     catcaaatcc ccggatatat cgagagcatt cgtctatgct gaaccccaat accatggtta    168420
     gtgaggttgt atcgaagagc tcttgaatag ttttgctata gttgggaata tctacatgca    168480
     ctaataatac cttcacctta tatggcttaa gcttattgat cctcttatgg atgtattcgg    168540
     gtttgcagct atgaaaccga agagatagga acagtaaagc ggtagatctg tttatctcgt    168600
     aatcgggcgt tatagaattg tcgtagtgcc aggatgcatt tgaaagatag ttcagaacat    168660
     tgtttccttt ctgtaatgga gaaactttta tcatcgatgg gataaactct gttctttcta    168720
     ttatgaaaaa agctgttgac atcaggagtt taatgttatg aatttttttc aagtaattct    168780
     tccatgttta tgtatctatt ctgggacacc attgtcttta tcttagaaac aagactggct    168840
     atctctatga aagccatggg atcttctcgg gtttttccaa cccatatgta tccgttacat    168900
     cccacaataa ccttgatgtt accatgaagg aggaacctcg ttctgagggg ctcaagtaga    168960
     aagtggggcg caaacaccaa gagaccttgg cccaacttcc catacatgtc atttcttgta    169020
     tgtaatgcaa tcgtaccgtt tcggttgact ttctgaactt ccgatacaac tagatcgttg    169080
     atgtcgaaaa agtccctcat ggacatctca tccgattctt gtttccgccg ttgaactgtc    169140
     cccggaaggt tgatggctga cagccctaga taagcatctc ctctactgct caactcaacc    169200
     ttccacttct tgttgtggat cccaataacc ctccccacaa caacattgcc aacctctgga    169260
     ttgtacttca tggaagaaat aggatcgatg gagacgagct tgtttgtgat cttcaccctt    169320
     ccaaagtagg ttgatgctat attgcttcct ctaagctgtg ttccatgccc tcttatatac    169380
     ccatcggact ctagaacgtc ttccccggga agaaacaaag tcttcattag ggtaccgttt    169440
     ctgcggcaaa aaaccattta gatcgtcgga aataccgtat ttagtcaggc cccaggatga    169500
     atgttgttcc tcttggggct gggcaagacg ttggccgatc ttgcatcctt gtcactatca    169560
     acggcaggac agtaatgttc gactgtggaa tgcacatggg gtttaacgac gaacgtagat    169620
     ttccggactt ttcatatatt tcgaagacaa agaacttcga caaagtaata gactgcataa    169680
     taatctccca cttccatcta gatcactgtg gagctctccc atacttcaca gaggtctgtg    169740
     gctatagcgg gccgatttac atgaccctac cgacaaagga agtatgtcct gttctcctgg    169800
     acgacttccg aaaaatagtt ggcggaaagg gagatagcat cttctcatac caagatataa    169860
     gcaactgtat gaagaaagtg gttaccatca gcatgaacga gacatacaag catgacgaga    169920
     acttctacat cactccatac tatgcaggac atgttctagg ggctgcaatg ttccatgttt    169980
     ctgttggaga ccagtctgtg gtgtacacag gtgattatag tacaacaccc gacaagcatc    170040
     tagggcctgc ttcaatcaag tgcataagac cagacctcct gatcaccgaa tctacatatg    170100
     gatcaataac tagagactgc agaagagtaa aggaaagaga atttctgaag gctgtttccg    170160
     actgcatagc aagaggaggt cgtgtcctaa ttcctatatt tgcactagga agggctcaag    170220
     agctttgcct gcttctggac ggatactggg aaaggacagg gcttgagatt ccggtgtatt    170280
     tctccagtgg cttgactgaa aaagcaaacg agatatacaa gaaattcatc ggttacacaa    170340
     atgaaactgt taagaggaaa atcttcgaaa gaaatgtatt tgagtacaag cacataaaac    170400
     ccttccaaag gtactacatg gataacaaag gccctatggt cttgtttgca tctcctggaa    170460
     tgcttcattc tggaatgtct ctcaggatat ttaaagagtg gtgtgaggac gaaaagaatc    170520
     ttgtgataat acctgggtac tgtgttagag gaacgattgg agaaaagatt ctgaacgggg    170580
     caaagaggtt ggagattctt ggagaggaga aggatataaa actggaaatc aagaatttag    170640
     gattcagtgc ccatgcagat gcacaaggga ttctaagtgt gatagagcaa tgcgccccaa    170700
     ggaatgtgat gcttgttcat ggagaaaggt ctcggatgaa gcaactcaag aaaagcgttg    170760
     aggagaggtt tgggatcccg acatttctcc caccaaacgg aacacttata aacattccat    170820
     cgaaaaacat cgtcaacctg aaaataagga aagggcatct ctccagtcat ttcaagccaa    170880
     atttatcgaa ggggaagatt tctttaagaa tgagtctctc ctcaaaaaaa gaagaaaacc    170940
     atattgatgt tgtagattgc gaagattaca tagaggatga tggctaggca actggtattt    171000
     aggagtttta gtggtttgcc agttgttggg gctcgggagg gatctaaaac acttggtttg    171060
     aaagtggttt gaaacagaaa gtcatataag ttgtgaagac ggtggatact aatggaaaaa    171120
     gaagatttta gatggtttga aggagatgga gaaacagagg cagaagaatt tgtccccgct    171180
     ccaaataggg tttcctctgt aagttatgtg atagatgcaa taggagggat attctattct    171240
     atttttgttc tctccttggt tgcaagggtt actacatatg tctttggcct caaactgctt    171300
     gtgttttctg ttgacctcaa tgttgtgttc ctgagcataa ctgtcgtatc tttactgttc    171360
     atagttcttg caatagcacg ggagacaatg actttcatgg ccttgactct cggaatggtt    171420
     gagaactcgg atgcctgtgc aaagctgcaa aggcttgtga tggtttcggt ctggtttgga    171480
     ttgagtgcat actggattaa gtatgtagga acggcctacg gacacaattt ttatatcata    171540
     aagaaagtgt ttatgtccgg gatgataacg tctgcagcat actctattgt aacaattgca    171600
     atggcgtact tcgagagttt tttcctaaag aagactctca aaaggaagtt agatgatgtt    171660
     caaaagactg aaagaatagt atatgcaatg aaaaactaca ggtatgatat ttccgaatca    171720
     ggaggagggc cgaccccaga gtgtacgtgc agggatctct tttgttttag aactgcagcc    171780
     acggttggaa gtagggaaac aggacgaaac ggcggagaag aaggattcca tatgtttacc    171840
     ggggggcttc tgattaatgc gcctgaaatc cgtggaatca tggatgccaa gacccttgca    171900
     agggatgttt tcttcaaggc tagtggagga aaggatgttc tttcatatga agacttcagt    171960
     gcaatattcc caggggcaca ggatgcccaa aatgcattct ctttctttga ttcgaaccat    172020
     agcaaggtga tttcaaagaa agagttccat gacacaacta tatacttcta catggaaaga    172080
     gtgaatctcg agaaggccat aatgagagca gaagatttca ttggaataat tctaggtact    172140
     cttaatgtga ttacgggagt agttctctgc tttgtctatc ttatgatctt tggggttccg    172200
     cttcaagagc tatttgcact gatacttagt ggatctcttg cctttagctt tattgcaagt    172260
     ggaatagcca ctgatatgta tcacaatttc atgatgcttg ccagccatcc gtttgatata    172320
     ggcgatgacg ttataattga tggagccgac tatagaatct atgagtttgg acttacaagc    172380
     acgtccctta ttggagagaa cggagggaaa gttaagcttc tgaacagcga tctccggaaa    172440
     aagaaccttg tcaacatgac aagagcacct gaaaagatta ttgtattcaa ctttgatctg    172500
     aatccagaca taaggcctga ggagtttaaa aggttcaaga gcataataca tgagtttata    172560
     aaacaaaagc cgtttgacta tgacaacgaa ttttccctcc aagcttccac agaaaacttt    172620
     gtaagcattg atgttctaag ctgtacaatg atcctgaagt gcaagagcta taagaataag    172680
     tcaaaaaagt ttcttctccg agttgagatg acttcgtttc taaggtcgct aatagcagag    172740
     atgggtattg gagtgaaata agttcggaat gcgaggtggt aataaattat catggtattt    172800
     attttaagag ccttgttttg agaatatgct tgtcactgtt ttttcatgga atgtaaacaa    172860
     cagagaaggt gttgcagatg ctattcccga aattcttggg gatcagaagt ctgacatgat    172920
     acttatatcc ctacaagaac acttcgactc ccagagtact gtggcgaagt ctattcagaa    172980
     gatgtatcca tcctacagaa tgatctcggt tgacaggatg tttgggctgt tgtcaatagt    173040
     attatctaag gagagacaca cagtggagag aataaagatg gggtttggga ttctaggttt    173100
     cattaacaag ggagtatgtg tgactaaaat atcgaatggg ataatgttca taagctgtca    173160
     tctatctgcg catcaggaga acaacaaaaa gagattgaaa gaaattagaa gaatatttga    173220
     gtgtgtttgt gactcggagt cggtgagaaa tgtcaaaact gttattttgg ctggggacat    173280
     gaacttcagg attgcaggag gttcaagaag tctcgactac ctcaagtctg gaaaagacga    173340
     tcaatgcaac gagtttaaga gagcctatcc gatgttccta gagggaatga tagatttcaa    173400
     gccaacttac aaatatattg caggaaccga cgaactgtgt aaaaagagac atccatcgtg    173460
     gtgtgataga gtatttgtct cgtcctcata tgtaaagttt aatacatacg actctgctta    173520
     tgaagtgaag ataagtgatc acaagcctat tctctgtgca ctggaagtga gtgataagaa    173580
     gacaagccgt gctgccattc caatgatcgg atatagtggg caccatgtca tacgtgggct    173640
     tacaagattt tattgcattg tgcacgagta tcgcaatgca gtttctgcac ttctcttgat    173700
     aataatgctg tatttgatgc tttccagatt taaaaccatt tcgaggctca gaaatccatt    173760
     ccgggtcttt tatccggagg cagattgttg ataaaggtgt tcttgtattt tcgattcttc    173820
     aaaagccccc aatggaggaa agatttgagt ggagatggat gggatcccct cttgaggaaa    173880
     agctgcatga atatatccgg agcatggttg aagaggaaga ccttgactgt cttgctaaga    173940
     agatcactgc ctactttgac atatggccat tcaaagaatt ttcccttaga tgctggagaa    174000
     tactcagcga caaactcatt gatatcattt cctcactgga gaagaaatac ttttccgagg    174060
     gaatacaaat gttcaaaatg tctgaggaag ataaaagcct tcttattgga attttcaagc    174120
     tctttcaaag gatatttggg tattcaagac aaagacatcc tctcgatgtt tctacacaag    174180
     ttatgaagtt catatatgca atggatctag atgttgtgat tgaagcacat aagatgcttg    174240
     tgttctgcct taattattcg attgggctgg atgagttttc tgatgaccat gacattctgt    174300
     tcaaatgcct aggaatcaac tcggagttaa atggagagaa gatccttagt ctctcggaga    174360
     aggcctttgt gagtataccc aaggatctag aaggagaaga tgtgttttgg actcttaaga    174420
     agaatgtaga tgagtatgga agagggaatc ttgtgtttga acttcggcaa agaataaata    174480
     atgaaaacag agatggcctg aatgtgttga aggtccttgg aacatgtata tttctgatcc    174540
     ttgcaaaggg agaaggagct tttgatgaaa ttgtggaaaa aatagacttt ggagaaattt    174600
     ggagatttgc aggcgaggaa ttatccgaaa acatggaatt tgccatcatg aaccttctgg    174660
     acatattgat ctatgacgaa tttgactttg gaaggatctc acgaatcctt gaactaagca    174720
     acaccaaagg atttttctac aaaagatttg taaatggatt tgatgagtgg acgtttgaaa    174780
     gacacatggt gtttcttatt tacaacacac tcgtgggaag ccaaaaaacg aagtacctca    174840
     agatgaatgt ccttatggaa gtacttccga aatttcatga atgctcgcca gatgttcgat    174900
     atcactttct tcgtacagtt agaatgcatt gtaaggaaac caattcccgt ggaactgccg    174960
     agtttatttc cagaaacggc gtagggattt taacagaata ccttagacat gcagaaaaat    175020
     acgatgtaaa tgaaaatgta aatctcaaat attcgttgaa gatactaagt gagatctaca    175080
     tggacgaaag gaacagagga gtggtgggga atttcgaaga cagtcctttt cttgatgtaa    175140
     ttgttgcaac tatccaaaag ctttgccttt ttgattcccg tattgtatct gtttgtatag    175200
     gaatactatc ttccttcatg tttgaagagc cgctgaatct gcccatattc atggaaagag    175260
     gagtgaatgt agttctgaag acacaactat ctgttgagca tactctggaa tatgtttctg    175320
     catttgtttc ttatattgat gcattttcct tgaacctctc ctttcagaag gagatatctc    175380
     atggggaata tctctttaag cttctagtac tatgcagaga ggaagagttc cttggttcaa    175440
     tgagcaatac aaacaagatg gtatcccttc tgaatgtcct cataatgcat catccgatat    175500
     tcaaggagga catcttaaag ttctacaggt ttgagattgg gtatctgaaa aatctttttt    175560
     cggaggagtc aagcagtctt cttgtagaaa aggagtactg catcgaaatc ttcaacaact    175620
     ttttcagtct tgtggaaaaa atggaggttt atcccgaaga gaaagacgcc gacggattct    175680
     ttaacaatgt atttgatctg gttaccaatc cggcgtattc ttgcaacatg caaaacttct    175740
     tcaagggatc ttttggagag gtctaccgaa cgatctatag agaatcccgc acatctcttg    175800
     ataagccgtt tgagcagttg atatccgaca caatgaagat catagagctt agtagaatga    175860
     gcgaagaaca ggatacaaga gattggaaaa aagccatgaa aatggagcag tggtgcgggg    175920
     cagaggctga tgaactgata ttttcttatg aaagtcagat ttccttggcc tgcattcttt    175980
     gcgaagattt tatggagcta atagataatg gggtaaagac aagactgttt aaagcaatgg    176040
     cagacctgta tcttatgctc atccgattct cgggagcctt tatttcgatc agcaactttg    176100
     aagagcacag gtttttatct acatacagat ctataagact caagcttgaa gaaagcacca    176160
     caaaggaaag catccgattg catttgctgc agtctgtgta tctttgtaac ctgtttctac    176220
     tccagagaat gtaccttttg gagatcaagg attcatttga caagactctt gaacttgttg    176280
     agaggctggt ggaagtaatg gctcttgaag gagatgactc gattaccctt ggactaagag    176340
     cgatagagag gctgagcaag aactttggga aagagcacta tgaagcaata tctagagaat    176400
     ggtttataaa gagcttgctt aaaccccact ctagaagcga caggttaatt gcagttataa    176460
     acttcctttc gtcccaatta tcatccaaaa taaatagcga tccgaagcta aggagtatgc    176520
     ttctggagta tctggaagaa atagacatca gcgtctcctc ggatctccgt aaagttgagc    176580
     taagtaatat ggtcattgag gccattggga gaatatttgg agatggaggg tcgctttcag    176640
     atgacgaaat ggaaatgatt ttcagaattt atgagaggtt ttatatatct ccattgtgtt    176700
     cgaggctgat gattaagaga atgataagac taccaagatt tacaatgaga ctggttcgga    176760
     taaaagcatt tccgacattc caatatttcc ttatgaaaga tgagaaagtg tatgagcatg    176820
     catgctttat tgtaaataga ttctttgagt attctgacga attcattgaa atggctagta    176880
     atgttcttct gtttggaacg gttgggcgat gtcctcatag gatagatatc aaagagatcg    176940
     gaaagaagat ttcaggactt gttatgtctg aagtttcgtc gccaaaggta ctgtttttcc    177000
     taattatgta ctttcggctg cttcatcggt tggggatgcc cagacattgt ggatttgatc    177060
     ttggaaagtt gatttcacga gttaaaacat gtgacgagat gactttgatg agaatactca    177120
     tcagctacat aataaccccg gatatcgata gtattttgga aaggtctgga attccctcaa    177180
     gaaggattag gagcaaggat agagaattct taaagtccca tgatttcctt atatacagag    177240
     actatgatct ttttgttgag aaatgtctaa agaagtcggg tcttggacct atagatggga    177300
     tctgcttcaa acatggatgc aataggactt tctctctaaa gggagaagag atatctgtat    177360
     cggacaagga aatcgactgc agcaagactt tcattagaaa gctcgttctt ttgctggata    177420
     cccaagaata tttcggaatg gtaattcagc ttctctgcga aatgatgttt aaccatccat    177480
     ctcttttgca cgatatatgt agatatcagg ttttggacat tgtgtatgaa agatgcatta    177540
     gaaaaatgga tgtatcaagc aagcacaagg tgactggaga actgcattgg ggtataatgc    177600
     tgtttgtcat tggactctat tcggaggttc ttttgtcgaa gtccagcaca ggttctgaga    177660
     agaaaagcga gactgagcaa gaaaacacaa gaaagagtct tccatctgta tctgactttc    177720
     tccttgaaaa gatcaaagat ggatccaatg aggactttct gaacgtgtcg ttcatacttg    177780
     ttagaagcct cacaccattg tttattctaa ggcacgaaga tgaagaagat acaaccatgg    177840
     agaggttccg agagatttcg atttttatgg gatcagtagg gatctttgag aagattatca    177900
     agagaataat tgctgttgat gaaagcgacc caaaatacat aacatgcatc caatgttcgc    177960
     tggactatct tggaagggtt tttaggcatt gctacggcga cattcttcaa gatctggacg    178020
     actatggtga cgacgaatcc cgtgagattg aatactatag tctcgtttcc gaggaccatg    178080
     gatttgagga aagtattttt gactccgacg agagctattt ttttgatgat ccaccattcc    178140
     atgaaattga agaggagagg gccatggagt ctgatgaagc ggaaagctcc tcacaatcgg    178200
     aaaatacagt gttcatcaaa agcattgaaa acgatcatga gatgccaacg gaaatgtatc    178260
     tgattagctc cgagtattac aatatttctg cagaaagtag aaccgagatc gaggctctta    178320
     tgtgcagaaa gctctacgtc gacttaattg atagcagcac aagctgctat acctggatgg    178380
     ttaataattt ccaaaagagt atagtttgtg agctaaggga gccgagtgtt cattgtaagg    178440
     agcctgagag gtctttgaat gaagatgaca aggatgaggg ctatgtcact gatggtgagg    178500
     aaaagatgat atggaatttc gaaccaacaa acgatgaaga taatctggaa gatacaaatg    178560
     aagccttgga cacttcaaat ccaccagata gagaggagat agaagaggag aatgaggacg    178620
     ttggatcctc ggaatctgat gtcgggtctc agaacggaga gattccgact cttgaccctg    178680
     ataatctcaa cagaatggag gaagacgagc taaacgaagt tctgaaagcc tatttcgacg    178740
     agagacgatc cctatcgctg acttatatac ctctccacac gggtttctat gaaaggcttt    178800
     cttcccgtgt aagacctatg tttgaggaga tggaaagagt gtatagagag agtttcttct    178860
     acgacattag aaccgagtct accaaggaga gtgacgaaga aatcatggaa accaaagaga    178920
     atctccttga gatggatctt tcaacatttg aagaattcat caagaaatct atcgtcgaaa    178980
     aggatttccc atttgccaag agctggaagt tagttgatgc actttccaag gatacaaaaa    179040
     tgaagagtgt tgtcttcaaa gtatccaaca gcatgatctc gtcaatttca tcatctcagg    179100
     aaggagacct taataattac gacgcagtga aattccgaag aactttgtgc tttcttctta    179160
     gcatcgttaa aagctcaata aggtactatg gctatttccg agaaaaccct gaaattgtaa    179220
     gaaaagtttt tattcttctt ggaaaggtga aattaaccaa tgatcttttg agactagtga    179280
     ctgacttcag tgttatcttt aggaaggaca aggactttgt ctttggccaa gacatcgatt    179340
     tggaaaatat tctcggttgc tttggaagaa tggttgactc tgaatgcttc aaccttcttg    179400
     aggagttcat ggagaacacc gccgaccact ttggcccgag attcctagat attattctgg    179460
     tagagataaa gcagcaattt tcgatcctct ccaaagacat tggaaaggag tttccttccg    179520
     atgcatttct agaaagtcaa aagatatttt tgagactttg gaagatgatg acaaaagtta    179580
     taggaagaag caatttgtgt agtgaggaaa gagacattgc acttctgagt ctgatgctga    179640
     atcctctctg gaatgtgttt tttgaaaatc agaagaacaa ggaatcgatt gaagacctca    179700
     ttaatgtatc ggatatctac gaagcttttt ttgttgttgg aaaggtgttt gaaaataggt    179760
     tcggggaaac agagaataca ggttgcgcag agatgtgcaa caagttccaa acattctata    179820
     aaaagattat agagttacgg gccaagcaga ttaacttact tgccgatgaa agaccagaaa    179880
     agcttttcag aaacttcaac agcctcataa gtcattcaat actaacgttc agtaacaaaa    179940
     agaaatatct gtcaagaatg ctctctgtgg aaggagtgga taaatcctcg tctttctaca    180000
     gagtttatgt agataggaac gatgttctga ggagttctta ttttcaagtg atggcaaaaa    180060
     gtcctgaaga attcagaaca agaagactcg agataaagct aactggagaa gaaggcttgg    180120
     actatggagg attgacaaga gaatggctgg ttcttctctc aaaggatttt cttgatccta    180180
     actttgctct ttttgagttt tccaccgagg acaagacagt agctgttcca tgcaagaaca    180240
     gttatgttaa tcccgagcac ttgtcttact tcaagtttgt cgggcgtatc atggcaaagg    180300
     ttataatgga tggaaacttc atcaacttgt atctaccgaa gtttatctac aagcatatcc    180360
     ttgggaagag ttgcgatcta caggacctag aatctgcaga ccctgaattc cacaaatcgc    180420
     ttgtctggat aagagataat tctgttggga aatctctagg actaacattt tcgttcgatg    180480
     acgtgagctt tggagttcat agaactgtcg aattagtaaa aggaggagca aatatctttg    180540
     tggatgactc gaacaaggaa gaatatataa agttggcgac acaatacagg ctatttgatg    180600
     gagtcgaact tcaattatct gcactaaagt caggactgtt tgaaatactt ggaaatagag    180660
     ctcttgagat gtttgacgag aatgaacttg agcttctaat ctgtggaatt cctgatatag    180720
     acattgatga ctggaagagt aatacccttt attatggata tacagagagc tcaaagaccg    180780
     ttatttggtt ttggaaagca gttaaaagct ttgactctgt caacagggca agacttctac    180840
     aatttgtgac tggaacatcc accttgccgt ttgaagggtt ctcgcattta caaggaaaca    180900
     atgagatcca aaagttctcg atccataaga tctctgacag aacagacagc cttcccactg    180960
     cgcatacatg ctttaaccaa cttgtacttc cagagtattc ctcctatgaa agccttctga    181020
     aatatttgat gttggccatc aatgaatgct ctacaggatt tggttttatc taaagtaaaa    181080
     atattcgaca tggtttattt ggagtcttga tacagcttcg agatactttc cttcagtttc    181140
     tctgtatttc ctgtgtattt cttatctttt aaggcatcat tgacaagatt ttggatgtcg    181200
     gcagctagtt tttccccaag ctctgtagga aggcgatacc tgctctgatt ttcgatgttt    181260
     ttgtcaagaa agaaggtgat gtcttcttct gttctcttgg atatctcctt tttccacaca    181320
     tttaagatat cttcgacgtt tatctcgatc atcttctcta tggggattcc ctcaagactt    181380
     ttcaggtagt tccggaatat atagatattg tttacaacgt atacagactt cggaatccct    181440
     cttagggttt ctgccagaaa taggattttc tccatggtct tggtactgaa tttttcgaaa    181500
     atgtcctgga cagtttccag ttcaaaatcc tttccatact cagatgcaaa tacttttgaa    181560
     acatctttgt tgtcgtagaa ggcttctagt gctttttcca tcttcataca tagctcctca    181620
     gtgttacagt acttgtttgg ttccattatc atgtccaggt cttcaaagta ttttagaatg    181680
     ctattacaca tgatcttgtg tatgctgtct ttaaacacaa aaagttcctc tactactcgg    181740
     attctcttgt ccccggaata cttgagttgg ctgtccagaa ttattagaag gccgatgttt    181800
     gcaatgtcct cttccttctc cattttcagt agattgtctg caattgctct tttgagccca    181860
     atcacaaaca tcttcagcag tccaatgttt gtaatcttgg aattttcctt tccaagcaca    181920
     ttgtcattca tttcaattac atccagcaga aacttatcca gatgagaagt tctctcgatg    181980
     agaagttcag tgttcattcc tatgtcatca aaccccaatg tagaatagac cgtgtctgta    182040
     tacttgctga taaatcttct ttcgttacca ttggaaagaa gaaaggttgc aaacactcgg    182100
     aactcaggct tgtactcagg aactcttttc aaagaaacaa agaaggattc ttcaatcccg    182160
     tcgattgctc ttttgacaaa atcatctaga atatcaatct cggtgtctac aatcttaaca    182220
     cccttgtatt ccttgagtac ctcgcccatg tcgataagcc tccgtgttga ctctattgcc    182280
     ttcttttctt ggagcagttt caagtccctt ggaaggaatc ttttctcgga ttccccaaaa    182340
     acctcgccta gcttggactt ttcctcctct ataatctcct ttgtcgacat aaatgaatcc    182400
     agaaatgtta agagcctact aatgtttttc tttgggttga tgtaaggtct aaatccgtcc    182460
     acagcactta attggagtct ttccattaaa gaactcagtg tgtttgcctg agactctatt    182520
     tctctcgaaa gctcagcgca tttcttaagc tttggcagga tgcttgggat ctccggcatc    182580
     atggggctat tggtctaaca attcagaagt ttgacgtcct ttagaatgat tggtgctgga    182640
     gagacaagtg ccaatcacgg catagattgc tttattatta ctttgagttt caatccccaa    182700
     caatggttga cttcggtgct tccaagaaga cattgctgac aggattcata ttgatggcat    182760
     attcagacat tctgaataat agaacatatg accttgttgg agtagatcaa ggatatacaa    182820
     ctttcaaagg ttaccactac aatgcggaaa aagacatgta tgacgaagtg ttcagccaca    182880
     aacacaagga aaagatccat ctagttatcc ctgcggactt tactggaacc ggaaatgtaa    182940
     gctacattct tgtctcgaag aaaggcccgg aaaagtttaa tatttacatt tacttccgag    183000
     actatgacga atcccggtat ctcggagaat ctattacagt tccgctgctt tacgcttgcc    183060
     cagatgactt acgcccacaa ctacttgtac agtatagcga cggacttaag aaaattagaa    183120
     ttgacgagag cggaaatatg atcaaagaac ctgccgacga gtatggaaag cttcataagg    183180
     aacatacatc tgcatttgtt gaggttgatg ggagtatgaa agcctgtctt tgccttgttc    183240
     tagatgatgg ccatggagga agacttctga ggattctgag caacagaaat ggagagttta    183300
     taaattactt tgagatgaaa ctacctgatg agatcggccc tatagttttt ggagacttca    183360
     atggaaatgg gatgaatgac atggcatttg ttcagaagaa tggagaaaaa tatctcctaa    183420
     agatttactt taatacaacc tctagagttg gtgatggaga caagagactt cttggaggat    183480
     ttctccctca ccagattgat agcaccatat tttcggaagg aaacatgaaa gtcatagacc    183540
     taagcgaaga atttccaaac tgcacaccag taataaggtc tgaagatcac ttcgaaggcc    183600
     ttccctacgg gatatttaat gcagatctca gggcaaaggg aaggcaggac ttcttcatta    183660
     taatgaaaga catagacagc agcatccgga ttggagtcct cgaaaacaac tcgaatccag    183720
     atgacattcg gttgggaaag gcagagtata acgaagatat ctttggcctc aaaaacatca    183780
     tctcgataag ttgttgcgac tataacaaca agggacgaga ggcagtgttc ttaaatagag    183840
     ttgtggacaa taatgctgtt gtggaggcat acaaaaatga tctttcaaag gaaaacctta    183900
     aactcagtct atcaaccatt catcctggac tacagaagta tggatctgtt gtcccagggg    183960
     tgtcgtatct ggtatcctat ggagatggag aaagaattat catttcgaat caaacaccat    184020
     acagtacgtt tgtacatcta aagcaccagg tggcgtacat tggactgggt acaatgaacc    184080
     ttatagtcga cagtctgatg ataggaacac ctggaaagaa cgggagtcca tatgcaggcc    184140
     catatgtgat agattcgata gccattccaa acacggacct agttgtatat ttggaagaaa    184200
     acgagaaata cactgtagag gcacatttca ttgttggaga tcatttcaaa actattatcg    184260
     ggacattgct tatagttgca ggagtgaatc ttgcctttat actcttactc caatacagag    184320
     acagaagaag aattataaaa gcaaagaata tggacaaact tcatccactt ttctctacgt    184380
     tgcaatagtg aatatattaa aatccaaaac ctttatgtat ttttaatgaa atataaatat    184440
     cttttcgaaa tttggctgtt attcagtctc catctccgtt aatgtttttc tattcagccc    184500
     tagagactgc tttttgttca agtagaaaag aagcccaact agagaaaagg ccagcattcc    184560
     cacacttaat atgtaaatct cgacgttgtc ataggagtag tccccggagg caaggaatgc    184620
     aacggcaatt ggagaaaatg taaatgccag gttcaggatg caatatatgg tggcaaagcc    184680
     tgttcccaag gactcctctg ataccaaaga tggaatgcac ggccagtagc atgctattag    184740
     cggtccagaa aatcctaaaa atgtagcaga tgcatatgga gataggaagt taaagaatat    184800
     ccctaggtgc cctaagagaa aaagaatgca tccagcgcca atcagccata gcttaagtcc    184860
     atatgcgtct gtaattgcac ttgtaaatgt aaccaatact agggatatcc cttcgatgat    184920
     tgccagaacg tttccagatg agacaggaga taaaccgtat ctcttttgaa atagcattgg    184980
     tgctattgtg tagaatggtg cccataccaa agcaaacaaa aaggacatcc cgacgagtac    185040
     atagaaggct gagtgatgag tattctttcc ttcaagcctc ggctcgtaaa acaatatgcc    185100
     tgactcttca aagagtactt tgggctttcc cttttcaagt ctacttttta tagatgtggt    185160
     ctcttttcca tctgccttcc aaggagagaa gggattttca aagagaattg gatctgtttg    185220
     aagaagttcc ttgggctttg attctttgta atcatagaaa aacgggtttt ccggaatgct    185280
     tagagagttg gaagcatctc tgggcgtggg gtcgcttgct tttagaagga atcccgagtc    185340
     cgactcttca agaaaccctt ctccagggta catcttttct tcttgaacct catccccaaa    185400
     tccattcttt tgaagttcta taagcttctg cttgagtacc ttgtgagatc tttccgagtt    185460
     atttattcta agacagaccc aaagtcccag aagagtcagg aatatcccaa ccacacatgg    185520
     aaacatcttt ccaatataat ctgccaggaa gggagtgaca aggaagtttg caaccgtgcc    185580
     catcctggca atgcatgaaa agatccccat tgcgaatcct aactccttcc ccttgaattc    185640
     ataagatatt agtttgttct gaatgactgc aaagctctct cctccaattc caaagaaaaa    185700
     cctcccaata agcatgatct tgaagctgtg gttccaaact cctattgtga agattagatg    185760
     tccgagaaag acaaaagcac atagaagctt agccatggta gacttcctta cgtgggtgat    185820
     ccatccaaag aatacaggga caattatgtt tggtagagag tacaccgaat agagtaaagt    185880
     tattttgtac tctatgcctg attcagagcc gaagtccatg tgatggctca atgcagacgg    185940
     gatgtcatat acaaaataaa atgaaaacag tattaatccc gacaacagaa ggattctatg    186000
     tctttctttc attgttgtta atgaatagct atacctttta tttcagattc tgtttcaaaa    186060
     ctatccaatc aagtataagt gtatggaagg ttctggatgg ctgatgggat cgcaaaactt    186120
     aacagaacag ctttaatcat gtaaagtata gaagcttcga cttttttcta ctgagaacct    186180
     cctgtattcc atccatgaag tcattttggg agatttcggt cttttccctt ctaagagctg    186240
     ccattcctgc ctccacacag actgctttgc attgtgcccc gttaaatccc tcggtacttc    186300
     ttgcaagctc atcaaagttg acatcgtctc tgacactcat atttcttgca tggatctgga    186360
     gaatcctttt tcttcctagt gcatttggaa ggggaaattc aatctttcta tcaagtcttc    186420
     cgcttcttaa caatgccgga tctaagatat ccaccctatt ggttgcagca atgatcttta    186480
     cctcctcggt ggaggaaaaa ccgtcaagct ggttgagaag ctccaacatg gttctctgaa    186540
     cctctctgtc tccagtctga tcagagtcag atctcttggc tcctatcgcg tcaatttcat    186600
     ctatgaagat aattgttggc tttttctcct ttgcaagagc aaatgcatcc ctgacaagcc    186660
     ttgctccatc tccaatatac atttgtacaa gctgagggcc tgcgagcttc aaaaatgttg    186720
     cattcgtttt gcttgcgcat gctcgtgcca tcagtgtttt ccccgtacca ggaggaccgt    186780
     acatcaagac ccccttagga ggctttatgt tcagcttttc aaatctttct ggatgtgtga    186840
     gggaaagaac tattgcctca tttagctcct ctatctgtct ttctagccct ccaatgtcct    186900
     cgtaggtttc gtcgggcttt gcatcagact tcaaaaccat tcccccgacc ttcatgtcat    186960
     agtcgggtgg aagcttctca aatactatgt ttgtgtcctt atgtaaagct acaagatctc    187020
     cagggcgaag ttcggaattg ggaataagtc ctgtaatagg aagatatgaa gacatccttg    187080
     tagatgcatt gacaacagca ctttgattat caagaacctc cacaacgttc ccaacaaggt    187140
     atggaagctg cttgttgagt cttattcttt ccatgttttc tgcaatcgac gcattctttg    187200
     tcgaaatatc atgcttaata gtattcaccc ggctctgaag aatcctagtc tccgaattca    187260
     gcatccggat cttctcccgc accttttcaa gaaactcttc gggattactt tgatccatca    187320
     tttcaagctc ctccagagac atcttagggc ctcagcctcc aattttttat ctttcaaaac    187380
     aatatcaaaa acaaggcttt tctccaaaac aattcaattg atttcttttt ttttcggaag    187440
     tttgtcaacc acatgcttgt aaaactcaag tcttctattg aaatggttca ggagtttttg    187500
     tgcacattta taatattgtg tgtctttacc attgtatgta aagcaattat tcaccattaa    187560
     gttcacgtct tcaacaaacg cttcaatgaa tttgtattca ttgtttttta acttagatga    187620
     catcgtagac agatccatag gtttggatat acatttgtag tagttaggga cttccttagg    187680
     atccacaggc ttcaaaaatg gccaggcata tgcattgatg caaagatcag atataagata    187740
     cgaaataaac ctgtcctggc acctctgatc attggtctcc tctgcagaat accttgcatt    187800
     caagactcct ggaatatcgt tgacgtcttt aatttccgag tagtcatcta tcttccgaat    187860
     aatatgatat tcattgacct tcttcatctc ttcaaacaac tttcttttcc tatcttgaat    187920
     aatctcctgc tttttcaaat agttaatttc ccagagtaca cagcactcta ctattgtgcc    187980
     cccttcatag tccttaataa acccaatcca tcctccaaat cttatctctg ttgtaaatcc    188040
     ttgtttcttg aagtacccta ttgcaaagtt gtctgcatat gttaccaagt agagggatgg    188100
     ggcattgctt tcaggagttc tgcatagaag cggggtgaga tcttctataa ccctattctt    188160
     ctgtttaggg ctccctgaaa ggccatttga tggtttctca aaatagcttc ttatctcttc    188220
     cttaatgacc tccttaaaga gatccatcat aaatcctcca attcctttta cttggaaatc    188280
     atagtctaca gctaagaaca caatttctac aaagtttctc tcaaaaaacg gtctgtaaca    188340
     tattccgcca accacttctc ctacggagtt cagcagtacc aggttggcat gctttgtgtc    188400
     gaatacttgt ctgagaatgt attccccagg catcttggag agctgattct ggaaaagata    188460
     cttggttctc agaagaagta tcttgtctac acatggatcc gacgacgaca caacaacagc    188520
     cttcagctcc ccattcttga acttcgcata caacatttct ttttcatttc tccatgtttg    188580
     gtttctttcc aatccaaaaa gattcgtttc aacactatcc atcctttctg ccctagttaa    188640
     tctccggttt atatccttac ccttcgttcc tcttgtatct ttccgccaca attgttgttt    188700
     caaggtgctt gagccttgca attcctgcaa gagctccaat aattccccct cctaccacgt    188760
     cagaggcaaa gtgcttgtta tctatcacac ggcttgctcc cacagcaata ggaaccatta    188820
     aaaatagaga gtaaagcata aaaacaatcc cccggttcac ctttgctcta agttcgggaa    188880
     gactaagctc cttgtatatg aagaaagcta gaaacataaa cccacatgca gcaatcgagg    188940
     tgtgtccaga cgggaaactc tttcttccct ccatcacaat agagggatct ccagtacact    189000
     ttcctccaac aggaatgcat ctgtccaaaa aatcaggtct gagtcttcca acaacattct    189060
     tcatgttctc aacaatggcg gatgtgaaga gacaagccac tagaaatgac atataaaagt    189120
     atatctcatc aactctcttt actatgttga tccgaaaagt tccaaacata attccaagag    189180
     gtgcaagaat agatatggct gcaatctcta caaatgttat tgtatcgtgg tataaatacg    189240
     acttagatat tgacctgtcg tttacattaa agggccgttc atatggctct actgtacttg    189300
     agagaaataa gaggcctatg gacacaatcg tgatggcaag catttctctt gtcattgttg    189360
     atcgatccct tgcaattatt tgtagttata acaaataaag aaaagcccaa aaatcaacat    189420
     aaacggagtt tattgaagca ctttgtctcc gggatagaaa tatctttgga ccccattcct    189480
     agaaattgca gacattctta tgcatcctcc agaagcattg tctctgttta ttgcacacga    189540
     aactgcgttt ttgataaatc caattccttc ctcaagactc atcccatttt tccaattaac    189600
     atcgcaatag ccatatataa acgcagatcc agagcctcca attgcccaat cgcactccac    189660
     aagcgtccct ccgagagata tgttgaagat ccttggctta tcgtcgtatc cagcaactat    189720
     gagacctgcc aagaggcttg gattctcata tatgatctta ctagccagtg ttgctgctct    189780
     ttgaaccaaa ggaatagagc tttcaagatg tgaatacaga gtaagataca tctttaggta    189840
     ctcagaaatc atttgtgtat ctgccgagct ccctgaccta caaacaaata tgttatttgt    189900
     aatcggtgta agcttgtcag tcactctgct tgggatatat gctcccatcg atgttcttga    189960
     gtctgctcca atcaatactc catcatcata ctttattgca ataatggtgg tgcctgtcat    190020
     ctccttctta ttaaacatct tccaagggca aggctatctt tcttttgtta tcaaagatac    190080
     caaaaacacc tcgatagaaa tgtatcactc ctagacaatg ttcttaagag ggagtgtgag    190140
     attaacaaca atgttctctt cagttgtgtc tctgtccaca cagaaatacc caatgcgttg    190200
     gaattggaat ctatcctcga caccggcttc actaattctt ttgtcgcaaa gcccgtggac    190260
     aatttttaga ctatctttgt tcatctcctc aagataggta gagtcctttg gactgaatga    190320
     tgtccagagt ggagaataca tcctcatctc tactcggaca cagtccgaac taacccagtg    190380
     gatgaacttt ttaggaatcc catcccatct ttctgcaagg atcccgtctt cagttacctt    190440
     tacaaccctt attggataaa gcatgtacaa cccaacaggc tgatcaagtg taagtcttaa    190500
     aaagtctcca tctcccttat ccataaagtc cgacttctct atgtatatga ctggagtaaa    190560
     gggaacattt ctgcttacct ctgatccagg gaaatctgga atagatacac tacagggctc    190620
     ggcgttcatt attgttacct ttaaaggatc tcttacacac atgatccttc tagaagttct    190680
     gttgagattg tctctaacaa aattctcgag tttctttaca tccactattg tttcagcaaa    190740
     agtaagtcca agactcttac agaactcgtt gatggcttca ggagggaatc ctctccttct    190800
     catgcccttt attgtaaaaa gacggggatc gtccaactct atcccatact tcttcagagg    190860
     gaccagcttc ctcttgctca aaaccgtatt acttatgttc agacggctaa actcccattg    190920
     gattggtttg taaatctcga gctggtcaag cagccaatga tagctctcct gccgtgtaaa    190980
     gaactctctc gtgcagaagg agtgtgttac atcttccagg ctgtcagaca cgcaaagagc    191040
     gaactcatat gttggataca cggtatatct cacctttttc ataggatgca ctgcattcag    191100
     tattcgaatc cctatcaagt caagcattag aggattcttt gtattcgtat ccattttgaa    191160
     tcgaagacat gctgttcctt cttcccactt accatcaacc atctcctgaa agattcttaa    191220
     attctcctcg accgacctgt ttctgtattg gcttagatgt gatctttcat tcatgttgtc    191280
     tgatgtgtat tgtcttcttc tctcacatat ttcctcctgg cttaagtggc agacatatgc    191340
     ttttcccttt tttataagct gaaatccaaa ctcaaccatc ttgtcgaagt aatcgcttga    191400
     tgcagtaacc ttatagggct caaacccaag ccatcgaacg tcctcataaa tcgaatcaaa    191460
     gtactccact tcttcgttct ttggatttgt atcatcatat ctcaaataag tatatcctcc    191520
     aaatttcttg gcatattcaa agctcaaatt tattgccttt gcatgcccaa tatggagaat    191580
     cccgttaggt tcaggaggaa atctggtaac cactctccct cctgttctct ttaagtgcgc    191640
     ttgccttatc tcttcactga cctgtggggt ttccccaggt tttggaagtt tcctgatctc    191700
     tccttcttcc agccagtctc ctccttctag gttttcctca tgctcttcca catcatcggg    191760
     gatcttattt atttcttcca tcacaattct gaaatccgcg caaggcatgg tatttcttgc    191820
     tttgctaagc atatctttct ttgataatcc ctctctcctc atcttagcaa tgttattctt    191880
     tatactctcc tcgtcaactt cattggactt tacaaaggaa accatttcct cggccgaaac    191940
     ctcttttttc cccatatgtt ttaagcactc cttcagcata ctctcgttct ttatggttcc    192000
     agactcaatg agattggcta gcaactcaac attggcattt cttgaagctg tgcaggcaag    192060
     agtatataaa agtctgttgg agaaggatct tccagaaaaa atcttctcca tattcttcac    192120
     aacctgttcc tttttcatca cttcatgtct cttttcagag gaaatctcta acttctcaaa    192180
     aacctcttca agatttagca tagagggtaa acacaaattt ttattaaatg gtctctagat    192240
     ctctctaatc atggcgggta agtctctttt tcctctgttc caactccttc agatattcat    192300
     ccacagccct tatttcatcg attattgctt ttcttctttt ctcagctctt ctcaaaagaa    192360
     tattgacaat ctctaatatt ctcttaatct tcttgttatt gtcatacatc tcgcagggat    192420
     tcttcaaaac ggtttcttct cctaagatct cacttcatag taggagggat tgttagcgct    192480
     caaccagggg ctgggaaata gataatcatt caagacttca aaccactccg gcccgtcact    192540
     ttccaaaact tcatgcatct aaactaaata ataaattaat tattccatag caatgaatcg    192600
     gcctgcttca tcaattcata gtatttgaca gatcgagcga tgagtattca gatttatcca    192660
     taaacatgat atgataaatt catcttatga tatatgggag attcctttta tggaaatgac    192720
     atttatggag aggatagggc ttctaattgt gtctatagtt gctttaaggt atgggatata    192780
     atttggcaat gaccccagct ttgttcatgt caaggttgcc caatcttgcc tcctctcgta    192840
     tgaatgaaat aagaaaagtc tacatagaag ccaacaatag aattgttgag gaaatagatg    192900
     cagtaacaga aaagttctca aaagaagttg agaccattcc taacatctcg gccagcgtaa    192960
     ggatatatct tgaagaaaaa atcagatcta tacgtgagtt tgttgtcgat agtattggat    193020
     tttcaatagg cgagtttaga gccttataca atcccgatgg aaatgaaagc ataaaaacga    193080
     gaagatttcc aaagttcata accgaggcac tagaaaggag ctttgagatt gaccaatatc    193140
     cgtccgaagc cgaaaagtca agacttgcaa aaatatgtaa actttcgaca aagcaaataa    193200
     acaactggtt tacgaacaaa agaaatagaa gcaaaagcca tgatgggggt aggcagtact    193260
     aggctgtgaa tgggaggcgc atatgatttt aatataatcc atgtatgtat ttctttgaag    193320
     taaagtaaga gactaaatta gtataactct tcttaaagcc ccaatggcaa gtaatataag    193380
     ttattcttga tacgaagatc aatctcacct cgattctcta ttttaggaaa ggtgaaattt    193440
     tcgtggtagg aagatctttg acgacctaaa tttcgtagga gaaagatacg acagaatcga    193500
     ccgagtgtga atgagataac atagtatttt aattgttaat ttaaacaatt agttttcgat    193560
     gtaatataca aaaccaccga tgtgtagagg aaattggttc caagacagaa cactagaaaa    193620
     ggatgttaca agacaacatg agactgtaga cttctatgcg cgcttggata ggccagattc    193680
     tatttatttc tgtcatattg acacaattga aatattaaat tataaaacct ctatcaaaca    193740
     agattaatta agctatcgcg agacaattag ataaaacaga gtgaatggag cggtagccat    193800
     gaacatgata atggatatat tgaatcaagt tatgtatgct gaagaatgct atttctccaa    193860
     cagagttagc agagagaaat taatggaaga cataagacgt cttcggagtg aatacgagat    193920
     tggaataatg agagactctg gaagagaagg aataaaattc aaaatggcat tgctatttat    193980
     tcttagaaga gtgagacaca agattatact tgaagacaga ctcatggaga tgattgattc    194040
     cgaggttgct ttcgttagag gatgtgtaag cagtatcatc tctgagccct tcggagtcaa    194100
     gcctgtagaa accatgaggc ctacacaaca agaagcagag accaggtgtg ccaaaccaag    194160
     gacaagggcc aacttcccta tggacacttc acagcttctg agatcttggc ttaaagagaa    194220
     tatggataac ccatatccat cggatgccga aaaggcatat ctttgccaga agactggcct    194280
     tggtcctgca cagattaata attggtttat aaatgctagg agaagaatct tacctttcat    194340
     gaaaggaaag cgtgcgagtt tcaaataaat ttatatggga gtttattggt taattatctt    194400
     atccatcggt agccacacat ttagaactcc aaataaaggc tcgaaagatt ctgaacaact    194460
     gtattagagt ctggttcgga tgtgtctaga agccaactac tgcccacccc gagataacta    194520
     gtaaaaatgg aaaatccata tgaaataaaa ttatgggtag ctattaatta aaataagttt    194580
     aaatttcata gatataaaac gaccttattg cttttaatgg attattgtga gcatttattt    194640
     cttctataag atcatcatgc aaaaagtttg aaaaagaagg ctgctcatgt cagctacttt    194700
     ccttaagctc aaactttatt ccctttgatg atagtctcgg gatgatgtct gtattgtaca    194760
     acacacaggc cggtgttata acccctcccc ggaaaagagt tacgcctgtc cctctttctt    194820
     tctgattaag gcttctcaaa aatgtaactg ccgtctgagt caagcatacc gaagtcacta    194880
     tatatgcagg gtctgggccg gttattgtga gcaatttccc aactatctca ttcccctttt    194940
     cccctctggc tcttatttca attgtaaagt ctgcatttct gatctcttcg aaggaaggcc    195000
     tccttttaat ggttcggaaa gcaaacatct tggctagact cgtgataatc catcttccaa    195060
     atgaaaatcc agagaaaagc catattaccc aagcaaggat tcgatatttt atcatctcaa    195120
     tccgcccccc gacatctaga tatgcagagt acttcgcccc attgatccct atagactcca    195180
     ttagctcctg gcttcttctc acaacagaat agtctattcc ccgaaagatc acctggtagg    195240
     aatttttctt tacaacccgg agagatcgcc ttttctttcc ctgaccgtat ctcttctctc    195300
     tgagggcgtt catctctctg aaatttgcaa ccgatgcaag aagagattcc caagtggtca    195360
     agttcacaac aacattactg accttgagaa cactctctat ctctacatag tactcaaaca    195420
     tatctcggag atacataact ccaatgtctg aagggacaga ttcaaagccg cagcagttga    195480
     tgatgtatac acccttcctc acggcttcgt catggtattt gttgatgata agttcaaaga    195540
     aatatacctc tccagatatg tccatgtaat gtgttccatt tcttatacat gacttgacaa    195600
     tgcattctcc atggatggaa taaggtccaa cacagtttat tagaaccttt gtcatggatg    195660
     caatttcatc aatattatct atcttgcatt cgtaaacagg aaatgcctta tcctttattt    195720
     tgcttatgtt tcttgatgcc aaggccaacc taacgttttc ggccttgaag gcttctatga    195780
     tgtatcttgc agcatatccc gaggcaccgt agattatgaa gtcaaactct ctttccatgt    195840
     atgggcactt taaaaaacat tatttatcat tgaaaagggg gtagtggaat ttctaaggtt    195900
     ccatagacga aaattcttct ccaaggctca tgtgcttggt gattggacat tcccatacca    195960
     acggcacaaa atggaccaat agaactggtg caagtcaagg caattggttt cgaggaatgt    196020
     atgaattaag tacatatatg aaggtaggaa gaatcttggg aatggatgga ctgtctggca    196080
     aggacaagga taagatgtcc ggaaagaaag aaaaggaagt tgggactccc atatcagccg    196140
     agggatctaa tggagaggga gaggaatctt ttgaatctga tgttatgaag catgtaattg    196200
     gggcagcatg tatgctaagc cataagtctt ctgatgaaga tgtgactgag tgtagcgaag    196260
     agaaaatctc tacgtttgat gtttatatag ttaatgaaga tgggaaagtt aacggatatg    196320
     aacttaagca cataggtcct gctgggggag ttgagtgttc caactctcct caaagctctc    196380
     cttcaaacga aatgataagg tcaagatctt tccattttga tcgcaaaaac aagggacttc    196440
     caccccaaga attctacaga agaaaaaagt ctagcgagca acttccttgg aagatcaatg    196500
     ggaattgtag caatggatcc aaggaaaagt gtgaacccat aattcttgag atatccgaaa    196560
     tttccgatgg atatagtgtt gacgggacgg atgaacatca agatatcaac gctagtgtct    196620
     gtagccaaga tacgggctcg agcaaaattt cgttgaagtg tgaaaatgaa acgtcaaaca    196680
     cctttgttga tttgaatttt tctaacagac aagaaacttc agagaagtca gattgcaggg    196740
     gtctccaatc ggacaaaggc tcccaagacg agattttgct gccatttcct tcacaagaca    196800
     aggattatac ctcctctgga tcggcttctc cagagtccag aaatggacca tcaagaaatt    196860
     ctgaccttga aaagatagca ctgtctattg ttaagataac agagcctggg gaatctggga    196920
     aggagaaaga acacgaatct gatgctccta aggccatggg aaacatcata aaagctattc    196980
     aagcacaaga gtctgaagat aagcttgtca taaaccagaa gattggatta aatagcccct    197040
     gtccaattaa cgaagagaaa tgtcttgggg aagatgcaat gatgacctct gaggatcttt    197100
     ctagggagtt gaagactgct ctgcttgcag cattcattcc ttccatggag acgtctgaaa    197160
     tgtcggaaac atcggaaaag tcgttcgtag aaaccagcat cactcgaaac atcggtggaa    197220
     agccggattc aacagaagag gttgaaaagt ttaggaccgt tcttaatatt ggcgatagtg    197280
     ttcctcctct tttggatgta aaagatttgg ccgggaaaaa aggtaaggat gatgaaatga    197340
     taatctttgt tgaagccgaa gacattggga agaaaaggaa tgtggccaca agaaataata    197400
     gggttggaag attggttaaa ttctttgaaa gcttagagga aagaaataag gaaagagatc    197460
     caaaagaaga atgaatgaat taaatttaaa atttgtttat caacagttga ttaaaattgt    197520
     cttctggcgt ctgaggagag gaggaaaata tttttagagc aaagtagact taaaaaacga    197580
     agtagattct tcttgcttct cactaataat ttcttccatt tccttatcgg ttggaggttc    197640
     atgagaaaaa ggacaatcct tccttgtgca gtttcccttt atgtgaaatg ctttacatgg    197700
     aaacttgctt gtatcatgcg aatatgtaca gttatcccca tgcttacagg aattcatcag    197760
     aaaaaactta caaagtatgg tacgatagtt agaagccgat ctttcgactt cccgaggttt    197820
     tggggtggtc tttgggacga tcttgtgtac tcggtattct aacagatagc tcttattaag    197880
     acgggtagga acatttagtt tcggaagcat tttgatgggt tacataaaaa tccttttctt    197940
     tgttagaaac taagatgggt atatagaaag agaacccctt aataaatgga tccaaagata    198000
     gagttcaggg tacctgggaa ggtaattgtg aatgggtcat atatagtatt ggaaggagaa    198060
     acatgcagag ccatagctct taaggaatac atgatatcgg aggcgattag gatggagtct    198120
     agcaaacaga agatagtagt ggaggtagaa ggacaagaaa agattacata ctaccataac    198180
     cgtagcgatt tgccagaaga caaaggcaaa tcttcatatt acttactcaa agttgtcgat    198240
     tccttctttg aggttacggg aatcatacct aaaaaccaaa tacaaatcag aatgaaggct    198300
     gggaatggat tctttgtcaa tgggcctaca agtgagaaga cggggattgg gtcatcagtt    198360
     tgtatccttg tatccatagt atatgctctc ttgaaattcc atcaggaaga cctcaaccaa    198420
     ataatttctc tcaagggctt tgaaagatgg ggacgatctc ccgtcttccg agggaattta    198480
     gagtcacatc taggccatct ttctctttcc aaagaaattc tgaatcacct tttgtctata    198540
     acatatcagg tgcatcagaa aaccaatcaa ggtggatctg ggtctgatgc aatgtgttgt    198600
     ctcttagggt ccatatactc caatcgagaa gcatgcattc caatagaaaa agttcctcgg    198660
     tatttgattc ttggatcctt tggaaagagc acttcgacaa gagaaatgct taagaaaatc    198720
     gacctttccg actccaaatg gaaatctctt aaagatatga attccagaat taacaaagaa    198780
     aggagaaatc caaagaaact ctatatagaa tatctgaaca ttataagaaa tattagtaca    198840
     gcaatagtcc ctgaaaaaca atatgaaata cttataaaaa ccaatgagta tgacatttgg    198900
     ggatgtggaa tttctggtgc agggggagat gattgtgtgt gggttcttac ggatgattat    198960
     aagagtgtat atgaatattg gcagaaggcc ttcgccttta catttataac agaagtatcc    199020
     tacaaaggaa tttgtttatt gtaaagtatt tcttagtgtg gagttctcta gcatctcgga    199080
     aacctatgct taattgaatt attaaagtca ggagataaag gagagattta tgtcgtttat    199140
     agttgatttg gaaattgaaa gttattatat gttacatagt aaacagccca tggaaatgca    199200
     agaaaaagac ctcggaccca tagtaggata taatcttgaa ctcaaagata tttttcttga    199260
     ggctcccaac aaagatttat cctcaagcac caagtatgtt aggctgataa acggcatatc    199320
     tacaactttt gaatcaggga aattgtcagt tatcatggga cctagtggaa gtagtaaaac    199380
     aacattgata aatttgattg taggaataat tcaagaaaac tcgaaggtct cgggaaatgt    199440
     gcttcttcgt gggaaatcaa gaaacccaaa gacatggtta acccaggttg cctatctaaa    199500
     tcaggatgac tgcatagttc cctacataac tatccacgaa tatatttact tttgtgtgag    199560
     ttgcagaaca acgaaaaaac aaagaggagg aagaagtatt aatgagatca tcaataaggt    199620
     gatgaaaaaa cttcatatcg aggatcttaa ggacgtagtt atgacggcga tttcaggagg    199680
     ggagaggaaa agggtaatga tagctgttga gtttgcagtt tctccagaag tattgattct    199740
     agatgagcca acaagtggat tggattcaca tcttgcattt gaattaattc aaatgatcaa    199800
     ggaatatgct gttgaaaaca acaagattgt gatcacaaca gtccatcagc caggtccggg    199860
     attgtttgat atgtttgatt atctcctgtt tcttaataag ggatctttgg tgtattcggg    199920
     gtctgctgat caatgcgaaa gattttttga ttctaaagga attcatagag tcggaaatct    199980
     gtctgtgagt gaatttttat ttgagctttt ttctggacag tcgtatatct ctggaattga    200040
     ggagtataga gaggccatca acaaaatgat agagtctgcc gtccaagagg gagacttgaa    200100
     aatcgaaaac aaaacaatga gccagatctc tggctctgta gttaagcttc catttagttt    200160
     ctcaaaggca ctcaagatag ctaaaagaaa atggattatg gaatggagat cttggaggat    200220
     gatgaggaat tggattttcg agatcgtttt tctttttgtc tatgtctatt tcttgtatcc    200280
     aatgatcttt tctatagaat ttttgaattt taaaaatctc ctaaatctaa acataaacga    200340
     acgtgatgaa acagaatcag tttttcgttg gcttataggc tccttaaaat ccatgattga    200400
     tgaatctcta gtgggcaatg tagatgaggc aatcaagtgg gagatatgtt catttctact    200460
     aattacactt tcccttttcg gttcgacaga catacttgat ggcttaaatt atgtccacag    200520
     agaaacatcc aaggcaacat atggcatatc cacactttac ttctcgacat ggattgccga    200580
     aacacctata accattctaa aatgctttgt atttctgggg atttcatcat ccataggaat    200640
     tcatggggga aatacgtttg aactaatcac ttacataatt gtaggaagtc ttttaatact    200700
     ggcatttgat attatgatga gaagcattac atcttctagt gcgtttagaa agtttctctc    200760
     gatgatcact ttcatatttc tgacatctct tactccggag atttcatata catttacaaa    200820
     aatactctcg gttccttcgg ccggaaatct cagacttctg aaacttttaa agtatccctc    200880
     tatacttctt tggcctcaaa tcttctttca aggattcatg aggctgtctt tctttgaaag    200940
     ggtgatgttc cctaaggaac caaacgagaa gtttactttt atatacaagg ccattatggg    201000
     ttcaatagtg actccacgtc tttatgacct acatcttagt gatgaagaaa acagagaaaa    201060
     gctcctcaat cctcagacca ggtttctagt agatcaaaac tactctaaat atattctatt    201120
     gcctcttgga gctacttctc tcataatagt tatcctttta agtaattact ttcttgtgag    201180
     aagattttct cctcgcttac agcttaacct atccaataaa taaaggtact ttaattttaa    201240
     gccttggatt ttttccctga atggagtctt tgattctttg ggatggaaga agcatctgtg    201300
     ggcttaaaaa gattccaaag acaatactaa tagttgatga atacaacaca ataacacccg    201360
     agaaaaaaag taagataaaa gactccgtgg ctgaaatgga catagacttt gaagaggagg    201420
     caacacgtta ttctcttgtg atcctttgca acactgtctt gaggtttaac ctaaagaacc    201480
     cactcgtctt ggcagaatgt gagatttggt ttactagaaa gaccttttcc tcaaaagtat    201540
     ttgaagatgc tcttattcac tattcggaat gtgaaataag aaatggagtg taaacaaccc    201600
     atgaaccccc gagaagattc ctcgtttgca gctttccggt taaagaccga gattgaatct    201660
     atccaacttc tcccaggatc actgttgaat gtggataggt cttctgagga taaatacgct    201720
     atggaaataa aatattccat gatgatcaca gaaggaatat ataaaaatcg cttgtttcga    201780
     ttcaagataa agataccgca tgcctatcca tttaagcctc caaagctttt gtgtctggat    201840
     aaagtgttcc atccaaatat tgatgatgat ggaaatgttt gcatggagat tttgaggcta    201900
     gggtggaggc ctagccatgg gttggagagc atacttgtta atctttatgt tatatttgtt    201960
     gaaatcacag gagaagatgc attaaacaca caggcaggag atttattcaa gctagactat    202020
     gaaaggtttg taagaattgc aaggggccag gaaagaatct aagactttca acaggatcta    202080
     gcgtttgtgt attattgctg catattcttc ttttgcatct tcagacacct cttttagaac    202140
     aaaatcaaaa ggtagagaag ccttatgtcc atccaccaca ataaaatcca agttctttag    202200
     aattttctta tttagggttt tttcaacgaa ctggtatgag gatttcggat caagtagtac    202260
     aactccgata ttattcggag agattaatac tctcaaaggt ccatggactt cctctttaaa    202320
     tatcctattc aaagttcctt ttagggaaga attcttccag aggtttatgg atgcctccat    202380
     ctcaaggatt catattgaag aatttttcta tccatgatat ggatctctcg ggaatgaata    202440
     gactatttga agttctcgat aaaatcaaaa ataaagtaga aaaggaggaa aggccaccca    202500
     acccaaagga agcgttggaa agagagcttc acaagttata tctatgcata tccttagaaa    202560
     tatgcaagca aaagcttcaa ggatctgttg gtaaggaagt tcttgacaag gtgaaggaaa    202620
     ttaaacaata tttcaagcac atagagaaca tccggggtaa agatcgaaat gatcctgtac    202680
     aaaaataaga tgatacttat ttattctttt tctctgcctt cttcattgct ctcttgatag    202740
     taccaaagat cttatagcgc ttcttccttt cgtcctttct tacccttcta ggtgttattt    202800
     gaagctcctt tccagtgatc tttgctacaa catgcttctt ctcaactgaa gaaagaactt    202860
     cagcatttga ataaatcttt gctctgagtg tggttctgtg tgttccatac ctattcttaa    202920
     gatttccaac tacaatgttc ttcttgcttg tttgatagag ctcagatatc ttgtctgtta    202980
     tttcctctct gctgggaata ggcattccag gatggtatgc aaccacatcc aattctttcc    203040
     tggaaagcag tttgttctcc ttaaggccag aaatctcaag ttccaaactc tataagttag    203100
     cttcaaatac ctcacttacc atttcgtgag ggataaaatt ttcggaaata tctgtctttc    203160
     aggcctctcg accttcgaaa atattttcct taacagaaag gccctttgaa atggtaagtg    203220
     gaacttcgga gtcctggaaa taactttagg caactattac aatcaacaaa gctggaaagg    203280
     ttaggaatca aacaccaaag gatcctgttg tcgaaaagga aaggaagaag tgcgggcgct    203340
     gcagacaacg cttgaagttt gagaagagaa acgagatggg atattttgat gtgatgggaa    203400
     agatgaagct gaatcctcag tcatgaaaga taaaataaaa tcttattagc ctctatggcc    203460
     gaattttccg ttataaaaca tatctaatgg attacccttg ctattttcga agctttcttg    203520
     gtttttacca aggatgtcaa agagtagcag atagaaagct gcaggcacca agggtgctag    203580
     gcacacattt taatttagac tttactatta gtttgacact cctcctgtgt caaatctgtg    203640
     tttttcttct cgtcattctc catactattt ttttccggct cttcggcctc agctcctact    203700
     gcaacaagta taacggtgtc tcccctgata aagacatttc caagctttct agaaaactcg    203760
     ctaccctgcc ttttctttct tcccttattt ctacctcgcg cagtcccaaa ctccctagct    203820
     tctcttacca ataagttata atgccgatca tatgctacca cttttcctgt gacctttctg    203880
     ttgtttcgta aagaaatcaa cacaggaatc atcttaacca tggcccggcg aacaagtgaa    203940
     agaggccctt tcatttccat cgactccttc tccccaggat tatctggatt gttcggaaga    204000
     aacatctatg ggcccatcca aacattaaaa taaccaaata tttattacat gtcttaagac    204060
     aattattcat tctttctctt aagcttcaca aactccacta ggcgatcaat aaacctgcca    204120
     gaagtctttc catggtaaaa gttttctata aatccagaaa taatctcgtt ggacactctt    204180
     tcccagtacc tcattgcaat tcttatttct cgccttatgt cttcaatctc tctttgaatg    204240
     tcaacattct tgatcatctc attcattttc ttactcatct ttattctctt catatgaagg    204300
     aacgatatat tcaggtcctt tgcagaaact cctctctcaa ggtttcttcg gacatataca    204360
     tcatagttcc tcactatgtc tgttattatt ccactagtac taattccctt tgttcttttg    204420
     atcggtataa acatccccat gtcttttaca aacttgtaga tatcgtcctt attctctccc    204480
     ttgtacggaa tgtcatcatg cgcaacaaaa tctattctat gcttttgaag gaattccgat    204540
     gttaactccc atggtgcact tgttataact tcatcaacat atctgcaatg gattagtcct    204600
     tcagctcttt ctttttcgtt catgacaaga tttcccttaa gtcttatagt tatgtcgtca    204660
     tctgtaaccc caaccagcaa gtagacattt ggaaaaagat tctttgcttg tttcaaactt    204720
     cgggcatgtc cataatgaaa tagatcgtac accccatcgc agtatattct aacaggccta    204780
     ttcacaggga ccttatacat cccaacttca gaggtcatct cttcatactc gaaggtattt    204840
     ctgtcgggat atgtgggagc catcatcttg tatttctctg tgtcgtttct cttcatcatg    204900
     ggctaggttt gcagaacgaa aaataaaacc aaacaaattc tctgtctgtg taaggtttct    204960
     tcacagtaat cagaaacaat caaagttact aaatctttgc ctttgtttat tagaattatc    205020
     attggatata gtccaagtcc tgaggaatcc caaagctact gttaaactct gacttttcca    205080
     ttgcaaactt gttacagata taatcttgta taacaaaaat gttgtcaaca atcttattat    205140
     actcgtcgat tactttcttt ctatctccga taagcttgtc atagactata ggatctgttt    205200
     cttcgaactt ctttagctct tttttttgtt cttcctccat cttctctagg gaattcagcc    205260
     tttcttccag cctgcttctc tcttccgtgt agttcttgga ctttctttcg tcttctaagt    205320
     gttttctctt gttagaaatg tcttcagaca ttcttttaca ttcgtccata agctctttac    205380
     acttcaactt cttcttttgg actccttcag atgcaaacga ccaatacaga ttggaggttc    205440
     caaccttctc gacagtgaca agaccttcgt caacaagctg ttgtagaatt tctttgatcg    205500
     tatttaccac tatccccttc ttcgagccca gagtttccaa ttcctgtaac ttgaagaatg    205560
     acttacttgt tcttattatc tccaatagaa tgcttttctt ctggtctgct ttcatcttga    205620
     ctgttgccat gactacaggg ctcctctcga agtagcttat tagtgtttcc aatactttat    205680
     ttccatagga tctatacccc atgatgtcgt tagagctgac caaagagaat atcaatgcag    205740
     tttctcttga gcttgtgaag aacaaaaaga tgtttgacaa gaacgtgaat tatgtaatgg    205800
     gtttcatgct taaatctttt cccgagaaaa acgagcttct tagtagaatc aaagtcctca    205860
     atattaaatc aagatcagca aagaagatag accccgagtc cgatgttatg gaacagatag    205920
     ctatgaatgt ctttgccata aagaatcttg acgaaggaag tttcaccaag aacatgctag    205980
     ccctcttcag ggacccaagt tccttttctc aagcattcct tacctacttc tattctaact    206040
     taaatcttag cactacgaag acagatgaga tcttgaacgg gctcgtagaa ttactcttat    206100
     ctgagtccaa actcaaaaaa agcttcatga attttatgaa ttcgattgaa ctctcggagg    206160
     attctgaatc tatttccctg gaggaggcca aaagtctaca caaagcctca gatgatcaca    206220
     cctttgaaaa gataataaat aaggaaagtt atgatgagtc atcaagcaca gtgatgtctc    206280
     tagtctccct ggacgactct gaagaaatca aaagaatcga tacatctatt tccctgctgt    206340
     ttgaaggaaa gagagaaaag atgtctatgc tgtcgatact agtgtgcact agagtattga    206400
     acattataag gatcatactg gaaaacaact acccaagaga tgtagatgtt attcctgttc    206460
     ttatgtacat cgcagagata gaccagacaa ttttcaagaa atcaatgtct gctatcaaga    206520
     taatattaag gaaaacagat tatagagaca aagaaaagct gtttgaaatg ttctgtgctc    206580
     tactcgaacg aaacccaggc attataagaa tggcaatgct ttttgtggat acttgtggaa    206640
     aacacttcaa ctggccgaga ttccttgaaa ttatagatgg gaacgaagag attgatctgg    206700
     atgtcgtgga taggtcttac attccaaatt cttccttcta tgaatttata ttgtttgccg    206760
     aggatccaag gagatacatg aagacaatca aaagcatgat tagaaacgag ttagactctt    206820
     ctcttcttag agatttaaaa gaaaagatta atggaagacc tgatctaaaa gatataaagc    206880
     cgatcaaaga tgctataagc tcccgtctta agctattaag ccaaaaaaag tgttctaaaa    206940
     aggaaaggaa agataacagt aactaaagaa catatttaat tctatccatt tgtgtttggc    207000
     tgctgttttg agaatctatg aaacacattt tcgatggcaa aaactcgttc tccctccctt    207060
     ttcaagagaa acagcatcct ttagtatcca tctgtcttcc tgatcatccc attcaacttc    207120
     tattctgcta cggcaaacat cacaaagtgc tgggcctccg gaatggacaa tcttctcgac    207180
     tttttcaacc tctagcctga gtttaatctt ctcgatgttt tttgtccatg cttctagagt    207240
     tggaaagaat tctctgctta tacaatcctt ttctcctaga acccttgctt ttcttcgatg    207300
     ctcgtcgatg tgaactccca tttgctcatc gccttctgga gtatctttat acctcagacc    207360
     gcatagtttg cattggtttg gatagtatag aatagaggga tccatctcag tcttcaagta    207420
     ctcgttattc aaaatatccg attcctgctc ttttttatcc cataggtttt ttgttcttgc    207480
     ctcctcaagc acacttctgc ttgttttttt actggccact tcctttggtt tggaatcagt    207540
     ttctccctcc tcatcaatga gtgtatttct ttcattaatg ctggccttga tcatatcctc    207600
     cgagctggaa gaactttctt cgtctattct aggtcttttg ggtttttcct cctggctttc    207660
     tccagataaa agtttgaata tcttgtgatt tctattaaat tcatctttgt acttttcaaa    207720
     aagactcaga tacctagtat ccttgctaca aagtagaaaa agaaaatcca aaaccgcctc    207780
     ttttccaagc aggcttctat gattcttgat caatgcatca ctcacagctt cttcattgta    207840
     tcgaaagctt tcagaaatca taagcaaaac attctgtgta atcttgtcgt tctttttgag    207900
     ggccttcagg agggaaacaa actcatccat gagggtctgc cagattggct ttttatcgct    207960
     tgtctgcaat catacatcaa gtggatattt atactagaaa cccccaaggt ttttttcgga    208020
     atatttgatt ttcttcttgg gcatcgattt gacactttcg tcttcttttt ctgtgatttg    208080
     tttgataatt tcatagagag tagaaaccac ttttccaggc ctaaaaaccc cctttggtgt    208140
     ctgtcttgtt tcatacacct ccttaagcat ctcgaggttg tcggggaatt ttacaagata    208200
     atttctattc ttctccaagc ctatcttgat ctcctttaca catcctttgt tccacatcac    208260
     aaatttctct ttaaagaaga aatagctctt ttcttcaaca aagaagaaac ctataaggtt    208320
     ctcaacctcg tatacaacgg ttttggagtt gattagatca aatcggtcgc agaataaaaa    208380
     ctctccacct ctcttgtata gcgccagcat tgatttccct acagaaattt tcatgaagtc    208440
     ctccaaaaag atagactctg cagtcctatc ttctatgttc agagatgtaa ccctgaaacc    208500
     cttgctggtc ccctcctgta tgtaaagccg atcctttaaa atagttaact gtattctcaa    208560
     gggagttgag tatatagtgc ttaccttgag gttattgaga ttcaaatgga acacttgctt    208620
     cactcccaca actatcagtt cccggaacag atagaagtgt atgaaattga ctcggccagt    208680
     atatggaaat acttttttga tcccgtcctc gtcaaacaac agaatctcct tggaagtcag    208740
     aacaaatacc tctccaaaag aggatgtgga caaatctatg gcgctaatgg aaaacatgct    208800
     tactttcttc ttctcgtaaa tatacatgtg tttttctgta agaataaatg ccttttggtg    208860
     cccagtcact agtcttttgc aagtatcctc tattcggaag ctatacttat actttccaag    208920
     aacgttaaag aaatggccgt cactcgaata tatcacgcta tcgttatcta ttttctccat    208980
     gaaagctact tgcggtgggc tctttgattt aacggcagtc tttctaaatg gaaatgctaa    209040
     aggaatatcc aactccttcc tgctaaagtc gaacttgcca ttatattttg gagctccaag    209100
     catcttaagc gcaaacgaat cgttcaagta cttggttggt ttctcctcag gaaaaattat    209160
     catgggtgtc tagtggagta aggaaatgag ttggacggta gtgctcgata tcaagaggtt    209220
     atagatctgc tttatagtgc attggatatt ttgtacgaga tcttctagaa gaggatagga    209280
     agagacccca ggaaatgaaa tgccaatact gcgaagtgga ggaactgctc atagagtgtg    209340
     tggggtgtgg aaagcatttc tgtaactcgc gtagtgcttc atcgatatct catatagtat    209400
     ttcatcttgt aaaggcaaag cataagtcaa tccgaattgg tggagacatc aagtgcagaa    209460
     agtgcggaga agataatttg ttcaaactcc ttgagaacaa tgggaagatt ttctgcaatg    209520
     gatgcagctc gggtagaatg gtggttgaag agagatgtct cactataatc aaaagccctg    209580
     aagtacaagg aaaaagattg acgaagcaac agatggcaga gatggaagag aagagtatgg    209640
     cgtctcttcc ctatgttaaa tcaaggtttg aagccaagga gtatgttgaa gtgttttctt    209700
     cgctaattga agctgagtgc aagaaggaaa gagagataaa ggaatcgatg aggcaagaga    209760
     atgtatttgt tcgatgggag aaactaaagt actgctattt ttactttcag aatggagata    209820
     gtgagctgaa gatcaacatt ggagatgaaa ttagattgac acataagagt ggatttgtcc    209880
     tacacggatt tgtcagtggg gagactttta gcgaggagct gaaagtggag atagaaacac    209940
     ctggagacta tccaagaagt ggatatactg tggagtatct ctggagagga atatgctacg    210000
     agagaatgga atgggcctta agaaagttat acaatacata taagaaggag acagacaaaa    210060
     tcaaaagaaa taagaataag aatgacgaaa gaaagccatg cgacaaagga atagatgtct    210120
     gtagggattt gagtgtacaa agaccaacga atagaggcga tatcggggct atgggggatg    210180
     aaggaaagat gcagaaagga aggaaaagtc ttaatgaagg cccatcgata tttgaatata    210240
     tcttaaaagg atataaggaa gggattggga attcggggca tatttttccg gtgccggatc    210300
     ttcccagact taatgcttct caagaaatag ctgtaagagc agctcttgga aggaaggtga    210360
     ctctgataca ggggcctccg gggacaggaa agaccttggt ctcgtctgct attgtttata    210420
     acctagtaaa acactacggg ggaaaggttc ttgttgttgc tcccagcaac actgctgtag    210480
     atcaacttac cttaaagata cataagacgg gactaagagt tctgcgagtg atgagtagga    210540
     gaagggaatg cgggcaatcg gatgtgaact ttctttctct tcatgaaaac ttgaaggagc    210600
     tgcaagaggg aagaaagaaa aaagatgagt gctatggaga ccataataga tacaacagca    210660
     tttacaacga tgaaaccaac gagtcattga aaaaacacct tttgaatcaa gcagaagtta    210720
     tcacttgcac gtgtgtaaca tctggccaaa agatgttcaa taagttccga ttccactatg    210780
     tattgattga cgaagcagtc caatcgacag agcccttgag ccttatccca ttagtgtatg    210840
     ggtgtaaaaa gcttgtgctt gttggagacc acaagcagct ggggcccact attctttgca    210900
     agaaggtagc acaagcggga ttcaagcaaa gcttgtttga aagactgatt tcaattggtg    210960
     tggttcccta tgtactatcg gttcagtaca ggatggatgc ggatctttgc gaatggcctt    211020
     ctgagatgtt ttacaacgga gaacttctta ctggaggaaa gaacttctgc agatttgatc    211080
     ttgggattcc aacgaacttc ttctatgtat gttatggaag agaagaagtc agcccaagcg    211140
     gaacctcgtt tgttaatcag gccgaagcct tgcattgtga aagcataata agacatctgt    211200
     tcaagtgtgg tgttacagag aatcaaatag gagtgataac accatatgag ggacaaagat    211260
     cttatattct aaatagaata tttggagccg agcctggaaa tcttgagata agcaatgtcg    211320
     atggttttca gggaagagaa aaggacttta taattgttag tcttgtccga agtaacctat    211380
     accagggaat agggtttgtt ggtgacaaga gaagaatgaa tgtgatgctg acaagagcaa    211440
     agcatgggtt ggtaataata ggaaatccaa tgactttgat gagacacgat atgtggagta    211500
     atctcttgtc cttctatgat aggaaaggcc ttgtgatgga gggcccttta cacaatctca    211560
     gacgagttgt tataaagccc cccaagctct tcgactttag agagataagc agatctctta    211620
     tgaatcaaat ataaagggat ttccaatcag aggagggaaa gaactactgt ttggaattac    211680
     taagaaataa aaattcttga attattttta tgttcttctt tatgctttaa gaggttttac    211740
     aaggtctctt tcttaggtat tttgctttca ctgcctacat caatctcttc ctttatgtcc    211800
     aaagcagtcc ttctgactat aaacacagga tcctttgtaa agctgtcaat gtttaagatc    211860
     tctccaaaaa acttaggcca ttctctatac gaatggagta gtgctcttcg atacctccag    211920
     tcattctcat agttcgtgca cagagtcttg gatattttca ataggaattc gttatctggg    211980
     aagtggtcta gaaccctgat ctgagaaaga aaagccttcc tgtagcgttt gcatacctca    212040
     agaacgattc tttccaattc ttgctctata caaaactcgg gggaattaag ccgcttggcg    212100
     ttcttaaacg tcttttcgtc gcccagcata gacatcttct cttcatcctt cgagagtttg    212160
     ttattctcct ctgtgctgtt aaataaatta agaaggattt tgactatctc ttccagatct    212220
     tcggcaatgt gtgcatagac agcatccgag actctttcga tcttgctttc gcatatctcc    212280
     tcaaggataa ggaacatttt cttgtgggga aaagaccgga gaaacttgat gtacagcttg    212340
     cttatgttgg aatagtcgtt gacagacgaa atagatatcg atccaaaagt gtctgcacac    212400
     cattcgatgt aaagcccgaa agttgtgtct gttacaggta gattatcaga cttcagcatc    212460
     tctctttttg aattcctcat tctcccaatc atagcctcca agactccaga atctattgct    212520
     tttaacttga atatgtggga ggcacataca ggttcgtact ctgtgcctat atacttctca    212580
     aacaaatcta gaagttcctt gtcaaaagac aagctaagat ataaggcaac attctcaagg    212640
     aaaaacctcg gagaaacaga ctcaatgtcc agcagatact tcttagcctc cttcagacat    212700
     cggctttcat ccgagggctt ataggaagca cacagacaag tcttgtcttc cgattcttca    212760
     actctacatc tacaaactcc atcatgacat tcctcttcat atggtctttg gtgaggtcgg    212820
     cactcaagag tgtccccttc caacttgttt ttagcttcct cccgatcttt actgttattt    212880
     gatggcgaag tagtagattc aaaaaatggc ttgtcttggc taaaacttag ttcctcaggg    212940
     agtccctcca ttccatcttc tcttctgcct ccccccgcac tatcaatcga atagaaatcc    213000
     gttttctttt cgcattctac tcctttatcg tccccaagct cccctaccga ggatattttc    213060
     atgtttttga tccactcttc catttccaaa ctgctcattt ccctggcgtc cttgcatcgc    213120
     ccacacttat acttcaagct tctttccctc ataagcctga ccttcaagag atacagctcc    213180
     acaagaaaat cctttttctt ctcaaacatt tcaaacagct cgtcaaactc cgccctgctt    213240
     gttctggtaa ataggaaggc tacaatatca accacctgtt ttgtgcatat tctggcaaac    213300
     ggaagaataa gcttgtaaag gtagtctatg tatcctgtag agactttatt ttccccactg    213360
     ctgattgaaa gaccgcattt actggcaaca aaacttattt cttcatcttc tttttgtttt    213420
     tcaaaatggt cttgtaaagc atttccaacc atctccaaca caatcagact tgtgttaaaa    213480
     tccaatagct tggtccccat cataatcttg accatcttct caaaatctac tgccgagtgg    213540
     ctatacacct gctgaatatt tctgtatgcc cacacaacat tctccgggtc gttcatattc    213600
     aagctgtcga tccggaaaga aaagtcctgg atgtctgtac agccagctcc cttgatcttg    213660
     ctgtccccca tcaatggggt caaaaatcaa catttatttc gagatctgcc gctcaccaga    213720
     tttaaaatta tgtatatctt tatacctttt cattaccatc atggtcttaa gatactccaa    213780
     ttaatactcc attaatctac tgtatgataa attctattga ttttggatat gtcataagga    213840
     acttttcatc acatgatttt acactcagac tacaaaggat atataataga ctctagtagt    213900
     atcagattaa ttacgaatat ttccaaaaca agaaaaagaa cacgtctcta gaacatattc    213960
     tttgtagttt aaatgtataa atagaatgca ataggaagga aattaaagat gataaagctc    214020
     tcacttctcc taagtctagc gagcttcact gcagttcttg caaaccaaag gcctcgctgc    214080
     caaagatgcc cagtgagcag cagtaagtac ttccaacaaa ataatcttct tggaagcagg    214140
     ttccaaaacg aggtacagag actttgcgcc cgccgtgtgc gagaagaaag ttcttctgaa    214200
     tcatcctctt cctctagctc tgaagactgc tcccgaagaa ggagaagacc ccacagagaa    214260
     tgggaggaca gctgttcatc atcatattct tcttgcagta gcacagatag ctgctcttca    214320
     agcgccccct gcccacctcc agtggctcaa aggtgtgata tcgaactcaa gactcctata    214380
     atcctgatgg gagaaaggat ctacgaattc ctcaagaact acgaggacca gtacaagaag    214440
     gctgttcttc ttttcttgac caatatcctt tcgcagatct caggattcaa cccagtcttc    214500
     cctggtggag actacgatgc tctgattgaa caactcaaga cacttggagt cactgtccca    214560
     gcaaacactg ctgccgagct tgccgccata gatgctgctg agtcgtcagc cctcacaagg    214620
     gccattcagg ccaatgcaca gaaggtaatt agcgatctac ttaccagggt cagtgccatg    214680
     tgctacttgg acatcatgag ccttgtcaac agtggtcttc tagccagcca agtctcaagt    214740
     gttttcaaca acatccagcc aataatcacc attgccggaa atgatttgtt tgccaaacag    214800
     atggcagtgt tccagaagat accaggaact ctgccctccg ctgccatcac agctatcacc    214860
     aatgctctcc aaggcaacag gaccaacttt gtcacattct ttacaactca gacaagcaat    214920
     ctgcaaacaa gcgtccagaa ctctcttaca accctgattt ctgagcttga gaagctggcc    214980
     accgacacgg agactgcctt cacagctttt gcaaatgcag aaatttcagc acttataagc    215040
     agaatcttcc caacatccac cacatcttcg ggatccggag actctacagg gtctggaagc    215100
     acgggagatg caggagatgc gggagataca ggagaggacg gcggagatga tgagggtaca    215160
     gaaggaactg gttagaacta cctatcctaa tgtctgagtc cggaatcggc tgttataaag    215220
     catagcaaaa tatcagccag gactcaaatg gcctcgtggt tagaatatgc ccatatacta    215280
     tcttcgctga tatcaaggct tttcacaagg ctgtaaataa aactgatttc caaactagtg    215340
     tattttaacg atgtgtggtt gggaagaccc atgaagtttg aggatttgaa aatcgaccaa    215400
     agaattgaga aaggattaag agaaagtgga tttgtagata tgaaagaaat tcagcagaag    215460
     gttattccaa tggcactgga aggacatgac ataattggat cttcgcagac cggaacggga    215520
     aaaacgcttg cttttcttgt tcccattttg cagaagttaa ccgatctcca atggagcgga    215580
     ggagatggtc ttggatgcgt gataatcact ccaacacgtg aactggcctt acagatattc    215640
     gacgtcctca gtaaagttgg aaaatacact gtattgagca caggattgat tatgggggga    215700
     cttgagacag aaaacgaatc tttaagattg agcaatatga acattctagt atgcacaccg    215760
     gggaggtttc tccagcatct gcaggagaat ccttatctaa ataccggggg gatccagata    215820
     ctggttcttg atgaggccga caagatgata gagatggggt tcaaagagac tttggaagat    215880
     atacttgggt acattccttc taagaagcag accttgctgt tttctgcaac acccaaagcc    215940
     tcaacggcta gaatcctaag gttagaagat cccaagatcg tttctatgta taaggaagag    216000
     ggatttccat ctcaactaca ccaatatttc tatatgatga ggatggaaga caaggtcaat    216060
     tatctacata cgtttattgg aagtaatcct ggagttaaag gaattgtatt ctttagtact    216120
     tgcaaagaag ttaagtttca ttatcttttg tttgaaaagc ttaagcttcg caatagaatc    216180
     ttttgtctca gcggtggtat gtcgcaaaag caaagaatag atacgttcaa aaagtttgtg    216240
     agagagaaaa acggaattct gttctgcacg gatctgggct ccagaggact ggattttcct    216300
     aaagttgatg tggttataca atatgattgc ccatgcaata ttgaaacgta cgtccatcgt    216360
     gtgggaagaa cagcccgaaa taatgagggt ggagagtcct atgtgtatct tgtttatgga    216420
     gaggaaaaac ttcttgggga tattcagaag aaaggatgga ttaaaaaaca agaaactgaa    216480
     agtaaagatg aagaagacag aggtagctct gaagaaattg tagaggggcc aaatatccgt    216540
     atcaagtcca ttgataggat gattaaaggc cttataaagt caaacaagga acttaatgag    216600
     tattgtagga agtatcttac tacatacgag aagttcctta cattcagtag taaaagatat    216660
     tccgagagca taataagaaa gatctcaatc ctatacgaat attttgggat ttcaaaagat    216720
     tagagacctg tttatttatt aaacaaacat cagcattttg tatttttagc agtagagcta    216780
     atactcgttt aatctcaaga gctgattata tttgctaact ctttctcccc gacagggtgc    216840
     acctgacttt atgtattctg ccccaacacc caccgagaga tcgcttataa aatgatcctc    216900
     tgtttctccg ctcctatgag aaaccatgat tttcattcca tgtcttcgag ccacctttat    216960
     tgcatttatt gtttcgctaa ctgttcctat ctggttaggt tttactaaga gtgtattgca    217020
     catttttctt attcctgcat tctcgacaag ttgcggattg gtgacagtca agtcatcccc    217080
     aacaatattg attttgtttc caacctcgga gtttatccat gtccatccat cataatcctc    217140
     ttcagagaat ggatcctcga gactatatat ctgaggatat tccctaagaa ttctcatgta    217200
     tttttctcct agatctcttg ttgtataaac ttcaccatcg agatggtatt tcccgtctct    217260
     taggaattcg ttggctgcaa aatcaatggc aattttcatt tctgttcttt tgcatcttct    217320
     ggatgcctct aacaccagct ccaatccttc ttctagcttc tcgattggcg gtgcaaaccc    217380
     cccttcatct cccaccgagg tatataaggc accgtacctt tcagatattg ttttctttag    217440
     agattcgtaa aacacgcatc cggactctat atttttctct aagtcatcgt attgatatac    217500
     aaccattatt tcctggacat ccattttatt tccagaatga atccctccat ttaaaacatt    217560
     gaagtgagga atgggaatct ttcttttgaa cattcctatg tccgaaagga attcgtcaac    217620
     tcgtctattt gaatatgctg cacccatttt gcagaatgca gtggaaagtg cgattattcc    217680
     atttcctcca attctcgact tgtcttttgt cccatccagc ttcaataagc aatcgtctat    217740
     cccttgcaga tcatcaacag gacactccag ctcaaatata ctttttgttg caacctcatt    217800
     aatattgttt attacagtct taactcctct tccattatag gacttccctc cgtcagaaac    217860
     caccacggct tctttggagc ctcgagaagc acctgacgga caagaagacc tataaacacc    217920
     ttttgatgtt atcaaatcaa cctcaattgt tggatgccct cggcttgtta gtatcattct    217980
     tggcttgatt tcttctaaag catctttgac tttcatcttg gttttgtttt tagatcttgg    218040
     attgagtcta taaatggtat tatccaattc cctttgacag gaaatgaaga aagacttttc    218100
     aaaacacttg aagtatcttt atattacggc actcaatatg attggaattc catcattaca    218160
     tagaagaaaa accaagaaaa tgaaaatgat atccaacaaa taccaggtaa gactgtcccg    218220
     agaaataaag aggacattat gttctacttg tctctcgatt cttgttccag gattcaattg    218280
     cacatcaaga atagtgagga aagagaacgg tctatgtctt aaaactgtat gtggatgtgg    218340
     aagtgagaaa atctttgtgg cccaaggaag ataattccaa ggtcttctat ctgacaatag    218400
     atcaattatg aaacacggcc atgtttcata acttagatat aaagatttgg gcttcacagc    218460
     gtatggcagt catggacctg ttgatagaaa agataaatga cctccaggac atatgtacag    218520
     aaaacaacat atcaaataga atcgagcttc cgcaaatagt agttgtcggt agccaaagct    218580
     ctggaaaaag tagcgtgctt gaaaacatag tgggaagaga cattcttccg agaggaacag    218640
     ggatcgtcac ccgaaggcca ttgatattgc agcttattta cagcaaaaca gaagactatg    218700
     ctgtcttcaa tcaccttcca gaaacaaaat ttacaaactt cgaggaagta aagaaggaaa    218760
     tcatcaagga aacaaacaga atcctaaaat caaagaatga cgtttcccca cttccgatca    218820
     cacttaagta ctattcctca aaagttctca cgcttacact ggtcgatctt ccaggattgg    218880
     taagggttcc aacaaacgat cagcctaagg atatatgtac caagataaca gagatatgta    218940
     gaaagtacgt atcgaatagg aatgcactaa tccttgcagt atcttccgca aatacagaca    219000
     tatcgaattc ggatgcctta cagcttgcaa gggaagtgga tcataattat gaaagaacaa    219060
     tcggagttct taccaaggta gatctgatgg attcgggaac agatgttgta gacatactag    219120
     ctggaagaat catatgctta agactagggt ttgttcctgt tgtaaatagg agccagcagg    219180
     atatcgaaag aaataaaagc atacaacaag cattaaagga cgaggaggtg tttttcctat    219240
     ctcatgagtc ttacaagagg aacagagcgt actgtggaac aggatatttg ataacaaagc    219300
     ttcataacat tcttcacgaa cacataaaac aatgcttacc agaacttcaa gaaagaatca    219360
     acagtggaat gattgatgct caaaacaacc ttcgagatct tggaaacata tgcttgagcc    219420
     cgaaagaaaa tgtaatgcga atcatcaaca ctgtttccaa aagattcagc gatattctct    219480
     caggaaacat cgagtctaag ggaaacgagc tgatgggggg agcaaggctg aactatgcat    219540
     tcaatcacca cttttcaaag ttcataaata ggcttggtgc tcttgacaac attcatgacg    219600
     agcaaataag ggcactactg tataactcta gtggatcgtc atctgtactg ctatttggac    219660
     atgtagcctt tgaaaagcta gcaagggttt ctgtggaatc cttcaagttg catagcttaa    219720
     agcttgtgag catagtattt tccgagctgg ttagaatgat taagcacatt gtagatgttt    219780
     ccacagcaag taggtatcct gtacttggag aaaggattat agcctgtgcg atcggaatgt    219840
     ttaaggaaag atgtgatgca acacataaac tggttgagtc attcgttgac tggaatacag    219900
     gatacatcag taccaggcac cccgacttta tacgatggaa tgaaatgtta tcaagggaaa    219960
     tggaggattc tgtacttgaa agaaaggcag aaaagataga cttctacaag ggaatggaaa    220020
     gcaaagccac tcttgattcc attcctaata cgttaaggat tcgcgatggg ctttccgagc    220080
     aagaggttat agagataaac atgattaagt ccatggttga gtcttatttc gaaataacca    220140
     agaagataat tgttgatcaa gttccaaaag caataatgtg tgagttagtc aaaaaggccg    220200
     aaaactcact tcaggagaca ctattcatgg agatatacaa cagggaagac ctggattcaa    220260
     tagcgtcaga gtcggaagaa gtgaagttag aaagaagtag aatagaatcc atgttaaagg    220320
     ccttgaagca agcctatgat ataatatgct ctttatgaga ttaaatatcc ttatcttatt    220380
     taattagctt ctttcaacaa tacaaacata tctttcttgt aatagttcga attcatatgc    220440
     aggttgtgga tgacatcgtg taatgggatg gcccttatgg aggaaaccgt tccctcatga    220500
     gctattttta tatttatgat atgaatgtga agtctaagat atgttggcct atagtggaag    220560
     aacataaata catgcttagg atccaaagca aactttgttg ccaagatggt gtttgcgttt    220620
     tcctgggctc ttatcagaag attgtgagaa tttatgtctc ttattgtttt gagggcagga    220680
     tctttgaata tcaccaaaag gtggagatgg tctatcaatt gcttattcca cttatagtct    220740
     ggaataatca ttatctcttg gtcctcatac aagatttcct catttacatt tcttttactt    220800
     ggatcgatga tattatccat ccaactagta cttatgtggc cgtagttttt tagaaaatcc    220860
     aagtattcct cgtaagtttc tctgatgtaa atgggactcg aagagtattt cctgatgtgc    220920
     tcttctgttg ccggatatat gagtctaaaa ctgatgggca tattccctaa gactttatag    220980
     gtatagtaca catcgtttga ctgaattctt tccattggaa gagataggaa ctgggaaaag    221040
     gtgtcttgtg gaacgggttg atttggaaat atcaatatag ccttttggcc ttcaaccttg    221100
     cctatgtaaa gatgtccctc ggagcttgta agactttcct ctagaatgaa tttcttgatt    221160
     acattttcca tagcagggtt tagattttta cgtgtaatgt ctaatcccta atgaaagatt    221220
     ctaaccaaaa agccaacgaa aaagcaaaag agttactaaa aaagatggaa gagtgcatgg    221280
     gtataaagat tgagggaatt tgttcacaag aggattattc tgacgtcata aacagatgct    221340
     gcgaaaatct gattggttat aaaaaggtac ccttaggggt ttcaaataga ggggtattaa    221400
     taaacaaccg catgttcttt attccaatag caacgacaga aggtgcattg gttgcatcaa    221460
     tgtgccgtgg aatcaaactt ataaatgcat gcggaggagt tgaagggtat gcagaaaacg    221520
     tcgggattac aagaggattt actatgaggt ttgaaagttt tagggaggcc atgaggttct    221580
     accagtggat aaaaatggaa aagtcaattg caaatctcaa aagaattgga aatgaaggaa    221640
     gcaggtatat gagaatcagt aagattgaat ccaagcatgt tataggggaa gatgtataca    221700
     ttaaggtaca tgggtactcg ggagatgcca tgggaatgaa tatgataaca aagtcatgtg    221760
     ttcaaatatc taatgaaata gttcgtttat ttccaaactc tagtcttgtg tgcataagct    221820
     ctaacacatg cactgacaaa aagtggtctg cagaaaacta ttgtaatgga agaggaagaa    221880
     agatatttat gaatctgaga gtagacaatc gaaactgtga agagatactt ggagttaaca    221940
     tagatagaat tctagatgta tatcatgcga aagttgtggt tgggggatct cttgtgctag    222000
     ggggatttaa ttgccaagca gccaactacg ttgcagggat atttctagct ctaggacagg    222060
     atctaggaca aattattgaa agtagcaatt gtatattgag catgaaaaaa cttgaaagtg    222120
     aagttctgag tgtttctttg tttatgcctt cggttacagt gggtgtggtt ggtgggggta    222180
     cacacctgga accttccaaa agctttttaa ggcaatttag caatgtgaat gatgaataca    222240
     taataacgaa taaagatgaa gacaagtcgg tggcacctgg atacttggga ctagctctag    222300
     gagcagcagt acttggagga gagctatctc ttttgggatc tcttgcggat aacacattaa    222360
     tggaaagtca cttgagattg aatagaagac aagggtagga ttgaaatgat ggtttagggg    222420
     cttgtattaa catgccctgg agccaatagt ttataatggt ctccttttga tctatcaatg    222480
     atttttcttg tatcaaaaga ataaaaataa aggcccatca tattcggatg tcaattaggc    222540
     tgacgataag ataccgaaca gattccatag aagcaagtgt aatgatgacg gatactctag    222600
     aatccttgaa actaagaatt caggaaatta caggagtgcc agtggattct caggtgcttc    222660
     tgttcaatga cagagtcctt aacgacaaca acaaggaact gaaggagctt ggaatagaga    222720
     acgactccac tttgtatctt aaaaaaagat ctggagctcg gaaggaagga aagcgacaag    222780
     attttactgc ttccatgatg aaaaaccctt tagttaagaa ttttctgaag aatccagatg    222840
     ccatgaagag cattgttgag atgttccctg ggctcaagga agaaatgagc aataatccag    222900
     aactacgaat gatgatgaat agctcaaatc tccaagaaga actcgaaatg ttttccatga    222960
     atccggaata catgaacacc cagcttaaaa acctggacat aacaatgtcc aagctagaga    223020
     acatccctgg cggcctcaat atgataaata gcatgattaa ggacgttcaa gatcctctgt    223080
     cgtcagcatt gaaagaagga atgggaagag gatatagagt gaaggaggga agaaagatag    223140
     acaagcccat taatgaagca attccaggtg cccgtaaaga agagagtcaa ttggtgaaat    223200
     atagagataa actggcagag cttaagcaga ttggattcag taatactaga aaaaacttca    223260
     cggctcttat cgcatgtaac ggggatttag agagatcaat aatgtattta cgagagctgg    223320
     acagtaaatc atccccgaca cagagggcaa aataaaaata aaggcgaggc cttactgcat    223380
     tcttctttcc ctagggttgt tgtgtctgtt agaagccatt tcgaaattgt ttttaatagc    223440
     aaggtacact aaacttcgct cccaatatac ttagaattca cgaggtcaat aaatctacat    223500
     acgctaaacg agcatatccc tgctatgtca cagatgttgt ttccattctt ccttagctta    223560
     agaagatcat caaacctgaa cgagacagga tgggaaacca aaatattctg gacataaatc    223620
     tccacgctaa agagaagagg agtgtcggag agaaatagga agaatatctc ggagatatcg    223680
     ggagagtcat atatttggac caatactccc atgttcatta acttctcagc actgtactta    223740
     tgagtcccat atttagaatc cctaatgata tcgtcaacac cgttaaatcc aaacaaggac    223800
     ctcctcttga tagccaattt tgcagcgaaa gagttgagat agttctgata aagctctatc    223860
     tttcctgata ggtaatcatc tttgtagcat agattgtcgt aacttatctc atttatcctg    223920
     agctctttgc ttctttcttc agacatgaat ctcagaatga ctatatcttg agctagcata    223980
     aagaggagtt ctgaatacag gttatgtcta ctagtgatct tcttatcttc caagaagttc    224040
     aaatcatcaa tgatggactc tttcagctgg tcgatagttt cgtattgctt tggtggagat    224100
     gctattgaca agccgtcatc ctcctccttg gtgcaaatag cactcttctt catttccaag    224160
     tatcgggatc tctcctcttc atcggattcc tttaaaagca tctcaagcaa gtttcttccc    224220
     ttgcacaccg atatggcata tataagcttt ctctttaaac ctcttacaaa gttctccaac    224280
     gctatctttt cgggatcctg agaacatatc cattcaggcc caaagaaagt gaatgagagt    224340
     gttttgtttt gatcgtctgg gaacaaaggt agggtctcaa gaatctcaca caactccgaa    224400
     ccaagtatcc tagtgttgct taggaggaga gttattaatt ggtttgcagt actacttgga    224460
     agatgtacgg ttgcccgctt gagctttccc aactcattca tcgactcaaa ctggaagtaa    224520
     tgatcaagtc cagagacgtt tgtaagtttg gaaagaatag attgatatct ttcgtggcac    224580
     cttctgaaaa agggataaag aggggaatag aacctaagtt caaagttctt tttctcccca    224640
     cttataaagg acatgtactt actcattccg tccccgtctt tttcctcttc accgttgtct    224700
     gattcctcga agaacattac tctgtctgct atatgttcca gaatcttgga tattataaag    224760
     cacttatttc taagagattt cccaacctca aatgattcaa taaatgcatc cggagcaaga    224820
     atgaaaggca ttacaaattc cgaatagaat gtcctagggc cgtatagctt aaggaagtat    224880
     ctaaggatat aaggaattga ttcaacacta gactccagaa gatccagcgc cgatgcaatc    224940
     actccacgaa ccaccataag ccttgtctgc accgcttccc taactctctc attctccaat    225000
     gctttgtccg cagacgtact ttggttgaat agcattttgt atatgagaac cggattcgca    225060
     tccacttcga tgttttccag gttctttaca acttgaagaa tcttgtctcg aagaacaaag    225120
     ctcccctggg atatcctgaa atagttaacc attaacttgt gggaaatcga tccaggcatc    225180
     aaagtatggt gaactgggaa ttccacttct ctaaataact cgagagagaa aaaggtacta    225240
     gaatggattc ctaaagacat gtctatcggg acgagtttcc ttacatcaag tccattatcg    225300
     agaagctctt tcctgaatat ctccagcaca aggtttataa acatgtattc ctctttcttt    225360
     gaagaaacat tggagaagat aggaataatg atggagacta taaaagaatc tgggtcgtta    225420
     acgtttctaa gaagctcaga aagatactta gggttgttct gcaaaaacag taatactctt    225480
     tcaaagtctc tggtgtcttc atcctctgga atcggatttt tgattgttat gtttcctact    225540
     tccatcctgt tctgaactat tagtctaatt cttgtctcaa tgtcctttat ctgtgcttcc    225600
     ttggcataga tactgtcaaa cttccgtgat atcttgtgat gaagattttc tataagattt    225660
     tccttgacca tctcggatga attactgaag aaaataaacg caaaccttcg gatcgaaaac    225720
     agagagacct ccttcctata gtagatatca tcaaaacatt ttttgtacaa aaaggtccga    225780
     agagtcagct tgagaatatc aaaagattcg tcacaaacac ttatgtcctc cgatagaaaa    225840
     ctcccttcct tttcttctac attctcctga tctaaaatct cttttcttac tttattttcc    225900
     ccattacctg ctgcttcctc catagctatc ttttccttta gcacatcttc aatgttgtca    225960
     aacttaggca tgttcatctt ctcaacctga acatcagctc ttgccatatc atcataggaa    226020
     aagatcttcc ctttagcact cttgatattc ttggaaattc cctttgaact caaaagatgt    226080
     gctaaagcat ggatgcagta tatgacctta acaaagtttt tcttttcata taagtcgata    226140
     acctcgaaat ggaagtattc cggcagtcca atatgcgata ctccacttaa aaagtagttg    226200
     atattgtccg tgtgcctgta ttgcaaagta caatcaacaa aaacattttt tacagagtta    226260
     ggtgcaaata ctttgcatat atcagtaaga atcactcctt tcctcatttc ctcttcaaac    226320
     tcttcaaatg attcaggtac agaggtaaaa tctcccaacc acgacttcgc ctcctcaagc    226380
     ctgcataggt actcgtatgc ccgagtgttt cttctctcta agtccatgtc ttcagacgac    226440
     acatgaacat cggtacctaa cctttggtga acattaatac tatttttctt gagctcttct    226500
     tttttgcttt ccatgggtga aaaaaaactg cagaatttat aaggattatc aaaggtatcg    226560
     agtcttagag cctaaaaaca tttccccctt agatgcagga gttactactt aactttattc    226620
     atactttctt tggaatccac gggaagtctc cttctccttt atttctggaa agtgcaatga    226680
     ggtacctgaa gccatccaaa tttgaagcca tggaggatga cgaaatagag aatgcaatca    226740
     aaatcaaatc atacagagca tatttggcat acagaagaat gaaaaaaaac atcattgcca    226800
     agatgctttg ttatgtacta gctaatgtgg ctgactccga gatttcagta atgtcagagc    226860
     tagatagaaa tgtgaagaaa ggagcgttag ggattgagat ttcctatttt tcagaagcaa    226920
     gtcttccttt actcaaagaa agtgttggta cacacatata cggaattgca tttcaggtgt    226980
     accaaaatgc atgtatatat agaaagctta gatcagaaac atctttttct tctaaggcac    227040
     actcatactt ttacgaaatc gtaagagagg aattggaaaa gtatgaaaga tcagtaattg    227100
     agcaggatga ggaacttctc tctttttatg tcggtatgta ttctcggtac ataaggattc    227160
     agataattca ccagctaaac gaatgtttta gagataatcc taagaaaccc tttgagttcc    227220
     ttaaattcaa ttttctctcc aatcatccat tttacagaca ggttttggaa tccagctgtt    227280
     tgcatatcga cagctgcctc caagagtttc tattgacagg atcctttaaa gacgatacta    227340
     acgagttttt catatgccgc aaagtaacca tcgatccttg ggaggagttc actattgatt    227400
     ttggccttgt cccatatttt attagcaaca gagtagttca aaagatcttg tatataggga    227460
     agtgctcatc tcttataaga agatatgact tggagagaat tggaagccta gatacctttc    227520
     aagcttcaca aattgaatcc agaatggaga agaccaccga aggagttaat ttcagaaacc    227580
     tggttgaaga agaactagag aacattgcaa gacaaattaa tattttaaat cccaaccttg    227640
     aagaaaacat agatctaatt ctccataaga tcaacaaaaa gataagacat gactttctca    227700
     gttgccctgc catatgcagt cagattgaag gaatcaaaaa cacctttttg tttagaagat    227760
     gtgattttat tgaaacactc tttctttacc taaaagacag tagggatctt actagaaaga    227820
     gttttagcta cgttctggac cttgcaatta gaaacactta tggagatgtt gacgaattta    227880
     cttcgggatt gggcgtatat atcgtggacg acgaaaacaa atacgagaac tttgcactat    227940
     tttgccaggt aagctatcca gcaagcataa taattacaaa ggaaagtgtc ctcaagcttg    228000
     tagcaatatt ccaatttctc tggaagctga agagagtcga acatcttctt ctgagaattt    228060
     caaagatgaa aatggagggt aaaaccaaga ttaagattgc ttcctacaag actttggtat    228120
     ataaaataag ctattttgtt ttccaagaag tgattgaaaa aaaatggaac ttcttctctg    228180
     catccggcga aatgcctttg aacaaactaa ggttaggaat ggagaaggta ttggatgagg    228240
     tcataaacat atgccaaatt ggaggaaaaa tggaagctct tcttgactcc atgaaagatt    228300
     ctctaataga tacaggagcc agatcctctt cgtttagcga tgaagagatt caaagaaaac    228360
     tatcggagct tgtgaaagag catggaaata gttttattgg aacgtctcta tatgacctcc    228420
     acaaatattc taaggccatc aactagcacc ctcaggctgt actaaagata ctccttccta    228480
     tctttctcca ttattcccga tttgactatt tttacaggag gtatgggtct agtgctatag    228540
     atatctacct tttctatatc cttgatcagt gaaatgcagt cttcattgac attcccaaag    228600
     actacgtgct ttcgatcaag atgaggttgt ggagaaaagg taataaagaa ctgagaccca    228660
     ttggaatttg gcccactatt ggccatggat aatttaccga ttccatcatg gccaaatatg    228720
     aatttttcgt cctcaaaagg ttggccgtca tatatagaaa tagacccggt gccatttcct    228780
     ttgacaatat ctcctccttg catcatgaac tcgggaataa ttctatgaaa tatggaacct    228840
     tcatatttat aaaattcgtt tccaatatgt gttccctcaa caagtttata gaaattagca    228900
     gctgttttcg gagcagcatc ccagtataat tcaaatgtaa ttcttccgga tttctttgtt    228960
     ccattaacca catactccac gtctaaatac ggagttcctc tgtttggcga tgtatttact    229020
     cccatacaaa gtaataccag taagacagca ccatggattt tcatgatggg cttgggccaa    229080
     aaaccttaaa ttattaataa aatttttaat gcccttaaaa atggaacttc tagactatgg    229140
     aaagcttaaa gttacaggtg agacaaacca ggagtcaaca aaggtcagga ttatacttta    229200
     cagtccctct aaggaaggag ttgatataaa aagcgagaaa aaagattcca gccatcaagc    229260
     ctttcttaat agaatgggcg caaaaggaaa ttcaggtgaa agttatgtgc ttccagaaga    229320
     gaatggaaaa ataaccgtgt ttgtaggaat aggaaaggag gacgaaaatg tttttcttgt    229380
     taaaaataat gcaaagaagg caggagcctt ggcatacaaa gccgtttccc aattcaaaaa    229440
     cttggagatc tttttagaat cggaatttat gggaaaagag gttgcatctg gagtaacact    229500
     ggcttcatac aaatatcaat tcttgaacaa agagaaagga gaacctaaga aggtggcgat    229560
     aaacactcag tttccttctg ttaaaaaggc aataatgata ggcaatgctc agaatttcgc    229620
     taggttttta ggagatacac cagcaaacct catgaatcca acattgttta ccgaatatgc    229680
     tgccaagtat ctgcatggaa agaagaatgt tacatttgag gtttttggaa aggaatttat    229740
     gaagagtaag tccatgaatc tcctcttgag tgtttcccaa ggatcggttc aagagccaaa    229800
     gctctttgtt gctaagtaca gaggaaaagg aggggatggc gtagatattg cactggttgg    229860
     aaagggagtt tgctttgatt ctggaggaat atcattaaaa ccatctgcac ggatgtccct    229920
     catgaaggga gatatgcttg gggcagcttc tgtcctaagc gtctttgggc ttgcagcaga    229980
     tatggaaatt aagataaaca ttgaccttgt aattccgttg gtagagaatc ttcctagtgg    230040
     tactgcaaca aaaccaggag atgtttacat aggaatgaat ggaaaaagtg tggagattga    230100
     caatacagat gcagaaggga gactcattct tgcagacgcg cttgtgtatg cacaggaagg    230160
     gcatcctaca tatatatttg atgttgccac cctaacaggt gctatggccg ttgctcttgg    230220
     agatgcattc attggatatt ttacttctga tgacaaactt tcggaaataa tctatcaaag    230280
     cggaattgat gctagtgacc ctacctggag aatgcctttg tcacaactgt atttacctac    230340
     aatgaagtct gatgttgcgg atctaaagaa taccggagaa ggaagatacg gcggatctgc    230400
     aagtgcagca atctttttga atgaatttgt tggaaaggaa tacaaatggg ttcatttcga    230460
     tatcgccgga gtaatgaata gtaataacag caaaggaatt tatggagatg gaatgactgg    230520
     atgctccgtt tctgcattga ttgagacaat tgaaaagcta tctacaatag ttaattaaat    230580
     atggtgtctc gtaggaggat ttggtcgtcg gaaagtgacc ttgagatcac gaacttagct    230640
     aaatttcaat tactaatcat atcctcgatt attcttccta tatctttcat tgcattgccc    230700
     aaacattttt tcttgtaatt atttcttttt ttgagaaagc gatccattat gtaggagaaa    230760
     tcatatttcg aaaacacaag gttttcctta acagcctcta atatagagtc agtgtacttc    230820
     acatcatatc ccttattaaa cactctactc tccagcattt caatacatct aaccagctgc    230880
     tcttctatga gaaaaaccat cccactcctt ttgatgcttt ctattttctc caggtccttc    230940
     acaagaatgg tttgttcttc taaaaacacc ctgaaatatc caaagatatc ttcaatgaaa    231000
     cttttaagag gttggatttt gtttatcctc ttgagtccat ctttgaatct ttcctctaaa    231060
     aacgaaaata cgtaaggaga tattcctttt tttccctttg aaataacaga aagatatctt    231120
     accatttctg ttttatcgtg aaacagaacc ttgggcgaat ggaaacactc atcggcttca    231180
     atatattcgt attgctctgt aaatacgaga taatcaataa gctctttatc aattacaggc    231240
     ttttgtacag tggaatctgt ttttttcttg taggtgtagg ttaattcttg gtaaattcta    231300
     agtatatatt ctacactttc cttattcttt tcaaatacat acactgttgg actcaccttt    231360
     atctctaata aatcatcttt aatctgaatt tgaatgatgc tataactata agcattcaag    231420
     agcctgtatt tcttggctcc ttcttgaact ataccgatca gaaggatatc atttgtcatg    231480
     ataagaatac attcctttcc gcttttttcc ctgagaatat caaagtgaac caagtatctt    231540
     ccttccgtag caaacacatc aacttcattg tcaaaattat ccagaactcg tctaaatttc    231600
     cttacaagat ccttgtcaac aaagacttcc tcttctacgc ctccgtccat gttataccta    231660
     actagctctt tggttaaatc aaccatacta gtaaccattc tataggactc ttcatagaca    231720
     ttaagaatat cgagcaaaga atcactattg agaaggaatg ttttaagcaa ctcagtatcc    231780
     acttcatgtt ctatcttaga tatgttatgt ctttcgtttt ccagaataaa accttcgtac    231840
     ctctggaagg tgttatttaa ataggactcc aagtcaaagg agttgaacct tgatatttta    231900
     cttgttaaat ctggcattaa gggcttagta catggttcat aataatcgtt tgtttatgcc    231960
     aaaatgtttt tatccccatg aggaaattcg atcaacagca aatcgatcaa gttttaaaaa    232020
     agagattctt tctggctcaa tcagcacata tatatggagg aatttcggga ctatacgact    232080
     taggcccacc aggattgtca ataaaaacaa atatcttggc attgtggaga aagcactttg    232140
     tacttgaaga agacatgctt gagatagaaa cgaccaccat gctgccttat gatgttttga    232200
     aggctagcgg gcatgtagat aaattctgtg acatcttggt ttttgacgag gtgaccggag    232260
     actgcttcag ggcggaccac ttggttgagg aaactctaga aaaaatgagt cccacagaag    232320
     aagttattcg agaccttcaa agagttgatt gcatgacatg ccaggaaatc gacgcagtta    232380
     tatcaaagta caacataaag agtgttttgg gtaataagct aagcaaatca cagcagttta    232440
     atcttatgtt tggaacacag ataggttata aaggaggcca aaccatgttc ttaaggcctg    232500
     aaacggcaca agggcagttt ttgaatttta aaaagcttta cgaatataat aacgagaagc    232560
     ttccatttgc atctgcctca ataggaaaat catacagaaa tgagataagc ccgagatcag    232620
     gcctcattag agttagagaa tttgaccagg cagaaatcga acacttcgtt ctccccgacg    232680
     aaaaaaaaca tccgaaattt tcctcagtaa aagaaatcaa attgaagttt atacaagaag    232740
     attcaagtga ggaaatctcc ttgggagaag cagtagagag aaaaatggta tgtaatgaaa    232800
     ccatcgggta ctatattgga agaactgctt tatttcttat agaagtagga attgacaaag    232860
     aattgctcag gtttagacag cataaaaaag aggaaatggc tcactatgct aaagactgct    232920
     gggacgcgga gatatacaca tcttatggat ggatcgaatg tgtaggaata gcagatagat    232980
     cgtgttatga tctaaaatgc catgaagatg ggtcaaaagt tgatttgaga tgcaaaagaa    233040
     gactcaccaa tccaaaagag gttgaagaat ggattctaaa gctagataag aaggaatggg    233100
     gagcaaggct cagagacaga ttttctactc taatagaaat gatcaacggc ttttcccaag    233160
     agtatattga aaaaaacatc tcagctcttg atggtaacaa aaactaccta aatgtggaat    233220
     tcgatggaca tggcatcaat gttgagtgtt ccaaagagaa gaaaaagata tttgttgaaa    233280
     acgtaatccc cgatgtaatc gaaccatctt ttggtattgg aaggattctt tacgcattac    233340
     ttgagcattc gttctaccag agagaagatt taagacctgt acttaagtta aagccaatga    233400
     ttgcgccaat ccaatgtgct atcggatacc taatatacta caacgaattt gaggaacata    233460
     ttttgaagat aaaaaggtct ctggcagaaa atggactagt ggttcatgta aacgaacggt    233520
     cgtgcagtat cgggagaaaa tattcttcat acgatgaatt aggtgtccca ttttttatca    233580
     cattcgaccc cgactttctt aaagacagca tggtaaccat aagagagaga gacacaatga    233640
     accagataag ggttgatgtt gaaaaatgtc cctctatcat cctggaatat atcagagggg    233700
     aatctaaatg gaattaaaga gctataacac ccccgttcat ttctaatttg atatttcgaa    233760
     aagtgatggc ccttttatga gaacaaaaag aaaaattgta attctgatag ttacctttgt    233820
     agtacttctc atactcttta caacactcat tgtaagaagg aaaagatcat atataaattc    233880
     tagaaacgcc agcggcttag tgaagtctaa tataattacc aatgagaact cgggaattcc    233940
     ctctaccaag gatagaggcc tttcctttgg tcttacaagc tggcaattga aagaaaatgg    234000
     atctttaaaa aagatagata gcattttcat gccaattctt gaaaaggcct ataatttaga    234060
     gaaaaaagaa gatcctgagt ctaaaaataa ggatgaaacc atcgaagatg agctattcag    234120
     gcataatcaa agactaatct cctttaaaat cgaaggaaag cattcgatag gaaattatct    234180
     atttggttta ctgagaaaaa ccatcgataa catttgtgct tgttctcctc ccgatgggaa    234240
     aaaacacgaa acatttggga tcagttcgga gcatacagca ctcattagac attatattaa    234300
     gtatttcaaa acattcgttt gcatgcccaa agtaatttat cacggtaata ctgagccaga    234360
     agacatttat aaattgcatt tcgactcaat caattgcttc atcggagctc ggctaacaaa    234420
     ataccatacc gcaagttcct tcactaaagg agaagaaaag tacatgacat atatagagca    234480
     attcatagat acagaagcaa gtgatattcc tatagaaatt ctatcagagg gaagggagag    234540
     attgagtgtt aaagatcaca tattatatac gctacttcat tacatttgtc tcttttattc    234600
     aaaatcccaa gagactagag acatgctcta tacaaagatg aaaatagaaa aaatgggtat    234660
     atcttctatc aatttatcaa agataatcaa tgattataga tacagtgaca tagttgagag    234720
     tataagacct attcactttg taaatgatag ttcttgcata gtaaagccat taatagtaaa    234780
     ataaaaatat cagaatttat taaatggtta cggaaagtaa aaaaagagag caaatatata    234840
     ttgctaaaga tttgcagtta gggctgaaat agtgtattcc aaatgtaagt               234890
//

If you have problems or comments...

PBIL Back to PBIL home page