(data stored in ACNUC8465 zone)

HOGENOMDNA: ENINT1_11

ID   ENINT1_11; SV 1; linear; genomic DNA; STD; FUN; 236244 BP.
XX
AC   CP001952;
XX
PR   Project:42703;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Encephalitozoon intestinalis ATCC 50506 chromosome XI, complete sequence.
XX
KW   .
XX
OS   Encephalitozoon intestinalis ATCC 50506
OC   Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-236244
RA   Corradi N., Pombert J.F., Farinelli L., Didier E.S., Keeling P.J.;
RT   "The complete sequence of the smallest known nuclear genome from the
RT   microsporidian Encephalitozoon intestinalis";
RL   Nat Commun 1(6):10-10(2010).
XX
RN   [2]
RP   1-236244
RA   Corradi N., Pombert J.-F., Farinelli L., Didier E., Keeling P.J.;
RT   ;
RL   Submitted (22-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Botany, University of British Columbia, 3529-6270 University Boulevard,
RL   Vancouver, British Columbia V6T 1Z4, Canada
XX
DR   StrainInfo; 819376; 0.
XX
CC   Linear chromosome is missing portions of the telomeric regions.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..236244
FT                   /organism="Encephalitozoon intestinalis ATCC 50506"
FT                   /chromosome="XI"
FT                   /host="Homo sapiens"
FT                   /strain="ATCC 50506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="nasal tissue"
FT                   /db_xref="taxon:876142"
FT                   /culture_collection="ATCC:50506"
FT   gene            <774..>2204
FT                   /locus_tag="Eint_110010"
FT   mRNA            <774..>2204
FT                   /locus_tag="Eint_110010"
FT                   /product="phosphohydrolase-like protein"
FT   CDS_pept        774..2204
FT                   /codon_start=1
FT                   /gene_family="HOG000150375" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110010"
FT                   /product="phosphohydrolase-like protein"
FT                   /note="similar to ECU03_0100"
FT                   /db_xref="GOA:E0SA76"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA76"
FT                   /protein_id="ADM12503.1"
FT                   /translation="MKLLLFFGLVLSSYADPLYRLFLPDLQDPPHPLIEDLLCHPLFSR
FT                   LHRVAQLSSLKFFFPHGNIHRAAHSRGSSIAASIYINALNQNSPPTSRISPLQSLAVQV
FT                   AALLHDIGHGPYSHVFQRAYSSHCPPLKPWSHELQSTRIACHLFNELRLVSKYNLPNDF
FT                   LYAVCDMILGISPRRHARKYGASSHFSSYVIFTIVNGDLQDSLDVDKFDYMRRDSRMCC
FT                   HPSYARIVDNAVCEIILNSRILNDRIVYSSRAAPALAVFAHCVYLNYRYLYYHPHAHGL
FT                   NLLIHRIFEELIPRHPHLFNLRDLHAFLALDDNLLDGFSDIHPDLQSLIGRFHARIPYL
FT                   FLAYRDLPDSSALNNAKQAFLHALRDSPYIQPYDYVLDSCHFAHIIRNPLHTNILRRVV
FT                   FYDLSDPEESFFLFQPYLQDLLNSSPSELFFSSKEIYYSFAVPFHETCIQLRLYCTSQD
FT                   PKKSALLLEIFNHALPLD"
FT   gene            <2311..>3081
FT                   /locus_tag="Eint_110020"
FT   mRNA            <2311..>3081
FT                   /locus_tag="Eint_110020"
FT                   /product="hypothetical protein"
FT   CDS_pept        2311..3081
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110020"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0020"
FT                   /db_xref="InterPro:IPR019081"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA77"
FT                   /protein_id="ADM12504.1"
FT                   /translation="MNSHETPETIWNSLYHIPESTEKKIHQVKDLYNRFISPMSTLFPS
FT                   LIFLIFSEGKVSGNLFLRFLVFILPLSYLSIHHFSLFFTTKKLEDKSPNVFHSFLKILF
FT                   LSLSIIFTLSIILFPIRSLSNNNLKKAATLFLPRAVLSTYLLSISCSLELMSFIDTEQD
FT                   ALLDLAIFICIITSGVIFSKFEKIHLFLFVVSSFILIPLRSLKEKHKPSPKSTEVTLWR
FT                   QALFALILLIIITTYIFSAYLCMFNPCAQESIPS"
FT   gene            complement(<3467..>4054)
FT                   /locus_tag="Eint_110030"
FT   mRNA            complement(<3467..>4054)
FT                   /locus_tag="Eint_110030"
FT                   /product="3-methyladenine DNA glycosylase"
FT   CDS_pept        complement(3467..4054)
FT                   /codon_start=1
FT                   /gene_family="HOG000224224" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110030"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /note="similar to ECU11_0140"
FT                   /db_xref="GOA:E0SA78"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA78"
FT                   /protein_id="ADM12505.1"
FT                   /translation="MEMDVPCAELAKKLLGKILCRRINGKTMKGMIVETEAYIGQEDKA
FT                   CHGYGGRKTERNSAMYMKAGTCYVYRIYGKYECFNISSIEAGAGVLIRALEPLCGISEM
FT                   KKLRGGGIKERDIGNGPSKLCIAMGITRKEINKEWIGDSSRIWLEEGREVEDFEIVAGK
FT                   RIGIRNCGEWEEKMLRFYIRNNEFVSCIRRRR"
FT   gene            complement(<4369..>5163)
FT                   /locus_tag="Eint_110040"
FT   mRNA            complement(<4369..>5163)
FT                   /locus_tag="Eint_110040"
FT                   /product="leucine-rich RAS suppressor protein"
FT   CDS_pept        complement(4369..5163)
FT                   /codon_start=1
FT                   /gene_family="HOG000149245" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110040"
FT                   /product="leucine-rich RAS suppressor protein"
FT                   /note="similar to ECU11_0170"
FT                   /db_xref="GOA:E0SA79"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA79"
FT                   /protein_id="ADM12506.1"
FT                   /translation="MVAGIFIRCDDESSQQRDSLAKHTGIIRKFDYSNQGLTSIPDEIF
FT                   NVPYSSHITEINLQRNKIHKLPSRIGNLQRLGKLYVNDNKITFLPKEIGKLLQLWDLDV
FT                   SNNNITWLPMEIGNLRSLFRLKINNNNLRRLSVNMEKMLSLHELHAECNKLRTLPNTFR
FT                   KFLNLGKLYLRNNLFEEIPEVICRMHYLEKLDMRDNKIQRLSRKIVERLFDHEMLEKID
FT                   LRGNDLKRESDSEWVGWEELEKLFKDQVLLSQLGRPGIDDVE"
FT   gene            complement(<5481..>6698)
FT                   /locus_tag="Eint_110050"
FT   mRNA            complement(<5481..>6698)
FT                   /locus_tag="Eint_110050"
FT                   /product="Ser/Thr protein kinase"
FT   CDS_pept        complement(5481..6698)
FT                   /codon_start=1
FT                   /gene_family="HOG000149244" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110050"
FT                   /product="Ser/Thr protein kinase"
FT                   /note="similar to ECU11_0180"
FT                   /db_xref="GOA:E0SA80"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA80"
FT                   /protein_id="ADM12507.1"
FT                   /translation="MNKKVLTFPSEKVGLSSDNVEFDLVMSRGDYLSKNKAQRYMVIDM
FT                   LGTGTFGQVVRCVGPEGEEVAIKVVKNQPKYYNYEMNEVRILHKLLYNNLNDRFVSIKD
FT                   VFMYKQHLCIVEELLGKNLYTFLKMTRFKGFDHITLRTILQQVLEGMIQLSMLGIIHCD
FT                   LKPENILIADYETFKIKIIDFGSAVTSPQGSHFYVQSRYYRAPEVILGIPYGSSCDIWS
FT                   LGCIGYELYVGHPLFPGKDNMDQMGRIYGLFGSLPMFMIEHGKNSNIFFEKENGYRFIG
FT                   PASNFTLEDMKKIIRSKCNSQDDDDMLIEFLLKALQPSHLIRPDARSLANHSYLKLKDV
FT                   SPELNKIHDSRNGVQQSILPASKNMRHMSTTGIILPSKKQKSTNDRRKISVYGISYENN
FT                   LNRDAE"
FT   gene            complement(<7354..>9984)
FT                   /locus_tag="Eint_110060"
FT   mRNA            complement(<7354..>9984)
FT                   /locus_tag="Eint_110060"
FT                   /product="histone deacetylase complex protein Sin3"
FT   CDS_pept        complement(7354..9984)
FT                   /codon_start=1
FT                   /gene_family="HOG000149243" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110060"
FT                   /product="histone deacetylase complex protein Sin3"
FT                   /note="similar to ECU11_0190"
FT                   /db_xref="GOA:E0SA83"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA83"
FT                   /protein_id="ADM12508.1"
FT                   /translation="MPRDYEKNLSNQESESWQDGGHVRKRYYPDEGIPRYGNQGDMRGG
FT                   MRGYYSDGGHMASSMGIKSRDSGLDQGVVSRGITGSSPPRTSHEDADLSDAMMFLNKIK
FT                   EEYANDMVTYDNFLETMRDFKFGKIDAEEVCRAVRVLFRDKPHLIEIFNDYLPVHLKFY
FT                   GNPSVGTVARPSDRQMQGIGSSSQYRGGLYGSSGRMGHPQPGINGPSYISPHHGIHQSY
FT                   GSQPLVMHSSMKMSGQEGKYAPYDQRRTEEFERMKARQAQDFIQKVKKRYSHNPSIYRS
FT                   FVEILQSHQVKNGLFEKMKAEVNSLLWESPDLCEDFERNFVPSRRHMLYDEKNILHRIK
FT                   ELLKSKNLLDDFLKCINYFNQKFINEKDLLELVAPLLKNEELIRGFKAFINYKEPLRET
FT                   PRSLEKYKKEGSYRILPEKIKSERQDPIAREVLNFTCIGCPTFESEDSNYVFLKRNVHE
FT                   EALFRIEDERSEADLAVERTQYFINALEQIISSNKDSEISMRDIKMSPGIIKEILKSIY
FT                   GKSAQEILEGILMKPHIAIPIVIKRLYMVNKKLRLCMKEKKKIWREVIERNYHKALDVT
FT                   GPSYKSSEKSIFTTKNIVETGEKGLKAMINDQEVVLDVMDICKAYIKANQAEGKKILVS
FT                   NVNSALESVFKKLEEKEFSFVSDFPLLCIFRFVIIIYERLLEIKKLDVADSFVNDQRGR
FT                   QNETSRYLEVKNLCLEFMKKNVDGYTFEDRIRELTDCKGYKLYNIKKMISKIEKQAIAL
FT                   SENNQLLNSLNGANEFDGNETIYYFKKSNNTIEVGVVGLKDSEKWSDYVEKFETLTLCK
FT                   GMIKEGPFLPRTCKKPPITGYLKQDLKIQLSPGTYKIKYITESESFYMSSGFFPKKGSS
FT                   CEGSH"
FT   gene            complement(<10265..>11092)
FT                   /locus_tag="Eint_110070"
FT   mRNA            complement(<10265..>11092)
FT                   /locus_tag="Eint_110070"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(10265..11092)
FT                   /codon_start=1
FT                   /gene_family="HOG000149768" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110070"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0200"
FT                   /db_xref="InterPro:IPR022042"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA84"
FT                   /protein_id="ADM12509.1"
FT                   /translation="MEKNYMDRIRRALEVFPKEWKERGKISSKKAYNLIVTERIYSIPW
FT                   DRTFSTNHKILYPKEFIEGFGKEYVYEDTSVVGECNRSFTETDNPENIYYEAQCFLGEE
FT                   VIAIFTMSGEALLSDLAALLTGSNNLTSKVFFVIEKTIYLKNIDESSIKFATMMFQLKI
FT                   FDIKKWDFKADKCIKDISKEIYFHDGRFLNSIRITRMFFSQRRMGSYVSVKHLHGRAQL
FT                   CKCCLKNNAVLKIANDPILPEKKKFICRKCFEHLFLSKEGNQRYEDVVVEFLH"
FT   gene            <11112..>11612
FT                   /locus_tag="Eint_110080"
FT   mRNA            <11112..>11612
FT                   /locus_tag="Eint_110080"
FT                   /product="hypothetical protein"
FT   CDS_pept        11112..11612
FT                   /codon_start=1
FT                   /gene_family="HOG000149767" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0210"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA85"
FT                   /protein_id="ADM12510.1"
FT                   /translation="MIVKAVNHDDLYVDGQFQNLEDLKSKIYQRYGIPINSQHIIFNGK
FT                   FYVLGIFNAPLETSSDTYSNPLGYFGLPDSLFNNLASDGITPSEIRAFAFPHKEDLNDE
FT                   ESPSLSEVLDIKTVAKRILEVQYNEIHGISESLNEEEKAAIVKNPGEYVELVLKHTGGL
FT                   PFL"
FT   gene            complement(<11615..>12298)
FT                   /locus_tag="Eint_110090"
FT   mRNA            complement(<11615..>12298)
FT                   /locus_tag="Eint_110090"
FT                   /product="RNA polymerase II transcription
FT                   initiation/nucleotide excision repair factor TFIIH subunit
FT                   TFB3"
FT   CDS_pept        complement(11615..12298)
FT                   /codon_start=1
FT                   /gene_family="HOG000149242" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110090"
FT                   /product="RNA polymerase II transcription
FT                   initiation/nucleotide excision repair factor TFIIH subunit
FT                   TFB3"
FT                   /note="similar to ECU11_0220"
FT                   /db_xref="GOA:E0SA86"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015877"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA86"
FT                   /protein_id="ADM12511.1"
FT                   /translation="MEERRCPVCKSDIYLNPDIVIYIGPCFHKMCESCMLRIFSRGQAP
FT                   CPECGTVLRKINYIKPTFEDIIVEKECKIRRTLLRVFGREEEEFDGDVVKYNNYLERFE
FT                   ELVFEILSFKTESLVKERIREIQEMGHNSILNPVPKVGPNKGKNILPARKRQIGSLDEK
FT                   SEAKTQKTGIANDYFDPEELPRIIEKSMKEIYLPEGFLQPNIPGGLSYDAVVSFAILSI
FT                   ENPSI"
FT   gene            complement(<12653..>13381)
FT                   /locus_tag="Eint_110100"
FT   mRNA            complement(<12653..>13381)
FT                   /locus_tag="Eint_110100"
FT                   /product="triosephosphate isomerase"
FT   CDS_pept        complement(12653..13381)
FT                   /codon_start=1
FT                   /gene_family="HOG000226413" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110100"
FT                   /product="triosephosphate isomerase"
FT                   /note="similar to ECU11_0230"
FT                   /db_xref="GOA:E0SA87"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA87"
FT                   /protein_id="ADM12512.1"
FT                   /translation="MKKNKLLGGNWKMNPSLKTLEIAKNFRQNFFSGNDTFIAVPFPYI
FT                   YFAKKMFPEYIKVGAQDCSQFEGGPYTGEVSASMIKEMGAEYVIIGHSERRRWFGETSE
FT                   VIAKKIRNARSQGLKVILCIGEEEKCRKQGKYLDVIKDQLLSLGEDVKGDGIDIAYEPV
FT                   WAIGTGKIPTNDQIREVVSNVKKWGESVGFEGRVIYGGSVSMLNCQSVLDVEEVDGFLV
FT                   GGTSLKMDFCMISSEMGTKR"
FT   gene            <13547..>16621
FT                   /locus_tag="Eint_110110"
FT   mRNA            <13547..>16621
FT                   /locus_tag="Eint_110110"
FT                   /product="exportin 1"
FT   CDS_pept        13547..16621
FT                   /codon_start=1
FT                   /gene_family="HOG000149766" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110110"
FT                   /product="exportin 1"
FT                   /note="similar to ECU11_0240"
FT                   /db_xref="GOA:E0SA88"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR014877"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA88"
FT                   /protein_id="ADM12513.1"
FT                   /translation="MEQILELDKDLNIDIFDEVVMNANCPDNRKKEEAEKVLLKFKELP
FT                   NSWTKVDYILNNSKHQESHYVALQLLEGMVKTKWSLFDEGMKQGLRMYVFQLVVEKSKT
FT                   KSKENYVLQELNTILIEIAKKDWPRRWPTFITDLINVSQGISMEVCRNSLNILKRLNEE
FT                   VFIFSEDSITTVRKRVLRNQLKIEFPQIFGFIKTILEYSRNSEMDESLLETTLESFQCF
FT                   CESMPLNFIFLTEIIDLVLEHLNSMHSVACLSCLIEIVDLGRNRSLSRTHDIESAEKEK
FT                   ILIIHKRCIEFLKMYFNKFQEERIYEVYGGMDKSEKVFVLKFAQLLSSFYEVYIDLLEA
FT                   KDIVNAKAGLGYLIQISKINNTNIFSIAFEMWNKFVFDLYSEFPFTSQDSSKRLRRSNY
FT                   TSILNQLMGTLVDKMPRPEEVFIVVDEYNQVIRKKMTDTDQIEFYRKMRGCLYHLAFLI
FT                   EEDMKKYFISKVGLQLDDKEWDCNYLNKLCWAIGSISGAFSEVNEREFFVNILKHLLAL
FT                   CEMKSFKTDKAVIASNIMFIIGQYHRFLLHNKSFLKTVVKKLFEFMDEDHEGIKDMACD
FT                   NFFKIVEKCPVEFLTQRENDEIFIVYILKNLSVITGTLEFYQKRIVYEALLMVIREVPK
FT                   TRDYKSRVLSYADLLLSSLLNFNILADEYINRLPSMISNVEEAKMVSHVLKSHALTYRL
FT                   LPETCSSSCIQIFPKFFAIFDICNSITLERKEGTAFNNAKAVKMEIIELFTTVIDSKFV
FT                   QDGFVNTVCEKIIFDYKTNSVYKEPAILALGSSIVRNVENDGSVIYLQREAFMISSLIE
FT                   PSIPFVMQADENLEISKNYLYLIESMLQFSFSSFFSSLFGQPSFRQVYNTLLYSLICIR
FT                   DVSDLSLNCLTILFKKCYEQKIFQFYTQNYMSTLENILGIIFDKDMRYNFDQQCLLLSF
FT                   MIRISKDIPSLDGINSNINILSEYIVGLFVKSFPNITQESVKIFSVGLFELCGDDEVFK
FT                   EHVEDFRVKVYEFGTDEDLQEEIDLKDERIRRCRN"
FT   gene            complement(<16668..>17231)
FT                   /locus_tag="Eint_110120"
FT   mRNA            complement(<16668..>17231)
FT                   /locus_tag="Eint_110120"
FT                   /product="dephospho-CoA kinase-like protein"
FT   CDS_pept        complement(16668..17231)
FT                   /codon_start=1
FT                   /gene_family="HOG000149763" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110120"
FT                   /product="dephospho-CoA kinase-like protein"
FT                   /note="similar to ECU11_0300"
FT                   /db_xref="GOA:E0SA89"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA89"
FT                   /protein_id="ADM12514.1"
FT                   /translation="MRIIAITGNTGTGKTTFLNILRGQGYGTVNCDRIVHKMLKSEDRK
FT                   TISQKFFTDPGFKEAHEKRIRPKIYIETMKNIIYLLLAGHGVIFVEIPLLFELNLHRYF
FT                   YTIVIACDEELQIERGRTLKYLKERLALQLPIEKKIELAQEVIHNNGDIGDLIERARDL
FT                   DLRGSSIYCCLLIISTVIFLIVCE"
FT   gene            complement(<17325..>19421)
FT                   /locus_tag="Eint_110130"
FT   mRNA            complement(<17325..>19421)
FT                   /locus_tag="Eint_110130"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(17325..19421)
FT                   /codon_start=1
FT                   /gene_family="HOG000149762" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0310"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA90"
FT                   /protein_id="ADM12515.1"
FT                   /translation="MDRMIEEVVRRKTRMSNENLKALFKQKKPDGQESVSKIEVEYEFV
FT                   VKVDPTKFASCPIIEAGNDYYFCTFDGRDLMFNPKQVSPYIFLPFPLRKVIFHRSGDKM
FT                   YFITLDTSNKLQYSLFINGYPAEERSVISRNVLQVTRQSGKVFYISTKNELLYINMVVE
FT                   DGGALRGRMCVSGIKSKLNISIFYVNSILFMNVESRFHREDGKELPVQGDQMCEIGGKI
FT                   LVLDGKEKELWAFLLDEEYILISQLKIPVSKRVSNVFPLGNTVGVVVGEVLYLINECNG
FT                   NLFVEREVDLKTSPLYISLCLKDNVVKISEIIADETSFPKEADDINTTSKDSANIPDSL
FT                   PEGNPEMMDSISFDGGDVKTNKNDSRASGKFPLLDSSPCPNLFLGSHEEGKDGHRTTEE
FT                   KSVLTKEEFSMDHFSPYIPDKSDCGEIKFLSEKIDSILKVQEKIEKKMDRIERDNSERF
FT                   RKLIEISARPGESQRNSGSQELSGGELERIIGILNGLESKLKSDLSNESKILDCVKKII
FT                   LGTLVPAVEAAMDEMRIQVINEIRLIHNEDHLKNVKKAVDCLHSSFNKQNEIKGLISEG
FT                   LIEEAAEIAVKGSESNLETFVSNVEISCLEHLASSILVALLERVLVMAKDEFKPVYQNF
FT                   AYMAMMCLEPNDLNDEEIQVLEILMAYINNIEDFALNDTKGLSVLLDFQRLKINKLKDK
FT                   RGIR"
FT   gene            <19593..>21386
FT                   /locus_tag="Eint_110140"
FT   mRNA            <19593..>21386
FT                   /locus_tag="Eint_110140"
FT                   /product="hypothetical protein"
FT   CDS_pept        19593..21386
FT                   /codon_start=1
FT                   /gene_family="HOG000149760" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110140"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0320"
FT                   /db_xref="GOA:E0SA91"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA91"
FT                   /protein_id="ADM12516.1"
FT                   /translation="MSTRIDPILAAFISSFRELPIHEKEGRIIKERRKMTSSAEAEPHI
FT                   RHSNVLKFIYMKMLSYEVNEIDFLNACESDILRIKTAGYLGLMAMESDEYVIMAINTIM
FT                   KDLGKKETRNDALTSICNLNNDGMALSNLMGHVCPKGKGDPFHKKALVAFFRLNPGGKI
FT                   SIVGQDPSEVYVKSQILIDIFGKTGKVDLSENDILFLLSLFMKSDNPFLRIKILQVFGI
FT                   LHSKNQLSLDRAFLDTIDGVIIPPKDKVRPQIEIALAIEAVEFLLKIGKITPKAEAFVL
FT                   RLIESQNPNSRYFGLKIVRRYKIHRDIAIECCIKLGLHHDQCLKTLISLITRNNHKTIY
FT                   KKKEEMIFYMEKGGAGKKTVNDVLATVFSKLLQYVKDEHMIKIYQEVPEICLKMPLDKN
FT                   IPKGYMLKLFNRICVTVNSRYFPLIYQLLQSGMENEELYTTIFERHLNILSVKRNGGWE
FT                   ISTLIRLLDCMLNFGSLTHNRNILIAKYKEILKEEDTSDILDMLLNTAYLLNTKLGDSI
FT                   IHVVSEHFIYFTVSKNYTIEFRTPPSLEIKLLAGNGTSIEKVYEKLSEEARTTSFHIEE
FT                   SSKLNLQVFVGNQIHILNLEV"
FT   gene            complement(<21469..>22260)
FT                   /locus_tag="Eint_110150"
FT   mRNA            complement(<21469..>22260)
FT                   /locus_tag="Eint_110150"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(21469..22260)
FT                   /codon_start=1
FT                   /gene_family="HOG000149759" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110150"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0330"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA92"
FT                   /protein_id="ADM12517.1"
FT                   /translation="MLRISIVPDTNVFISHLEVIKRLYEDEFPVDVIMSISKVVLRELD
FT                   YNKKKKVEAREAIRFLEKVYNAPITELEGRLKDSTMDLVDTTKLIQNTKNNDDEILNFA
FT                   SKQVHPVILTDDKAFHLKSKCYNIASILVHDLAYEDLKFKILKIYTGVEPMDIDEDSNR
FT                   PDEDEQMKEQIRDKLFPVVLTIMEKGIGKPYALFFPNDLRMITLDFLLDLIIKENYLFR
FT                   PYLPRRSKEVVQSLRERIKNAHGEELHSLGSELLMLFRIVY"
FT   gene            complement(<22316..>23056)
FT                   /locus_tag="Eint_110160"
FT   mRNA            complement(<22316..>23056)
FT                   /locus_tag="Eint_110160"
FT                   /product="CHY zinc finger domain-containing protein"
FT   CDS_pept        complement(22316..23056)
FT                   /codon_start=1
FT                   /gene_family="HOG000149241" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110160"
FT                   /product="CHY zinc finger domain-containing protein"
FT                   /note="similar to ECU11_0340"
FT                   /db_xref="GOA:E0SA93"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA93"
FT                   /protein_id="ADM12518.1"
FT                   /translation="MPCQHYSNACLIRFECCLNLYPCRLCHDNAEKHKANRYEISHMVC
FT                   TVCNLLQPKTQSCSQCLSVVSKYFCSKCNLWDSSGDQIFHCDKCSACRKGDPKVAFHCD
FT                   ICQTCLIATGSKNHIHVENTTSGNCPICAEDMLGCMEVLVLLRCGHSLHQRCFDEFIRE
FT                   TYTCPICSKPIGDTSTINKKVEHILEMELLYPGQEIKSVIRCSNCNSMLKCRSAWEKCP
FT                   FCGFHSMLSSSAKEKTYKEIMDKS"
FT   gene            <23139..>24227
FT                   /locus_tag="Eint_110170"
FT   mRNA            <23139..>24227
FT                   /locus_tag="Eint_110170"
FT                   /product="RAB protein geranylgeranyltransferase subunit A"
FT   CDS_pept        23139..24227
FT                   /codon_start=1
FT                   /gene_family="HOG000149240" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110170"
FT                   /product="RAB protein geranylgeranyltransferase subunit A"
FT                   /note="similar to ECU11_0350"
FT                   /db_xref="GOA:E0SA94"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA94"
FT                   /protein_id="ADM12519.1"
FT                   /translation="MGKFELFDLGFEGTTVRDCLRFQKEKTNDVIFFDDNGIYGSTYSG
FT                   YSGLKNSKYIKNCILNKGSGESKLLLEAFPAVFRPTDKHMPKLKETGMAEFLTLIEIKK
FT                   HFYIDSSGKAHQIPYTRTEIADSDVLSLREKLLIGKTLRGGMAPNELYTLLSEKSREIL
FT                   INGIIGEDRDYLEKMYRYIRNFGNTPFLYPQYGFKEISEMFSRSNSMCGAGYVLDSALK
FT                   VTGRTRESLGMFSPEENDGEEIPSEYMHRIDTTYGTIFTKRIIRAKNEKLTGYVRVINT
FT                   RRPTLGKTFFALALRETLMKVIGLNSDTDCCPEGTYLIYIIKKDKPVDEEDLKLLHMEE
FT                   KDIIEDISYQTKFSFESDSLDG"
FT   gene            complement(<24268..>24582)
FT                   /locus_tag="Eint_110180"
FT   mRNA            complement(<24268..>24582)
FT                   /locus_tag="Eint_110180"
FT                   /product="Rad5p-binding protein"
FT   CDS_pept        complement(24268..24582)
FT                   /codon_start=1
FT                   /gene_family="HOG000242147" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110180"
FT                   /product="Rad5p-binding protein"
FT                   /note="similar to ECU11_0360"
FT                   /db_xref="GOA:E0SA95"
FT                   /db_xref="InterPro:IPR008831"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA95"
FT                   /protein_id="ADM12520.1"
FT                   /translation="MGGSRFERELEFVQLLCNPEYLRWLAREGYFESEEFRSYLKYLEY
FT                   WKSPKYSRFLAYPQCLVILEYLNSKNVNSILNNESFFSTLGEQQHFIWLNRHKEDWNKQ
FT                   "
FT   gene            complement(<24596..>27928)
FT                   /locus_tag="Eint_110190"
FT   mRNA            complement(<24596..>27928)
FT                   /locus_tag="Eint_110190"
FT                   /product="DNA-directed RNA polymerase III subunit 2"
FT   CDS_pept        complement(24596..27928)
FT                   /codon_start=1
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110190"
FT                   /product="DNA-directed RNA polymerase III subunit 2"
FT                   /note="similar to ECU11_0370"
FT                   /db_xref="GOA:E0SA96"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA96"
FT                   /protein_id="ADM12521.1"
FT                   /translation="MKEDQRLELIKLFFKEKGLVRQHIESYDYFVDHEIKALVRANQIV
FT                   DSDIDHTFYLKYLDIRVGMPSIEENMVNYDVFPIECRLRDMTYSANIYVDIEYVRNRQI
FT                   IVKRDICIGKMPVMLRSSRCHLRKEAKGIIESNKTRDRKIRESQECPLDVGGYFIIRGI
FT                   ERVILIQEQLSKNRIIIESGPKGLFASVTSSTDEHKSKTSVTIKDDCYYLKSSMFNEEI
FT                   PAIIAMKALGLTQDKEIAECIGKEYFEIIVPSFGECISKEVFTKDQALLYMSNYIKLKP
FT                   EDNRIEEVLTILSEKVLPNVQTEGCNLRKKGIYIALMIRRLVQTKLNILKEDDKDFVGN
FT                   KRFELAGQLLSILFEDTFKRFNFELKKSIDKILSKRSRAQEFDALTFLNLQANMITSTL
FT                   SRAISTGNWNLKRFRMERSGVTHVLSRHSYISALGMMTKINSHFEKTRKVSGPRSLHTS
FT                   SWGMLCPVDTPEGESCGLVKNLALLAEITTNSDTRPVLDLMFRLGVVDINSVYTREIHQ
FT                   KDMFSVFLNGDIVGITNKAGFLIEQFRLNRRKGLIGKFVSIYRVPAEKVIHVASDNGRV
FT                   CRPLVVIDKGRINQMIISNQVDKYLEALNISEKIEMGSERSFFDCYLKYKSFSDLLEEG
FT                   FVEYLDVNEENDCLVALRPEDIVEETTHLEISEFAILGYVAGLVPFPHHNQSPRNTYQC
FT                   AMGKQAIGHISLNVKKRFDPVILQLTYTHRPMVSTKILDLINYNEIPAGQNAMVAVMSY
FT                   SGYDIEDALVLNKTSIERGLFRVEVYKTITTLLKKHSNGLSDILGPNPKESVLDDDGLG
FT                   KPGKMIRDGTVYVNKMSPVEGVYKFTGKVHRGDPAYIDKVLITKSQDQILIKTMLRQTR
FT                   PPEIGDKFSSRHGQKGVVGLIVGQEDMPFNDQGISPDIIMNPHGFPSRMTVGKIIELIS
FT                   GKAGVLSGQILDSTAFKENSVEQTCELLAKHGFSYSGKDCFTSGTTGAPLTAYIFFGPV
FT                   FYQRLKHMVADKIHMRARGPRAILTRQPTEGRSKDGGLKLGEMERDCLIGYGASSLIIE
FT                   RLMISSDMFEAYVCKPCGVLAFKGCCVACKNTKPAKIKMPYACKLLFQELISMNILPRL
FT                   HIE"
FT   gene            <28050..>28283
FT                   /locus_tag="Eint_110200"
FT   mRNA            <28050..>28283
FT                   /locus_tag="Eint_110200"
FT                   /product="ubiquitin-like protein"
FT   CDS_pept        28050..28283
FT                   /codon_start=1
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110200"
FT                   /product="ubiquitin-like protein"
FT                   /note="similar to EBI_26439"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA97"
FT                   /protein_id="ADM12522.1"
FT                   /translation="MQIKVKTIAGRDLELTVDPEDTVLDLKQKIESIELIPVEQQRLVS
FT                   NGRILMKEKDTLASLNIISGNVVHMVLALRGG"
FT   gene            complement(28394..28468)
FT                   /locus_tag="Eint_110210"
FT   tRNA            complement(28394..28468)
FT                   /locus_tag="Eint_110210"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Type: Leu, Anti Codon: TAG, Cove Score: 57.43;
FT                   similar to ECU11_0375"
FT   gene            <28562..>28945
FT                   /locus_tag="Eint_110220"
FT   mRNA            <28562..>28945
FT                   /locus_tag="Eint_110220"
FT                   /product="hypothetical protein"
FT   CDS_pept        28562..28945
FT                   /codon_start=1
FT                   /gene_family="HOG000149758" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110220"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0380"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA98"
FT                   /protein_id="ADM12523.1"
FT                   /translation="MGEKMAEGAWISRLDFEEESTSKPYFSLDIMRCKICLEVFYVKHH
FT                   ESHPCFSKNTVEQHHQKEEDRDLLEESSKSEEKIVDMPDHIFQNHEDRHLEEALNIKPV
FT                   VKKVWRLSYVMLLERENLFWMDG"
FT   gene            <29008..>31080
FT                   /locus_tag="Eint_110230"
FT   mRNA            <29008..>31080
FT                   /locus_tag="Eint_110230"
FT                   /product="exocyst complex subunit Sec6"
FT   CDS_pept        29008..31080
FT                   /codon_start=1
FT                   /gene_family="HOG000149757" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110230"
FT                   /product="exocyst complex subunit Sec6"
FT                   /note="similar to ECU11_0390"
FT                   /db_xref="InterPro:IPR010326"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA99"
FT                   /protein_id="ADM12524.1"
FT                   /translation="MDKALSQLSETLRHPSDLQTKLESIERSTRETYERHDQNLTGMIS
FT                   RCYSSILNISKRIYALEEHLKDFVENKDRNVRVLEDFFSLVKDYRSVKMICLAHSNLCR
FT                   VIEFSDKLKGIEDPVESEDIVAYHTKVYDSEDFGCQLDMYNAGISHDDYIEVNKALNTI
FT                   EKNSLDFTAKVLEVCEEFIENHEIMGKIVQIVEKEESRDELTRKVQKGEKSDDPVLKEL
FT                   YRMYKMYATRKPKMLKDKVVKSIKVSVKTKFDKLENEEIFVNKMDFVLNDLSFIKENIK
FT                   LSFYPFDDILMLYHNNLKDFLDRNTERLDAGEILAIVEYVGNYYDTIESKFNKIADALG
FT                   KRLLGNETELLEKYTRTAQEKLREWIMNISKIEVEKFYARSEELARDEEDKLVSPGFVS
FT                   LLQIIRMQLEPIAFNNRIFAHITRTITKYCEMFKEHLVEAMDKDFKPSCEMNSKVGYED
FT                   FCIMFGNSGLKIAQYITSLPSYHNDEVKELGDIFIDILKASNTFLSEFIIYSCQPAIDK
FT                   IFTDEWYRGNITKIVVLTLQDFLSDYQNTMSEYSFVTFIHELSTSIVLAYMKQLGRKRA
FT                   TIAEECNKVLKSDHTKLYELLSGYGDKEDVKTCLSPILKVIPLMDTRNDDLFIVEVKSL
FT                   KLIYPDIKRSFIKTIIKKRQDLTEDQKKTLTDRLKECFVEEASKEKTIFSRLLNL"
FT   gene            complement(<31111..>31635)
FT                   /locus_tag="Eint_110240"
FT   mRNA            complement(<31111..>31635)
FT                   /locus_tag="Eint_110240"
FT                   /product="transmembrane adaptor Erv26-like protein"
FT   CDS_pept        complement(31111..31635)
FT                   /codon_start=1
FT                   /gene_family="HOG000149756" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110240"
FT                   /product="transmembrane adaptor Erv26-like protein"
FT                   /note="similar to ECU11_0400"
FT                   /db_xref="GOA:E0SAA0"
FT                   /db_xref="InterPro:IPR007277"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA0"
FT                   /protein_id="ADM12525.1"
FT                   /translation="MLLVFLKSLFLILGSVGGLIGLGIGIVKAIDYIEDKAYAAKKHIE
FT                   TIIQISAGLHFILLLRGVSIFQILFSLSIQYAFYCLLDIYPLVKLDNPYFIYGTIASLL
FT                   NHFLVIRLIFSNPSIYGAEIILYFALVWTTPFCFFLSLSANDEVLFVRGKASSNTMIGS
FT                   FLKKYLYKEKK"
FT   gene            complement(<31831..>32310)
FT                   /locus_tag="Eint_110250"
FT   mRNA            complement(<31831..>32310)
FT                   /locus_tag="Eint_110250"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(31831..32310)
FT                   /codon_start=1
FT                   /gene_family="HOG000149755" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110250"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0410"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA1"
FT                   /protein_id="ADM12526.1"
FT                   /translation="MNKQLNEVESLCLTGIKKGDPEMVEMYFGPYLSCSPSTDNSALIK
FT                   AYMLLYYLSTGSKKTFYTTIETVTSLELSDPCIRLAMEVDMCVSIGAVERLRRLIEGNG
FT                   RKEFDQFLKGVLENQMKIMESSINYDDPRLEIQSQEDKKVIEDVTFIGRNLPANF"
FT   gene            32429..32501
FT                   /locus_tag="Eint_110260"
FT   tRNA            32429..32501
FT                   /locus_tag="Eint_110260"
FT                   /product="tRNA-Met"
FT                   /note="tRNA Type: Met, Anti Codon: CAT, Cove Score: 69.91;
FT                   similar to ECU11_0415"
FT   gene            complement(<32543..>33226)
FT                   /locus_tag="Eint_110270"
FT   mRNA            complement(<32543..>33226)
FT                   /locus_tag="Eint_110270"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(32543..33226)
FT                   /codon_start=1
FT                   /gene_family="HOG000149754" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110270"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0420"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA2"
FT                   /protein_id="ADM12527.1"
FT                   /translation="MIEIEEEIIRTIEEIDNTFSSINRTLRNIRGSIESIGKNNRKISE
FT                   GLSPWIRFFSVESSESEESELLTTENEPRLVEEPSFQNICVTEGSPISMKLSSPRNPFV
FT                   DSTSSEMLNKTFLGDLSARFHTSNAENESSSFVKIVEEKAFESYEETESSDNIFPFNPG
FT                   MLPPLFRNEEGLFLVYEIISRAPITLEEIYNEISTIPREKINIFVDLLLRKRFIGREGN
FT                   TFRTA"
FT   gene            <33457..>35223
FT                   /locus_tag="Eint_110280"
FT   mRNA            <33457..>35223
FT                   /locus_tag="Eint_110280"
FT                   /product="Sel1 repeat-containing protein"
FT   CDS_pept        33457..35223
FT                   /codon_start=1
FT                   /gene_family="HOG000149753" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110280"
FT                   /product="Sel1 repeat-containing protein"
FT                   /note="similar to ECU11_0430"
FT                   /db_xref="GOA:E0SAA3"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA3"
FT                   /protein_id="ADM12528.1"
FT                   /translation="MDTLHSFFGKKMSREADRVLLGVGRKRDEKLGLKMHMENSARDVN
FT                   SLAISAFCHEFGIGTAVDMKKAEMRYSKAALSDNGLALIRLAFIRWFGRPTATIDREEA
FT                   KKILDKLKRLGRKSVEWLFYANKYGNPYAKYCLGVCYQEGYGVPIDPLLAVKYYSEGAY
FT                   EANICSIGILGYCFLKGFGVERNEEIAVELFRYASEKKDSTALYNIGFCYEEGKGVVRN
FT                   LVKAFEMYRLSAKMENSYAQNALGNCYEEGKGVNKDLHKAFEFYKKSALQGYPSGQCNL
FT                   AFCYQKGIGIKKDLQKAFEWYKRAAAQGLSRAKHNIGYCYQNGLGTPPCMSKAVHWYKE
FT                   SASENNKYSIHALGVCYQHGYGVPKDERLAVRYFGEGAKMGFDEAIISLALCYRSGTGV
FT                   RVSPEKSFGLIKRAAKMNNSSAQNTLGYYYEEGYGTPKNIKEAIKWYGMSAKQDNSWAL
FT                   FNLSNLYFNRSRSSTDKEVGMRLLIKSRDLGNPKAMDTLGYYFEKGIGVEKNPMLAFEH
FT                   YNQALQGGYLKAGYNLGRCYESGIGTEIDLDKALYYFYKASSAGEETSLQKLKKILSSL
FT                   VEPNHMLIPPYA"
FT   gene            complement(<35236..>35655)
FT                   /locus_tag="Eint_110290"
FT   mRNA            complement(<35236..>35655)
FT                   /locus_tag="Eint_110290"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(35236..35655)
FT                   /codon_start=1
FT                   /gene_family="HOG000149752" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110290"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0440"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA4"
FT                   /protein_id="ADM12529.1"
FT                   /translation="MKDLIRQAPFDKHLSPLVPFVSQGRKKQLPRVEGISKFIKHLKSR
FT                   GKKNELFIAGATAKEALKEAFCERFPIRDIKVFKRYAFVSVEENANIDDVPGKYHSIGG
FT                   NLIYVDYAKGGDPKFIPNRLKNRINFWHNYKNKFK"
FT   gene            complement(<35707..>39969)
FT                   /locus_tag="Eint_110300"
FT   mRNA            complement(<35707..>39969)
FT                   /locus_tag="Eint_110300"
FT                   /product="phosphatidylinositol 4-kinase"
FT                   /note="C-terminal region"
FT   CDS_pept        complement(35707..39969)
FT                   /codon_start=1
FT                   /gene_family="HOG000149239" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110300"
FT                   /product="phosphatidylinositol 4-kinase"
FT                   /note="C-terminal region; similar to ECU11_0450"
FT                   /db_xref="GOA:E0SAA5"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA5"
FT                   /protein_id="ADM12530.1"
FT                   /translation="MKIEVIIKGSSEDIYIPLVRETTLEDIKKLSEMEAYEEGFGLNAY
FT                   AILKNSSTCLEYSSKLYEMYIVMFLRMLDNEYVSKEIMADISIVEPETLSSTGVINAFI
FT                   EASIWKIEQGEQPASKYEMFIEKLCGKMTSGLLYEIASWSLKEDIVNIKLDFLLLSLRL
FT                   IVMVMEDKIEKKRKIEKKNIFAFAKEYFYKTFVFLGEIKDLEDDMTFVFKASLAIDALV
FT                   TGQVAKRVNEVFPIIEDLPISGKNMFRIHIQMANICLYEDGALYDLLYLVFTSNCFTYL
FT                   DASYKNKFIGTLIEAVEQDGKIEKTKSIADTFRKIFHSLRDSESKNTDLMIWNFLSFLS
FT                   KLRINKDMGDFNSIFLKFIVKYPETIELYSNFILINEVDFPLHSLHEISNFGFMKEFYS
FT                   ILFKKAQEKRYSKAHVDKLVSEFLKFFLSTKNRELIGVLPLVPYIPSKREVLYVLYEIY
FT                   SFLFENEAIEQVDLFLLKTPALVGISSSIYYNVKYLHQLAAGLNLRNVEPRMLVFLGIV
FT                   YYCESRKLYNSNYTGILEYIQDEDGIRMARDGLISVIELIHNGYINKSHEFTFSYVNAL
FT                   LNIALEPKTIETTLMMIEIILRKIFEKEEKIIFMKEIHQRFQKLFVLLTSKRFLSEEVT
FT                   DSYRRLYRQMLEKIRCAPNFYNYVVLCLADISFFDGELPKGHFKSFNDLYNHTLSRMGV
FT                   VEEFPDIFMVDHGWNSAENTEETSSKSFMSSIQWKENRRKYGIRGKEEGLNSKEEKSHD
FT                   MYNIIHTGTNDSVVSLESSMGSISLHSSSPMHSVSRNGQIEMLDEGIRKREKSVSWLID
FT                   VIYTRRSQSSIIRIVLDLLKLRLRNMFEYEDLYILLKAYNILSIRENDSEEFLKHALHR
FT                   GLDFKTDPAICYKLSMETNGFYRFFFRALYFAVSNFSCNDDLSFPERTQLISKFDIADL
FT                   IHIQNTFKQKIVQKLLERSSTPSYRSYFFNMESLGIIDCLTIIRRIDDPSLVSKAFERL
FT                   KDFRGEMLFYVPQLVQMIRHKKVSEMALATLKDLAKDEYVAHQLIWNLKANLYGSDRTE
FT                   RDDCHDIFTRCMEEIMGEMTEEERDILLKEEEFISSLTKISSELIPHLRSSKDEKRRRI
FT                   NEHLSKIKLSPGVYIPFYPELKIVEIMGGSARALQSHAKVPFMASFRVQDPGGQINIKQ
FT                   LIFKSGDDCRQDMLALQIISMFESIFKQANLDIFLYPYRVIATSPGTGIIEVIPNSKSR
FT                   DQIGKENINNLSEYFEYKFGFKESEGYLTAICNFASSLAGYSLVVYFLNIKDRHNGNIM
FT                   IDDKGRMIHIDFGYILEMSPGNLNIEAPLKLTKEIEELLGGISGKGFEIYQELMVKGFL
FT                   ALRRHSKDLVMMVDSFSNSRLPCYKKNAVENFALRFRLELSDKNARRFVQSLIAESSQK
FT                   FRTWMYDQYQKITNNIAF"
FT   gene            complement(<40138..>41337)
FT                   /locus_tag="Eint_110310"
FT   mRNA            complement(<40138..>41337)
FT                   /locus_tag="Eint_110310"
FT                   /product="60S ribosomal subunit biogenesis protein"
FT   CDS_pept        complement(40138..41337)
FT                   /codon_start=1
FT                   /gene_family="HOG000149751" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110310"
FT                   /product="60S ribosomal subunit biogenesis protein"
FT                   /note="similar to ECU11_0460"
FT                   /db_xref="GOA:E0SAA6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR010613"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA6"
FT                   /protein_id="ADM12531.1"
FT                   /translation="MGSNYIKPQKKYISKELVMKNLDLQEKEFDKLVALCQVHPYIPKN
FT                   NRKVDQGDGFYYRISDANKLVHSDVYKILIKNRKLEDRKKKYLGTGLEYKIENIRHEEY
FT                   GYVDLIRSRCKGLGEAVDELNHTLGNLYLARMLGLDDRISETLGMFENFIARKSLLECS
FT                   YMSKAGVYNQTTLGKIRVVWFVPYPGAELKDIVEEKKDLPRKFEWSEPNFLDFVSSSEE
FT                   EDSESEEMEIIYNDPGKIDISLLSHSVPLLMVHCKLVLFKLEKVYESHNNRKGIFQDVK
FT                   FYIGSKTIEGSLRLIALSCGGDVVESPCKADIHISEGVDEVMENTIYVQPQYLFDCLNQ
FT                   RRRLSAEDYCVGKELPKHVSPFASIDSIITKENLMTMSKTRRHKIEDLINRFEDVKYEH
FT                   "
FT   gene            <41446..>43191
FT                   /locus_tag="Eint_110320"
FT   mRNA            <41446..>43191
FT                   /locus_tag="Eint_110320"
FT                   /product="kinesin-like protein"
FT   CDS_pept        41446..43191
FT                   /codon_start=1
FT                   /gene_family="HOG000149238" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110320"
FT                   /product="kinesin-like protein"
FT                   /note="similar to ECU11_0470"
FT                   /db_xref="GOA:E0SAA7"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA7"
FT                   /protein_id="ADM12532.1"
FT                   /translation="MKDLRTYLSESKVEHLYQLFERLGIDESQLLAKLKYSDLEKIGIE
FT                   NLIERRKVFDIINEINQDIYKEDIEMNENDSYRDELLSFPFGHKEESKCEHQPLAGNIA
FT                   ERSSLLFGSGETISQRLSLCSMPKRSSLERSLIGLDELDPDSSRTILESRNTNASVLED
FT                   IVESGTGLEKISVCVRKRPTTSPSLDIVDVEGRGVVVNEEKLRVDLRPYIERHRFEFDY
FT                   SFDLDKKNIDVYRECVKGVVNHVISGGFGTIIAYGQTGTGKTYTMLEKDIGMVYLAIKD
FT                   LMAFKNCGAITFCEIYMGQVHDLLDEGKIIQLREVNGVVHLSNSKEEQFCGYKEVLEII
FT                   AKGMSLRKTGVTGANSKSSRSHAVILVNFSERKIEKNDQRVHSGSIVFVDLAGSERGTD
FT                   RKEMGSDVKNEGAEINKSLLALKECIRGMEKDRKHLPFRQSKLTQILKNSFVGKSRTCL
FT                   IATISPTPENVEHTLNTLRYAARIKESILPREKRSRGPFCGRTSIGQTKSSDTETRKEI
FT                   EKSHPDSPRTELFSSKENLVCEIREILQRAESRIPLLKTSKELERMLDLCKKMEYEMES
FT                   NIMKY"
FT   gene            complement(<43245..>44852)
FT                   /locus_tag="Eint_110330"
FT   mRNA            complement(<43245..>44852)
FT                   /locus_tag="Eint_110330"
FT                   /product="CTP synthase"
FT   CDS_pept        complement(43245..44852)
FT                   /codon_start=1
FT                   /gene_family="HOG000077514" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110330"
FT                   /product="CTP synthase"
FT                   /note="similar to ECU11_0480"
FT                   /db_xref="GOA:E0SAA8"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA8"
FT                   /protein_id="ADM12533.1"
FT                   /translation="MKYIMVCGSVISGIGKGIVSSSIGVLLKSRGHNTTHFKIDPYLNY
FT                   NAGEIHPREHGEVYVLDDGHTCDMDFGNYERFNMSDLSRKNSLSSGRLFEDLIKREKEG
FT                   HFLGKTLQINPHAIDDVIRRIKMVAETPVEDFKSGRRVIPDVVIIELGGTVGESESSIY
FT                   TDAFAKFQRIVGRSNCAFVSVDHLVELESGEQKTKSIQMGCRNFRRFGLSYDIIVCRGV
FT                   RDPSKETREKISKNCWVEPGNVFGLPNLESVYLVPKFLEEHGMVESLNKVLGISSKEGD
FT                   REILETFERLVQKHEDTVRIGIVGKYSPEFDSYTSLVHALRFSGASVGVNVEIEWINAD
FT                   SYTTEDLEKCNGIIIPGGFGARGIEGKISAIRYARENRIPLLGICLGYQLSIIEMCRNV
FT                   LGMKDASSEEFNPSGKNLVVRFISDKNGVVDKKLRVGGYEVELEDGLVKRLYSGAEKIR
FT                   ERHRHRFEVVRSEVSSLCSYGLRFVGFSDERRAAKIFELTSHPFFVGVQFHPEFTARPN
FT                   QPHPLITGLISASCRKLN"
FT   gene            complement(<44927..>46546)
FT                   /locus_tag="Eint_110340"
FT   mRNA            complement(<44927..>46546)
FT                   /locus_tag="Eint_110340"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(44927..46546)
FT                   /codon_start=1
FT                   /gene_family="HOG000149748" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110340"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0490"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAA9"
FT                   /protein_id="ADM12534.1"
FT                   /translation="MEKIDKLFNKIRDVDECYGRYLSLRDEKVGREKELDRIEKEIKRT
FT                   DSISLEKEIKKIGDEYQNILEDIEKLSLGSKECRSISDLEAIFSKIADGDVVLKKSLEF
FT                   LNHSIALKYINSCGSGEVEDLESGHGDGPMVFKIGKDVETLFQLSARYMEIQEKCYFSL
FT                   RSIVHKNMLNIVPIGIKVFQDDLSLFFVFKGQSGDLSHCELVGKAIMGLEEISKYEMMS
FT                   HVIFGVLRDNMKNAVVEEDLSDESIEASNAFFRDTEFYIHNVVEWKLDVVMKEIIEMTK
FT                   GPRDMEAVKTFELSNRMPKSISASYKRFQKCFEVFRKLKSKRHEKGVRVINRAIKKLFD
FT                   PKRYEPSIYSYFIEFADITHFLRVYPGHCLADELSKRKEELFFDVIKESSRINVALDEP
FT                   LVTLKLYFKEKHVEFVENMELFVPEINMSLFEIQFFEMLGENLMKKIQELKMAKRSTIE
FT                   NLPILIDYILDLSFHLPAGAIGSQGKLKSYKQVLSSNRAEVIEGYRNGKLFISSEEFIS
FT                   LCSLVFQESEDKKLLLSEIENK"
FT   gene            <46598..>47212
FT                   /locus_tag="Eint_110350"
FT   mRNA            <46598..>47212
FT                   /locus_tag="Eint_110350"
FT                   /product="hypothetical protein"
FT   CDS_pept        46598..47212
FT                   /codon_start=1
FT                   /gene_family="HOG000149747" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110350"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0500"
FT                   /db_xref="GOA:E0SAB0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB0"
FT                   /protein_id="ADM12535.1"
FT                   /translation="MDLDEDVLFLGNIPESFNNELLIEMLSVFGEIKEFKRGKDLEGTD
FT                   SKWVIVSYYEKSSISNLYCSLLNRDLGQGMVVVFPQKKELQAWEVSDEILGRVDDIAKR
FT                   YKERLKKEDCLEKFVSSYDLLYGSTGDGQVFSEALSKWLDEESEIRRRCRKAENDFERT
FT                   AERKRQEEYYYLSTYDDDRSNDLFYTDRVSWALKRNKDDVK"
FT   gene            <47720..>48469
FT                   /locus_tag="Eint_110360"
FT   mRNA            <47720..>48469
FT                   /locus_tag="Eint_110360"
FT                   /product="chitooligosaccharide deacetylase-like protein"
FT   CDS_pept        47720..48469
FT                   /codon_start=1
FT                   /gene_family="HOG000149746" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110360"
FT                   /product="chitooligosaccharide deacetylase-like protein"
FT                   /note="similar to ECU11_0510"
FT                   /db_xref="GOA:E0SAB1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB1"
FT                   /protein_id="ADM12536.1"
FT                   /translation="MLHLLYLAFALCHEVPDVCTSSGMIAINFVDGPVRGVTDKVLNTL
FT                   EELGVKATFSFTVNQKAVGNVGQLYRRAVNEGHTVGLRVDPRMDEGYQDMSQEALEDNI
FT                   DREIDTIDGLSGTEVRYASVPISNGEVSSELYTILTQRGVLPLGYTFCPYDYDDPIAEF
FT                   EAMIEGSDPKHHSFIILMHDGQEGDTSRLEKMVEIGEKKGYTFTNMDECLRGYKGSPGD
FT                   PELNLRGKGAASLATFLPFFMLLGRLL"
FT   gene            complement(<48658..>49659)
FT                   /locus_tag="Eint_110370"
FT   mRNA            complement(<48658..>49659)
FT                   /locus_tag="Eint_110370"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(48658..49659)
FT                   /codon_start=1
FT                   /gene_family="HOG000149745" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110370"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0520"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB2"
FT                   /protein_id="ADM12537.1"
FT                   /translation="MEVSGRKEGIKSSLNDVELDISNDPTRLKKSSLEKMKIQQLFKNG
FT                   TSVENCEEESLNLGYSDSKVGPFITSKDLHEENKEDLSSNDGSSSSDCKDSDECEGLLS
FT                   IYSLKEAENLYKNIKTPSISDMAIEKNRRNHPNPKFLCNAEGRNNYTVVLEDLYFKQKT
FT                   KSLKKEIKLKHLLEEFFSELDKFVLIANYCLKSTEISDGDEDFNFALEWIRDAFHWLGI
FT                   EGAKYYARKSPGPYSGWVSDVEFLMNRYFFSPDFNHVNGFDIKQSVHEGYGFVENRYGK
FT                   FHLSYQPYPGYYDVSKDTIRFCSECNLLLPPSLCLLDSRCQETSDEKEEEIS"
FT   gene            complement(<49907..>51064)
FT                   /locus_tag="Eint_110380"
FT   mRNA            complement(<49907..>51064)
FT                   /locus_tag="Eint_110380"
FT                   /product="tryptophanyl-tRNA synthetase"
FT   CDS_pept        complement(49907..51064)
FT                   /codon_start=1
FT                   /gene_family="HOG000224742" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110380"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /note="similar to ECU11_0530"
FT                   /db_xref="GOA:E0SAB3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB3"
FT                   /protein_id="ADM12538.1"
FT                   /translation="MEEQKITPWDVEVVSTSETPVAIDYDKVVNQFGCERFNQDLVKRL
FT                   EQLTNKPAHYFFRRGIVFGHRDFNLLLDEVSKNKSFYLYTGRGPSSKAMHIGHIIPFLL
FT                   CKYIQDTFKVHLVIQITDDEKFLWKNMKLEDAISYGKENMKDIIALGFDPKLTYIFSNV
FT                   ESSHHFEKNVLKISKTINFNEVSKIFGFNTSSNIGQVGFPSKEIAPCFPSSFKFIEEDA
FT                   MCLVFAAVDQDPFFRLARDKANTLGERKPSSAYVSLLPDLKGVNRKMSASDPNSSIYLD
FT                   DTPETIRKKITVHAYSGGRETLEEHREKGGNIDVDVPFEYLRYFLDDDQELERYRLGYI
FT                   KGEITSREMKEKCISIVQEFVLRYQESRKKITDEDLKVFMDINKF"
FT   gene            <51143..>52912
FT                   /locus_tag="Eint_110390"
FT   mRNA            <51143..>52912
FT                   /locus_tag="Eint_110390"
FT                   /product="molecular chaperone DnaK"
FT   CDS_pept        51143..52912
FT                   /codon_start=1
FT                   /gene_family="HOG000228136" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110390"
FT                   /product="molecular chaperone DnaK"
FT                   /note="similar to ECU11_0540"
FT                   /db_xref="GOA:E0SAB4"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB4"
FT                   /protein_id="ADM12539.1"
FT                   /translation="MSSLSKKLSSSIIGIDLGTTNSCVSVVKNGEPLIIENQEGERTTP
FT                   SVVSILGDEVIVGNQAKSRMLMNPKNTVFASKRLIGRKLEDPEVKKYVKGLPFDTMSHC
FT                   NGDVWIKIDGKKYSPAQIGAFVLSKLKKSAESFLNHPVAKSVITVPAYFNDSQRQATKD
FT                   AGRIAGLEVVRVINEPTAAALAYGLDKLAKGNIAVYDLGGGTFDISILELSNGVFHVKA
FT                   TNGDTFLGGEDLDNELVKFIIEDFRLKEGVNLGEDINALTRIKECAEKIKKDLSSSLSS
FT                   RINIPYICSIEGKPKHLTREITRDELERVVKKIVDRTIEPCKKALRDAGMEGSDIKHVI
FT                   LVGGMTRMPYVRRVVKEVFGIEPSTGINPDEAVAKGAALQGGVLTGEVDNVLLLDVAPL
FT                   SLGIELLGGVFNKIIRRNTTIPFKETQTFSTSEDNQTEVDIKVYQGERSMALDNKYLGQ
FT                   IKLKDIPPLPRGVPRIEVTFESDANGMYKVTAQDSVTKKPQSLEIIPSSGLTEEEINKM
FT                   VEEGEKHRHLDEIKRRKAELIVSSAEFLRRPSSSLAKISKDCLDTIKRAVSGEEFDLEE
FT                   TKQALENAKKAIS"
FT   gene            <53040..>53795
FT                   /locus_tag="Eint_110400"
FT   mRNA            <53040..>53795
FT                   /locus_tag="Eint_110400"
FT                   /product="putative Arf GTPase activating protein"
FT   CDS_pept        53040..53795
FT                   /codon_start=1
FT                   /gene_family="HOG000149236" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110400"
FT                   /product="putative Arf GTPase activating protein"
FT                   /note="similar to ECU11_0550"
FT                   /db_xref="GOA:E0SAB5"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB5"
FT                   /protein_id="ADM12540.1"
FT                   /translation="MTTNFNKEVKMLRETEENKRCADCSAPNPPWASVTYGIFICFDCA
FT                   SIHRSLGVKTSFVKSVNLDIWDEKEYLFMKHGSNEKFKKFLEHCKLVGREMNEIYNNNH
FT                   IRKYGESVKSLVVKEIGEEAFNRPRTSTVPKEPRDSEDWRKRSSTDCVNRSKRSHGTPG
FT                   LESISTGSLQSSISSTLSIVGSAIFSGAKVITGKTVEYGSIVVSSTKSIIKDNSSSLSS
FT                   IFKKKDLIPKDHIKVPERQEVYPRPDKWD"
FT   gene            complement(<53859..>54248)
FT                   /locus_tag="Eint_110410"
FT   mRNA            complement(<53859..>54248)
FT                   /locus_tag="Eint_110410"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(53859..54248)
FT                   /codon_start=1
FT                   /gene_family="HOG000149744" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110410"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0560"
FT                   /db_xref="GOA:E0SAB6"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB6"
FT                   /protein_id="ADM12541.1"
FT                   /translation="MNPIGLFISLMLSVILCIVELYKIEAVLDAEGRRASSYNACDRIL
FT                   RLAAIEFKLLTLIMAAQVLSLCYTSFLVVLLFVYEIQKKGSKDSISALDFFKQKKRIKI
FT                   EMFCKISLYVFLVYKYFTALVVNKM"
FT   gene            complement(<54311..>55195)
FT                   /locus_tag="Eint_110420"
FT   mRNA            complement(<54311..>55195)
FT                   /locus_tag="Eint_110420"
FT                   /product="metal-dependent protease"
FT   CDS_pept        complement(54311..55195)
FT                   /codon_start=1
FT                   /gene_family="HOG000183690" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110420"
FT                   /product="metal-dependent protease"
FT                   /note="similar to ECU11_0570"
FT                   /db_xref="GOA:E0SAB7"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB7"
FT                   /protein_id="ADM12542.1"
FT                   /translation="MFNGFVGVDDGEPTSDASETVQISSLALLKMLKHGRAGIPLEVMG
FT                   LMLGEFVDEYTVKVVDVFAMPQSGTNVTVESVDPIFQMEMMSILKATGRHETVVGWYHS
FT                   HPGFGCWLSTVDISTQQSFEKLCKRAVAVVVDPIQSVKGKVVIDAFRLIDNQLGVLGGE
FT                   PRQVTSNIGYLKTPTLISIIHGLNKHYYSFNITCRKNDLEQKMLLNLHRKTWADNLKLR
FT                   DVRTKREEVLKLIESYGKAWEEEKNLKGKDLEMAKVGKVDYRRRLLEKCDENIMENAIY
FT                   NLLYSMHRYIFNQ"
FT   gene            complement(<55485..>55841)
FT                   /locus_tag="Eint_110430"
FT   mRNA            complement(<55485..>55841)
FT                   /locus_tag="Eint_110430"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(55485..55841)
FT                   /codon_start=1
FT                   /gene_family="HOG000149743" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110430"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0580"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB8"
FT                   /protein_id="ADM12543.1"
FT                   /translation="MFLLFLVFVFADNIEISRSSFDTLKVGNTYISSASHGASTWNSLK
FT                   ISFPGYYRYDVVEYEPRRFELVDVTQYFGETEKMVFRVDFETKYYGLIPDAWVMIISLT
FT                   TLSGIMFSLPIKNV"
FT   gene            <56276..>56590
FT                   /locus_tag="Eint_110440"
FT   mRNA            <56276..>56590
FT                   /locus_tag="Eint_110440"
FT                   /product="DNA-directed RNA polymerase I and III subunit
FT                   AC19"
FT   CDS_pept        56276..56590
FT                   /codon_start=1
FT                   /gene_family="HOG000149235" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110440"
FT                   /product="DNA-directed RNA polymerase I and III subunit
FT                   AC19"
FT                   /note="similar to ECU11_0590"
FT                   /db_xref="GOA:E0SAB9"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAB9"
FT                   /protein_id="ADM12544.1"
FT                   /translation="MKGEDRIRILNTQTIQVEKEDHTIMNPLRWCISKNFYGENVELVG
FT                   YTIPHPSDDASNLTIQFSNESSQTPPNLFKKMMEGLECMEAIGRKMESEIEKFEGKFNK
FT                   "
FT   gene            complement(<56644..>57585)
FT                   /locus_tag="Eint_110450"
FT   mRNA            complement(<56644..>57585)
FT                   /locus_tag="Eint_110450"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(56644..57585)
FT                   /codon_start=1
FT                   /gene_family="HOG000149742" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110450"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0600"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC0"
FT                   /protein_id="ADM12545.1"
FT                   /translation="MRTKPESCVFFLNEMTAEEEYNIVTRQPPRLPKRPVGRLNGNKIL
FT                   LSGNKLFVERHIGVVDLEYVESDEKIFNLLICLVRLPPFYNFILNFREKGEDIEKCQIM
FT                   FRISEFLRLLMEEKKTNASDLLMESDSKVYEDIYSELLQAIHDELCEYYNFEEDTWSTM
FT                   GKTQGAKPKLLYKEYSPIVEIFQGKAVSGSQSQEISFEKSRVSLKGFSNIQEAFDSSLK
FT                   VKNRKITKKPPVLVLVVKEQGGIDILNGSNISLGSHTFSLCSFITEENTMSYCYVKDGE
FT                   GWHGYGAGGVEKILEMKDVCGYPLMLFYTCNE"
FT   gene            complement(<57688..>59493)
FT                   /locus_tag="Eint_110460"
FT   mRNA            complement(<57688..>59493)
FT                   /locus_tag="Eint_110460"
FT                   /product="pre-mRNA cleavage and polyadenylation specificity
FT                   factor"
FT   CDS_pept        complement(57688..59493)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110460"
FT                   /product="pre-mRNA cleavage and polyadenylation specificity
FT                   factor"
FT                   /note="similar to ECU11_0610"
FT                   /db_xref="GOA:E0SAC1"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC1"
FT                   /protein_id="ADM12546.1"
FT                   /translation="MTVVTCIPNVTCFADIGNKVFILSDDLLSIFDIDKRMGQFPPCSI
FT                   RGVPYAIRFSSETSVPIDLSEKNDDEAVIEMAMLATGTKILMLFRLKGGYMVAYESFGL
FT                   EALLRETLPSEVIFFKIHLPRHIAFNLSPETKAFYNVGTMVFIKATTNVFMVPTDKGHF
FT                   LYRSQYTLNSIAMDGDDVIQLSKGYLMVCRVPSIENGYVFGSGFIGKKIPVLRTPKHIE
FT                   YADRYMVVASCEEVEFSPKNGKDCGVPVNTYRFYVDLYSEKYEHISTYELEENEYVFDI
FT                   QYLVLDDMQGNYGKSPFLLVCTTFIEGEDRPAKGRLHVLEIISVVPSLESPFKDCKLKV
FT                   LGIEKTKGSIVQCSEVRGKIVLCLGTKIMIYKIDRGSGIIPIGFHDLHTFTSSISVVKN
FT                   YILASDIYRGLSFFFFQSKPIRLHLISSSEPLKNATSTELLITGNELSMVCCDIKGTIH
FT                   AYTYSPNNIISMDGAKLVKRVEMKTNLGRLSSSRVGFRKNSIMLYSRSNQLVHVNGVDN
FT                   SSYLKLLGIQTSIMGCFKAVFGLNPRDYLNSDIHLHSLSLKSPIVLHILNLFSYFDLSI
FT                   QESISSSVVMSRREILDIIASLNQS"
FT   gene            complement(<59559..>61238)
FT                   /locus_tag="Eint_110470"
FT   mRNA            complement(<59559..>61238)
FT                   /locus_tag="Eint_110470"
FT                   /product="pre-mRNA cleavage and polyadenylation specificity
FT                   factor"
FT   CDS_pept        complement(59559..61238)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110470"
FT                   /product="pre-mRNA cleavage and polyadenylation specificity
FT                   factor"
FT                   /note="similar to ECU11_0610"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC2"
FT                   /protein_id="ADM12547.1"
FT                   /translation="MFIFFQCEICLQYGLRWENRVWHREIATPMNYLYSQESPWNSVEG
FT                   CSAGFFIPGTHSFLTYNGNIVRLWKYGSGLVLVKQHILFERVCQVEKYRISPDQDGLVF
FT                   LFHKAKISLVRFDPQENEFKTTSLKFFEKDEFDIKDEDIRNVRIGTDLGMFQMNKRYFS
FT                   VFPLFPGMFNAKVFKFIDIDGKIKNPIDFTFLENYSIPTVCLVYDSLPKKYTVVRNYNA
FT                   IVFSIDLSAGKFHTIDEFLVPPKTFKVVCAGSILLFISHNSILIRSTSSSYSVPLNRMS
FT                   EACEAGKALNDVVLFDVNFFSRGNTCLIFNGNGDRYRLEISMDIKRIIGASLEFERRGS
FT                   IASCIGEVENLLFVGSIGDSSELFEIKSLRRRTEENVIPAERSVLEEYSKLFGNKDQET
FT                   QKQDEEYAKLFNEGSESRAGETFTLHQVDEISNIGFLNEVAMKRENEAVFVVEGLEPGV
FT                   RVVSNIMPLKILKSQKTRRYLYCSRVLDFYILGRAGDTKVFKWPEKSLLEVDGKYAKDM
FT                   DTLLFAEFGTGIIQITPTFWLGMDHNLKVVEETLLAKRQRQK"
FT   gene            complement(<61266..>62444)
FT                   /locus_tag="Eint_110480"
FT   mRNA            complement(<61266..>62444)
FT                   /locus_tag="Eint_110480"
FT                   /product="sn-1,2-diacylglycerol ethanolamine
FT                   phosphotransferase"
FT   CDS_pept        complement(61266..62444)
FT                   /codon_start=1
FT                   /gene_family="HOG000184687" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110480"
FT                   /product="sn-1,2-diacylglycerol ethanolamine
FT                   phosphotransferase"
FT                   /note="similar to ECU11_0620"
FT                   /db_xref="GOA:E0SAC3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC3"
FT                   /protein_id="ADM12548.1"
FT                   /translation="MLKGSFFKIELGADELSSLRKHRFIGTDNSILSKYVIHHYVKWSL
FT                   EKIPATVAPNTLTLCGFIAMAISLGLTLIFDPYLCNPPRLLSLVNFFLMFVYFTCDNLD
FT                   GAQARKTGSGSPLGQLFDHGVDSCCALATSIALSSAFGFGLSQKFLIFTLAIMIEFYLA
FT                   GIEEKFTGHFVLGKISGASEGIAFALISHLITSLCGKGFFQYVFSDEFLWPIKKTYSLI
FT                   LRTNNFSAISAIITTCLVGNTILTLISIESKMRPPRRLSLYSTFLRMMSLIASFVVLHN
FT                   TLSTESLWIQYLNILMFGQIFSIKYVNEVFSYIIGKDLFLFIPVYLMYLMISVVLQLQN
FT                   PKKFREAFIAVSFVFSSVYYILVASKVIITFKEALGISFLTITKRNKPEAGR"
FT   gene            <62596..>63462
FT                   /locus_tag="Eint_110490"
FT   mRNA            <62596..>63462
FT                   /locus_tag="Eint_110490"
FT                   /product="hypothetical protein"
FT   CDS_pept        62596..63462
FT                   /codon_start=1
FT                   /gene_family="HOG000149741" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110490"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0630"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC4"
FT                   /protein_id="ADM12549.1"
FT                   /translation="MIDANNEKKSQSKQLCPIKIPLAGPLKDMIGREVGDKASTVIDIL
FT                   EGVVPTVSPEDMYSELVEALSPVVDQKAKGLVGKVMAYKRKTCRDGDECKAKNCIFLHS
FT                   WDRKSGEGSVQTGSKGREEGIDSGEVTGKRRRTNESNENNEVVFNKVNESRHNPENLKA
FT                   YAARFGKVVNFKRLNPEKYLVVFEDPESASELVKSSEPVLEDFGIKKFYNVIDNLVKVE
FT                   LKKLFEEQETVIDKMSTEFSAALLGHLRNINIRIRNLVLKEKLKDGTGTDNKRGFDQEN
FT                   SLYYNCF"
FT   gene            <63555..>63791
FT                   /locus_tag="Eint_110500"
FT   mRNA            <63555..>63791
FT                   /locus_tag="Eint_110500"
FT                   /product="U6 snRNA-associated Sm-like protein"
FT   CDS_pept        63555..63791
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110500"
FT                   /product="U6 snRNA-associated Sm-like protein"
FT                   /note="similar to LOC100214187"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC5"
FT                   /protein_id="ADM12550.1"
FT                   /translation="MNKDKIKKTQLLSDLGRFKGKKITVTFIDGKSVTGKLTSFDDVGN
FT                   CVLKKCGEWDYGNTVVCLGRSIVLVCLNAPYIL"
FT   gene            complement(<63914..>64384)
FT                   /locus_tag="Eint_110510"
FT   mRNA            complement(<63914..>64384)
FT                   /locus_tag="Eint_110510"
FT                   /product="vesicle-associated membrane protein"
FT   CDS_pept        complement(63914..64384)
FT                   /codon_start=1
FT                   /gene_family="HOG000149234" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110510"
FT                   /product="vesicle-associated membrane protein"
FT                   /note="similar to ECU11_0640"
FT                   /db_xref="GOA:E0SAC6"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC6"
FT                   /protein_id="ADM12551.1"
FT                   /translation="MLDIKVTPQTTIRVKRNKKSSTFIVHNNSMESVGYKIKTTKPRDY
FT                   IVRPNMGLIVPMQHAEIEVTLSETTVPDNTHKFLIEIYKFDWRRSLNDFKHYLKSVSPK
FT                   PCWTSRIGILYEEEEKITKETVECSEDRGAIVLFVHIYILCNVLYLFYRFFE"
FT   gene            complement(<64423..>65088)
FT                   /locus_tag="Eint_110520"
FT   mRNA            complement(<64423..>65088)
FT                   /locus_tag="Eint_110520"
FT                   /product="arginine methyltransferase-interacting protein"
FT   CDS_pept        complement(64423..65088)
FT                   /codon_start=1
FT                   /gene_family="HOG000149740" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110520"
FT                   /product="arginine methyltransferase-interacting protein"
FT                   /note="similar to ECU11_0650"
FT                   /db_xref="GOA:E0SAC7"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC7"
FT                   /protein_id="ADM12552.1"
FT                   /translation="MKRAHSLLDYAKEVNGTKTVELEDLDIHLLDPHISLRKIDTNALY
FT                   NILSLAYHFEDVKMEEKVVTTSSSTDKRQRYFCDTTKCFQCGEAGHEFRECTRALKRDV
FT                   CDLCSREGHERTYCPYRHCPKCRRFGHSSKNCSFPEDLNGSKICKACPTGSHSIADCCR
FT                   TWKRYRLNGNTSKYTIYKACPICLSKRHFIDDCFSVERSQSSIFSSSYAELAKFYNKQ"
FT   gene            complement(<65167..>66120)
FT                   /locus_tag="Eint_110530"
FT   mRNA            complement(<65167..>66120)
FT                   /locus_tag="Eint_110530"
FT                   /product="Ser/Thr protein phosphatase PPI-1"
FT   CDS_pept        complement(65167..66120)
FT                   /codon_start=1
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110530"
FT                   /product="Ser/Thr protein phosphatase PPI-1"
FT                   /note="similar to ECU11_0660"
FT                   /db_xref="GOA:E0SAC8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC8"
FT                   /protein_id="ADM12553.1"
FT                   /translation="MSNEKVDLDRIIEKLLSVRNSKLGRLVHLVEEEIRYLCEKSTEVF
FT                   KQQPTLVEVKAPVKICGDVHGQYYDLLKLFEHGGFPPSSNYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKFPNNFFLLRGNHECASINRIYGFYDECKRRYNTTIWKVFTECFNWIPISAL
FT                   VDGRILCMHGGISPDLKNMDQIKAIARPTDVPDEGLLCDLLWSDPDPGVRGWGENDRGV
FT                   SVTFGPDTVEKFLETHNLDLICRAHQVVEDGYEFFANRSLVTVFSAPNYCGEFENSGAI
FT                   MDVDKDLVCSFQVLKPTDFINNSEYKKKQMGIPRKK"
FT   gene            complement(<66225..>67625)
FT                   /locus_tag="Eint_110540"
FT   mRNA            complement(<66225..>67625)
FT                   /locus_tag="Eint_110540"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(66225..67625)
FT                   /codon_start=1
FT                   /gene_family="HOG000149739" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110540"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0670"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAC9"
FT                   /protein_id="ADM12554.1"
FT                   /translation="MPIVAHSENGLTFDVFAEGASWVECDYYSLKSNKVAWAKNNQVRY
FT                   YDLKNKKMILEMEINRPREIEASENGNNVGILNGKGEMVVLGKNGIMLRVENVSKFRIS
FT                   NSLLAYISGASFFIHRIGEDGIEESPFHTSRISILEFLISGEFVFLATKKLEKDGMHKL
FT                   LRMGKDSVEVLHSLKELQGFSLKAHASNRYILLLLMTSYVNNSYFPESDLYFHDTAACT
FT                   FKSLGYSPVHSYVFLSNGFAVCHGPQPSSVSVHRLDGKPGYNFPEGIRNRMFFNQHENI
FT                   AVFAGFDNLSGDIEVFHVPSRKPIAKFNVLGASLIDWKENGSYFCVSTTSYFQEDNKIT
FT                   LYDYYGRKIDERKFESLFSACSYGEKEEFVEIEKPEKLIIEMQKKYVPPSIHTFMTKTT
FT                   SKSRMPKKKEETVNEKPKKSSKEDLLNTLKEIESLKNRMKDGEELSIKELNLILKEYKL
FT                   KGELKSLD"
FT   gene            complement(<67731..>68738)
FT                   /locus_tag="Eint_110550"
FT   mRNA            complement(<67731..>68738)
FT                   /locus_tag="Eint_110550"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(67731..68738)
FT                   /codon_start=1
FT                   /gene_family="HOG000149737" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110550"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0680"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD0"
FT                   /protein_id="ADM12555.1"
FT                   /translation="MNLYDLVRSNSHEEISRLDHPEFNRFRAVAYINMGKFGEALKYAE
FT                   KRSFERAYALYKLKKYKKALRILRYLDTEGSKVLASQCLYYLGYYNTAYKVLSEIKKDD
FT                   EIVINLQAMKSLAILADKNQYTFGNKFQLRKKDDLVEFEDLTRYHFSQNESRVDFIFNL
FT                   SFENLSKEETFVNFLSNQLERREMVGTIVEEQLKNVKGEDANANVLLRNQRETVEFNTG
FT                   AISRFSNPLHFQKNFPGSGTPEEMMKGNECLWIEKVYNSDFGIKAEEIPLFSPKMILLR
FT                   ILTLCKNGRFPSKKLLGRVRNWPEVPIKRYLEVLDSETPPSKELYIGMSKDIMN"
FT   gene            <68901..>69941
FT                   /locus_tag="Eint_110560"
FT   mRNA            <68901..>69941
FT                   /locus_tag="Eint_110560"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT   CDS_pept        68901..69941
FT                   /codon_start=1
FT                   /gene_family="HOG000283479" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110560"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /note="similar to ECU11_0690"
FT                   /db_xref="GOA:E0SAD1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD1"
FT                   /protein_id="ADM12556.1"
FT                   /translation="MVHAKEQIKAVILVGGYGTRLRPLTYTLPKPLVPFANKPILRHQV
FT                   EALVKAGIKEIILALNYYSEVIIREVRDYSNEFGINIIYSKEQEPLGTAGPLALARKYL
FT                   EGHTFFVLNSDITCKFPLSEMLSFHRSHGKEGTILSTRVDDPSRYGLVITEEGTSVVET
FT                   FLEKPKDAVSNRINAGIYILNSSVLDRVELRECSIEREIFPEMAKERQLQVFDLEGFWM
FT                   DIGQPADYIRGQGMYLKHYREANVDEHSEDGRTFCVENNVVIGRNVKIGKNVTISNSAI
FT                   FDNVEIGDNVTIRDSIVGWNTKIEDNATVNTCCVLGYATTVERFAILSSVKTFPNESPF
FT                   KLLEDI"
FT   gene            complement(<69972..>70340)
FT                   /locus_tag="Eint_110570"
FT   mRNA            complement(<69972..>70340)
FT                   /locus_tag="Eint_110570"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(69972..70340)
FT                   /codon_start=1
FT                   /gene_family="HOG000149736" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110570"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0700"
FT                   /db_xref="GOA:E0SAD2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR005341"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD2"
FT                   /protein_id="ADM12557.1"
FT                   /translation="MKAGKALVVLFEEGSKVLFKAITNTISDIMLRDRMSKTEAEMILD
FT                   VTACANKNKMKDSFLRMHEANSKERGGSPYIQSKILAAYTVLSGTSPSFLEEFQSREKN
FT                   PSGKEQKVLSTKNKRIQF"
FT   gene            complement(<70366..>71346)
FT                   /locus_tag="Eint_110580"
FT   mRNA            complement(<70366..>71346)
FT                   /locus_tag="Eint_110580"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(70366..71346)
FT                   /codon_start=1
FT                   /gene_family="HOG000149735" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110580"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0710"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD3"
FT                   /protein_id="ADM12558.1"
FT                   /translation="MDHWARNFLEIKEDHTDPSDYEKFFTCFRNYLKNEPSSHCEVSKV
FT                   LVKALAMFKNTQLLSITYRLLYCLDIPPKIPESLLRRHFKSLYLREYMFPLISKLDLHL
FT                   FDLALQKLLYKPHYECKSFFDLMKSRRNWVVEFLGLKKRSLARKQMVLMVRTAMFHNLE
FT                   YFITFFGSRDRSLSFLAFEVFKLFIEELIRKKENKSFDVKGQPVLLHKEATFSIWIRDE
FT                   DAWIALNPRLKVESSFNFLIHFIDFMSEKKKLQQLIATNNRNGMEAIVGKYINLEESLA
FT                   IPGHRWISKEPRCQEIPKEEETENICFEYLFSGVTYKEMADCIEI"
FT   gene            <71472..>71834
FT                   /locus_tag="Eint_110590"
FT   mRNA            <71472..>71834
FT                   /locus_tag="Eint_110590"
FT                   /product="ribosomal protein S10-like protein"
FT   CDS_pept        71472..71834
FT                   /codon_start=1
FT                   /gene_family="HOG000149233" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110590"
FT                   /product="ribosomal protein S10-like protein"
FT                   /note="similar to ECU11_0720"
FT                   /db_xref="GOA:E0SAD4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD4"
FT                   /protein_id="ADM12559.1"
FT                   /translation="MDVEMKKQDIDVTVSMETMKVCIDMASLEEKRINKVCREFYEYGK
FT                   TFIDNLERETVLPKKIESITTLRNPSGQGTKKWSRYKMIVHLRNFYLEATHQQLEKVVQ
FT                   FLRNFPHVEINLSIQN"
FT   gene            complement(<71911..>72348)
FT                   /locus_tag="Eint_110600"
FT   mRNA            complement(<71911..>72348)
FT                   /locus_tag="Eint_110600"
FT                   /product="class 2 transcription repressor NC2 subunit beta"
FT   CDS_pept        complement(71911..72348)
FT                   /codon_start=1
FT                   /gene_family="HOG000178641" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110600"
FT                   /product="class 2 transcription repressor NC2 subunit beta"
FT                   /note="similar to ECU11_0730"
FT                   /db_xref="GOA:E0SAD5"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD5"
FT                   /protein_id="ADM12560.1"
FT                   /translation="MERNDDENTLPKATVDKMVSSMLPKNSIVPKESKEIFQNACIYFL
FT                   NMLTLEANKACEEEKKKTISYEHIYKALKNLGFEDYVDSCMKEHGNYENYIKQKPSKID
FT                   KFKDSGLSMEELHNQQIKLFQNAKLQFEKSFEDDHYDGNEE"
FT   gene            <72440..>72868
FT                   /locus_tag="Eint_110610"
FT   mRNA            <72440..>72868
FT                   /locus_tag="Eint_110610"
FT                   /product="hypothetical protein"
FT   CDS_pept        72440..72868
FT                   /codon_start=1
FT                   /gene_family="HOG000149734" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110610"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0740"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD6"
FT                   /protein_id="ADM12561.1"
FT                   /translation="MLLNISNLFMHNMDTEFISGVVVSYTKLLREISNMKKEIKEVLGT
FT                   AQAVLSLISACHSTEASCRSSGCRCSHSLAEAGEKIGLGSYKRTLKSPKKPLTGKKEPS
FT                   RRKGTGKNSSLITDSHPSFFEEVGGEVCSPQKEGDSSC"
FT   gene            <72929..>73519
FT                   /locus_tag="Eint_110620"
FT   mRNA            <72929..>73519
FT                   /locus_tag="Eint_110620"
FT                   /product="putative RNA-binding protein"
FT   CDS_pept        72929..73519
FT                   /codon_start=1
FT                   /gene_family="HOG000181708" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110620"
FT                   /product="putative RNA-binding protein"
FT                   /note="similar to ECU11_0750"
FT                   /db_xref="GOA:E0SAD7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD7"
FT                   /protein_id="ADM12562.1"
FT                   /translation="MTEIQTRSVPIHPKKMRGMKEEWMKIYTPIVEICKIQIRMNIKGR
FT                   CVEMRTCDHTEDSSYLERSAQYINAVNIGFPIEDAIAILKFADVFLDHFEISEVKTLRG
FT                   LHIERAIGRIIGREGKTKSAIEEFSRSKIIVQDQTIHFLGTIENIRIAKDAVCRLIMGS
FT                   QPGSIFNRLRIINSRLKEKYGGIQTVYSEFEKR"
FT   gene            <73582..>74673
FT                   /locus_tag="Eint_110630"
FT   mRNA            <73582..>74673
FT                   /locus_tag="Eint_110630"
FT                   /product="exonuclease 1"
FT   CDS_pept        73582..74673
FT                   /codon_start=1
FT                   /gene_family="HOG000149232" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110630"
FT                   /product="exonuclease 1"
FT                   /note="similar to ECU11_0760"
FT                   /db_xref="GOA:E0SAD8"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD8"
FT                   /protein_id="ADM12563.1"
FT                   /translation="MGISGLLPIVASKLVKMHISSYRHKRLGIDGHAWLYQILSCVAEE
FT                   MFFRIPTKRYVSMFEEKVKLLENYGITPIIVLDGDLLSSKEETNRKRQIRKEKSRKEAE
FT                   YWLMKNDPEKAKAFMRQCISVTRGVVSDITKMLERIDVEYIISPYESDAQLCYLERIGY
FT                   IDYILTEDSDLIPYGSNRILYKFDNTFVREFSRSCLAEVRGKDFEENILDISILSGCDY
FT                   LSSIQGVGIVTAHKLLSRERTIERVVEYLKHRKPVPKNYLDDFFKARKTFLYQIVYDPI
FT                   ERKRRYLQDVTEEMEFLGSLKEEEYKVEEGPLGLFFKSCMQTKTVKRHFVPSPKKVIPE
FT                   VMKIKRREEFIKVDAHIHSPYFK"
FT   gene            complement(<74820..>76298)
FT                   /locus_tag="Eint_110640"
FT   mRNA            complement(<74820..>76298)
FT                   /locus_tag="Eint_110640"
FT                   /product="glucose-repressible alcohol dehydrogenase
FT                   transcriptional effector"
FT   CDS_pept        complement(74820..76298)
FT                   /codon_start=1
FT                   /gene_family="HOG000294222" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110640"
FT                   /product="glucose-repressible alcohol dehydrogenase
FT                   transcriptional effector"
FT                   /note="similar to ECU11_0770"
FT                   /db_xref="GOA:E0SAD9"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAD9"
FT                   /protein_id="ADM12564.1"
FT                   /translation="MAEECLALRRKFFEKTTEAQEDPWTALDLCSQGIRNISRSLFDMR
FT                   FIRVLNFTNNEIEVIPKEICKLRHLEVLNLSKNKIRSIPPDIGKIVSLKELNLNDNLIS
FT                   NIPMEIGTLYNLEVLEISNNPLIVPFNTLLREKKLLQFCREHNTGYPPPNDRPWIECLN
FT                   KDVLYGDTISVGTFNILSNVWAARSTYAPSWVINPEFRREGILQEIVLYNVDILCLQEI
FT                   ELYSFFDFYKEQLEMRCNYDSIIYPRGRIKNVADKKNVDGCAIFWRRSKFRLIAQFPID
FT                   FCQKITQDTRFNINQELLDRYGKKDNIAIGALLERPNGQQVLVVNTHIFWDPDYSDVKL
FT                   LQVILLIEEVRKISSRHPNACLLLQGDFNSLKSSSVYKSITTQTIDLADFRGTMHHLSS
FT                   QEFGEGLKLNDSYRNQDLGFTNFTPLFKDVIDYIFYDSKVTLTSVLAPVEDEYAENIAG
FT                   LPNMHFPSDHIFLGAKFTLPYRSPNQNSFGRNTR"
FT   gene            complement(<76402..>76938)
FT                   /locus_tag="Eint_110650"
FT   mRNA            complement(<76402..>76938)
FT                   /locus_tag="Eint_110650"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(76402..76938)
FT                   /codon_start=1
FT                   /gene_family="HOG000149231" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110650"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0780"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE0"
FT                   /protein_id="ADM12565.1"
FT                   /translation="MKNFHPLSMSTQTEAEANISEIIKKYTKDISVRPELFGKIAIQII
FT                   ICDGGEKVMVVKVPKSILHGVQMNYSNIIKAAKQQFHDYYIIFIRNFEIESDVPEGAHC
FT                   KPKEIEKEWLANACFPFLLTGTRTDVRGVDDMVVNVLLERRTSFSRAEMDTIGAGLNKL
FT                   LGKNYIVDVNHHTKN"
FT   gene            complement(<77005..>79128)
FT                   /locus_tag="Eint_110660"
FT   mRNA            complement(<77005..>79128)
FT                   /locus_tag="Eint_110660"
FT                   /product="vesicle coat complex COPII subunit Sec23"
FT   CDS_pept        complement(77005..79128)
FT                   /codon_start=1
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110660"
FT                   /product="vesicle coat complex COPII subunit Sec23"
FT                   /note="similar to ECU11_0790"
FT                   /db_xref="GOA:E0SAE1"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE1"
FT                   /protein_id="ADM12566.1"
FT                   /translation="MEEEIRNIEENDGIRLTWNVWPSKGDATTKVPLACLYNIHQETGV
FT                   LECEPIYCMSCKSVLNPHCNIDFGRQTWNCIICNNNTALPSHARGITPDNLLPELLPQN
FT                   STIEYVLNRESVFPTVFFLIVDICTFDEQRHILLKDALKTVVEGIPEDALIGLIKYGTN
FT                   IELLELSTASPRKTHLFSGKKEYTAEVLKSLNAASKSESQVVGRFLRRKEECRDFLQNI
FT                   VEGLEKDPFPVLPAYKPVRCTGSAVSLALSLLETSFPDTAVKYLLFTQGPCTFGPGTTT
FT                   PIKFKEKGRNEHLEENDPMYAGPARKFYTGLAERMNSVGHSLDILAATIVDVGICHMER
FT                   LTTMTGGMLIMAQDFDRDIYISSCNKVLNRSKEGYLAQGFNAKIQVKTSKNLEYKGIIG
FT                   QGRSLGGCWRIGSIFPCTNISILLDKKPDAKHGEFGYVQLVTQYQRSDKKLLVRVTTFA
FT                   RLFTDSREDVVCGFDQEAVAVFQARFLLLKKYEEIKDCERMIDKNLIRFTKTFARYDKG
FT                   EPSSLSLPDSMAYYPNYMFFFRRSLLVQTGNNSPDETAYYSSLLYNQKVSDALKLIKPT
FT                   LVSYHYQGGVEAVEVDSKSLMPDVVLVLDTFHNVVVWRGEYVAQWVKEGYHEQAEYEFL
FT                   KNILKSSEERARTLCNERLPTPQFCITEQNKSQQRILHHYVNPSGGGSIITENINYEKF
FT                   EEALRRVVVFNSE"
FT   gene            complement(<79259..>81307)
FT                   /locus_tag="Eint_110670"
FT   mRNA            complement(<79259..>81307)
FT                   /locus_tag="Eint_110670"
FT                   /product="DNA replication licensing factor Mcm4"
FT   CDS_pept        complement(79259..81307)
FT                   /codon_start=1
FT                   /gene_family="HOG000149230" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110670"
FT                   /product="DNA replication licensing factor Mcm4"
FT                   /note="similar to ECU11_0800"
FT                   /db_xref="GOA:E0SAE2"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE2"
FT                   /protein_id="ADM12567.1"
FT                   /translation="MHIETWNMYFPEEEFTAFNELVQIILAVKKKLKDVLSEDKLERIL
FT                   EARVYYISEQYLESLVEKNLLDTNAGNLLLCVSCAVSELLYDKGYLSVKICTRVETVNK
FT                   EGNFGDVDRANLGKLVFMAGTVCRVGFRRVIISKMFFECSKCGDVIYVNVKNNVYRPPA
FT                   GCKGSCNSRSFVLMRNHPEMECRDMQEIKIQELYGGIGEDGKGIPKAVDCILYDEFVGI
FT                   LVPGDIVQIVGVLGVELENDGLYRLMVHINNLQIVKNKNFFIESLEYQSRDFAEFRRIA
FT                   KGKNTLASLVRSLYSSVYGNELIKIGLVLSLFGGTRKMAGQHLIRSETHVLIIGDPGLG
FT                   KSRLLLGTCSILPKSSYVSGSFTTTAGLTVSLTHDPVSGEYMADAGALVVADNGICCLD
FT                   EFDKIDDHAALFEAMEDQKVSIAKGGVICSVPTRSTVIAATNPRHGHFDRTKSMMENIR
FT                   FDPGLLSRFDLVFLLLDDLSEKESYMISGQILKKRQTLSPGIGSEFDDIMETIRRDDFI
FT                   EEVRSRGDVYPMEIMRKYISYARANVFPVLSKSAKEAIREYYVEIRKQGGVSARDLESL
FT                   IRLTEARAKAELRSIATRADAVFCIELHRRTFVPREKMSNSRRNGDFSQVLKEYGRKKG
FT                   EWVVSVEELRRLIISFDSGKPANDFIEALNHNGLIIKKGAGMYKITR"
FT   gene            <81453..>82229
FT                   /locus_tag="Eint_110680"
FT   mRNA            <81453..>82229
FT                   /locus_tag="Eint_110680"
FT                   /product="ribosomal protein S8e"
FT   CDS_pept        81453..82229
FT                   /codon_start=1
FT                   /gene_family="HOG000234606" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110680"
FT                   /product="ribosomal protein S8e"
FT                   /note="similar to ECU11_0810"
FT                   /db_xref="GOA:E0SAE3"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE3"
FT                   /protein_id="ADM12568.1"
FT                   /translation="MPQNDFVERHIKKYGRRLDHELRQYKKDRREEKMVSRKAEKLFGL
FT                   KAKLFAKKQRASKIQLKKDQKMKEFKEKKMEVSIESNPLPHFLLDREMEERARDINNKI
FT                   KQQRQEKGSKYSVPLPKIHPLPEKEVFGVVSSGKRRSKHWKRMVTKPCFVGSDFTRKPP
FT                   KYERFIRPMAMRFRTAHVSHPELSSTFNLKIIGLKKNPHSEVYTGLGILSKGTIIEVDV
FT                   SPLGLVNGAGKIIWGKYAQITNNPENDGCVNAVLLV"
FT   gene            complement(<82349..>83353)
FT                   /locus_tag="Eint_110690"
FT   mRNA            complement(<82349..>83353)
FT                   /locus_tag="Eint_110690"
FT                   /product="DNA repair protein Rad51"
FT   CDS_pept        complement(82349..83353)
FT                   /codon_start=1
FT                   /gene_family="HOG000227426" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110690"
FT                   /product="DNA repair protein Rad51"
FT                   /note="similar to ECU11_0820"
FT                   /db_xref="GOA:E0SAE4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011941"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE4"
FT                   /protein_id="ADM12569.1"
FT                   /translation="MSEEYQYQDAEYHSESISISELKNGGILAVDIAKLIEAGFTTVES
FT                   LAFAPKRQLLSIKGFSDVKVDKLIKEAAKLVPMGFTTASAYHQRRSELVYLTTGSSEVD
FT                   KLLNGGFESGSITEIFGEFRTGKTQLCHTVAVTCQLPPEQGGGGGKAMYIDTEGTFRSE
FT                   RLIPIAERFGLDPDEVMDNISYARAYNSDHQSQLLIKASAMMSESKYSVLIIDSATALY
FT                   RTDFSGRGELGARQLHLAKYLRSLVNLAETFRVAVIITNQVVSNVDGAVGMFAGDIKKP
FT                   IGGNIMAHASTTRLYLRKGRGETRICKIYDSPCLPESEAVFAITEQGINDPDE"
FT   gene            <83454..>83780
FT                   /locus_tag="Eint_110700"
FT   mRNA            <83454..>83780
FT                   /locus_tag="Eint_110700"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF10"
FT   CDS_pept        83454..83780
FT                   /codon_start=1
FT                   /gene_family="HOG000149733" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110700"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF10"
FT                   /note="similar to ECU11_0830"
FT                   /db_xref="GOA:E0SAE5"
FT                   /db_xref="InterPro:IPR003923"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE5"
FT                   /protein_id="ADM12570.1"
FT                   /translation="MKEEEFNELKQNLDNYTPLLPESVIDYFMEKAGMVTSDQSMKKLV
FT                   SLLAHKFVTDIAISSFQYHRINQKAAQKDKRFAKEKKPTFQLIDLEKALEEVGISISRP
FT                   HYYM"
FT   gene            complement(<83827..>85188)
FT                   /locus_tag="Eint_110710"
FT   mRNA            complement(<83827..>85188)
FT                   /locus_tag="Eint_110710"
FT                   /product="AAA ATPase proteasome regulatory subunit YTA6"
FT   CDS_pept        complement(83827..85188)
FT                   /codon_start=1
FT                   /gene_family="HOG000149229" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110710"
FT                   /product="AAA ATPase proteasome regulatory subunit YTA6"
FT                   /note="similar to ECU11_0840"
FT                   /db_xref="GOA:E0SAE6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE6"
FT                   /protein_id="ADM12571.1"
FT                   /translation="MRDLEASKNYKVENKTAEDEEEYEKVKNRTKDNKPEEKKRDINND
FT                   ILGALIYRKILKDYGIKKKPKTEKTKDTSGGTKGVLYLIIIILVFAYVIYRIIVSEGGG
FT                   SIGKTSKEKDEKMEDQDKPSFRDGSTFENVPYFGKEDLMIQVISQVTKIVSLLRTVPEK
FT                   ELHKTIETTQRNFLFHGPPGTGKTLFMKKLIYLVDLNIKFLKMRSEIGEEEFDRMDHNE
FT                   KLVRARQMESLTRITFVTPSSLNNKYVGETEKNIRALFQSANDGNYWASFVFIDEVDVF
FT                   FSKRSDRSQDYTLKAQTEFLNTIGGACDKVNSNVFLFGATNLYDSLDDAFKRRFSGVYE
FT                   FQLPNDEERLEILEEYLGDCKKEITNRFNDLIRMTNGMAQSRIVDVLKKISFANDGNVD
FT                   RISWNDLVRALEDGDPKKKGTDGSDVSVAKSLKKFYFLEPKPKRRDAEILITKE"
FT   gene            <85397..>86561
FT                   /locus_tag="Eint_110720"
FT   mRNA            join(<85397..85845,85871..86283,86308..>86561)
FT                   /locus_tag="Eint_110720"
FT                   /product="CDP diacylglycerol serine"
FT   CDS_pept        join(85397..85845,85871..86283,86308..86561)
FT                   /codon_start=1
FT                   /gene_family="HOG000149228" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110720"
FT                   /product="CDP diacylglycerol serine"
FT                   /note="similar to ECU11_0850"
FT                   /db_xref="GOA:E0SAE7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE7"
FT                   /protein_id="ADM12572.1"
FT                   /translation="MDISEEKFDVLDSVHVSGFRILKDSGEFYQRIKFLMQNSTSVCIA
FT                   SLFFGKNGEMEDIIDILEERKRKNLMTIIFIDKNRGTVFESLESIKRRGLGSFFHLVDL
FT                   STSFLLPRRLNELLRTFHTKALVFDGLTILSGANMDASYMTNRVDRYLEIDSRELADMI
FT                   RSRVFGIRPPLEAGKTICQGLPVYVGMFKEKEEPAIVQSFLEDFDEIHISTGYLNFPAR
FT                   YFKMLQGKKVSLYASCPDKNTFDSFGPLERFIGPAYSYSFYRTLRSISSLSIHELKRDG
FT                   HSFHLKGFWGFKGRTAATIIGSSNFNRRSVERDDETNYLIITSDPDHVQKLRTEVEYLK
FT                   SNSEARTLKQLRGRTYQLAVILLFLIFNRFF"
FT   exon            <85397..85845
FT                   /locus_tag="Eint_110720"
FT                   /number=1
FT   exon            85871..86283
FT                   /locus_tag="Eint_110720"
FT                   /number=2
FT   exon            86308..>86561
FT                   /locus_tag="Eint_110720"
FT                   /number=3
FT   gene            complement(<86583..>88586)
FT                   /locus_tag="Eint_110730"
FT   mRNA            complement(<86583..>88586)
FT                   /locus_tag="Eint_110730"
FT                   /product="HrpA-like helicase"
FT   CDS_pept        complement(86583..88586)
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110730"
FT                   /product="HrpA-like helicase"
FT                   /note="similar to ECU11_0860"
FT                   /db_xref="GOA:E0SAE8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE8"
FT                   /protein_id="ADM12573.1"
FT                   /translation="MEERTVFKGMETEIRINREIPPELFPLAKDKKDSIAEEEIMDLLI
FT                   STEKKEERSGEESVKDKMGEIFSKLEKSQVLLIEGDTGCGKTTKVPRYLLERYKSIVCT
FT                   QPRRIAAVSVAKKVAQDMNVKIGMEVGYSVRFNDVSSKKTRLKYATDGILLREIVSDKC
FT                   LNRYDVVIIDEAHERSVNIDILLGYLKSILSKRKDLRVIIMSATLSSEKFISFFRCQTV
FT                   EIRHRMFPLEIFFLKKAGALDYLDEAVKTVVQIHRTEEEGDILVFLTGKEEINNGRNIL
FT                   VEILGNDAEVYCIYSMLSPEEQELVFKKTKKRKIVLATNIAETSITIEGIKYVVDCGRA
FT                   KQMRYSGAFGMDILEVAWISKAQAKQRAGRAGRTQEGKVFRLYSKEEFQEMSENTIPEI
FT                   FCCNLAKAVLELKSIGVNDIVNFDLIDKPDTSNVRKALELLYYLKAIGGDGKITPIGAR
FT                   ASKIPLEPELAISLIVSSDLGCLEDVSIIAAMLSVGNIWLDIPKYSQSHKAFLDAKSLY
FT                   FDRRGDHFSFLKIYRMWERTGFKISHLKRSFLNVRAMLQTVKIKKQLCSMFNGPCKSDE
FT                   SKIVLSFCAGYFMNVAKLVEGSSYVSIFNDTQFFVHNTSCMSRKRAKYILYHSLCRTGR
FT                   EFVRCCVEVTLEDLLKGANHMFSKVEKDLDRC"
FT   gene            complement(<88819..>89787)
FT                   /locus_tag="Eint_110740"
FT   mRNA            complement(<88819..>89787)
FT                   /locus_tag="Eint_110740"
FT                   /product="ethanolamine-phosphate cytidylytransferase"
FT   CDS_pept        complement(88819..89787)
FT                   /codon_start=1
FT                   /gene_family="HOG000187618" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110740"
FT                   /product="ethanolamine-phosphate cytidylytransferase"
FT                   /note="similar to ECU11_0870"
FT                   /db_xref="GOA:E0SAE9"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAE9"
FT                   /protein_id="ADM12574.1"
FT                   /translation="MASKEIQKVWADGCFDMFHYGHANALRQSKALGDYLIAGVHSSLS
FT                   INREKGLPVMEDDERYEVVQRCRYVDEIVKDAPFVTEMSMVREYGASIVAHGNDIILDS
FT                   KGQDSYFQVRRTGIFREVERTVGISTTETVGRMMLKNRGTCLDGEHKESNKNSRYHDQL
FT                   LELFVSSMKRERKGKVVFIDGNFDLFHAGHVVSLKIAREMGDYLVVGIHDDETTREYTR
FT                   NYPVMTTKERMLTLVSCKYVDEVIISPYLIGKEFIEKHGIDIVGTSFDTKDLSRYDSIK
FT                   EVVEHSYAENRFSYLSAEHIVNRIISNYQDYANRQKKRMKN"
FT   gene            complement(<90113..>91576)
FT                   /locus_tag="Eint_110750"
FT   mRNA            complement(<90113..>91576)
FT                   /locus_tag="Eint_110750"
FT                   /product="CTP synthase"
FT   CDS_pept        complement(90113..91576)
FT                   /codon_start=1
FT                   /gene_family="HOG000077514" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110750"
FT                   /product="CTP synthase"
FT                   /note="similar to ECU11_0880"
FT                   /db_xref="GOA:E0SAF0"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF0"
FT                   /protein_id="ADM12575.1"
FT                   /translation="MLAPSEHGEVYVLEDGSECDLDLGNYERFSSINLEASNAITSGKI
FT                   FFEMIKREKEGHFLGKTLQINPHAIDDVIRRIKMVAETPVEDFKSGRRVIPDVVIIELG
FT                   GTVGESESSIYTDAFAKFQRIVGRSNCAFVSVDHLVELESGEQKTKSIQMGCRNFRRFG
FT                   LSYDIIVCRGVRDPSKETREKISKNCWVEPGNVFGLPNLESVYLVPKFLEEHGMVESLN
FT                   KVLGISSKEGDREILETFERLVQKHEDTVRIGIVGKYSPEFDSYTSLVHALRFSGASVG
FT                   VNVEIEWINADSYTTEDLEKCNGIIIPGGFGARGIEGKISAIRYARENRIPLLGICLGY
FT                   QLSIIEMCRNVLGMKDASSEEFNPSGKNLVVRFISDKNGVVDKKLRVGGYEVELEDGLV
FT                   KRLYSGAEKIRERHRHRFEVVRSEVSSLCSYGLRFVGFSDERRAAKIFELTSHPFFVGV
FT                   QFHPEFTARPNQPHPLITGLISASCRKLN"
FT   gene            <91890..>93521
FT                   /locus_tag="Eint_110760"
FT   mRNA            <91890..>93521
FT                   /locus_tag="Eint_110760"
FT                   /product="methionyl-tRNA synthetase"
FT   CDS_pept        91890..93521
FT                   /codon_start=1
FT                   /gene_family="HOG000200402" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110760"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="similar to ECU11_0890"
FT                   /db_xref="GOA:E0SAF1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF1"
FT                   /protein_id="ADM12576.1"
FT                   /translation="MKKFITSALPYVNNQPHLGNVIGSVLSGDVYSKYCKKKGETCLYI
FT                   CGTDEYGTAIEMEAVSQGRPPLEICEENRRLHKQVYDWFNIDFDYFGFTSTPEHTEMVQ
FT                   SLFMKMYNNGHFKELEIEQFYCGNCGIFLADRYVVGECKFCGDLGAKGDQCDACGQTYN
FT                   FLELLSPKCSICSTVPIIRSTCHLFFDLEMFRPHLLETYKENGHLWSQNAQNIFNQWIS
FT                   MEFHPRCMTRDLKFRWGVPVPLEKFKEKVFYVWFDAPIGYLTFLKELVGEDFSEWCKDS
FT                   ELVQFMGKDNVAFHTIIFPAMIYATGEKYPIIKRLSATEYLQFENQKFSKSRRHGIFGL
FT                   DLVKGNLGKPCIWRYYLMKIRPESTKDSNFTFYDFQQSVTADLINNLGNFVNRVLKYIE
FT                   SRCNSRVSLLELDEKDKEFVEDINGLYRRYITKMDEIKLREGLQVVMEISRRGNEYIQE
FT                   GVRNKARKSHFFCLGFSVVGFLATLLYPFMPVASVEILRMCNLEETGLPESIQIIDGHM
FT                   IGGRICPLFENFTPEQLEEMKKYGSS"
FT   gene            <93583..>96294
FT                   /locus_tag="Eint_110770"
FT   mRNA            <93583..>96294
FT                   /locus_tag="Eint_110770"
FT                   /product="U2 snRNP spliceosome subunit"
FT   CDS_pept        93583..96294
FT                   /codon_start=1
FT                   /gene_family="HOG000149732" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110770"
FT                   /product="U2 snRNP spliceosome subunit"
FT                   /note="similar to ECU11_0900"
FT                   /db_xref="GOA:E0SAF2"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF2"
FT                   /protein_id="ADM12577.1"
FT                   /translation="MSNEDHSRESARKRMSEWDEEVDPGRENVSKWEITPRTATQSKRL
FT                   KWDQTPLGYIRVEDDLWRRSGMGSGAIWDRETQDTGGMAEYSEMSLREINMCLPSKGYR
FT                   RYDFVQTFGNEDPSIADLPDIPAEERDFFMPLLEAGDGDEVDIYKGILLVKNGSKKMSI
FT                   RGLRILKSKEVNHVLEKVLLMAMSLELDDKDKGKIGGLLYSLLDGVDMDGVKYVREILF
FT                   VVGSYSYFLSLRRMCIPVLALVYKRGFDFSVKSIEGAFGSKEGYVREMAGHVVGTFVDH
FT                   FGMERTHTLLESLAGRKDTESRRACAKCITAICEFIGRRVVPYLGPVLGTLCKLITDRN
FT                   RFVRMDAANTMSYISKVVSPVRTAQMDSVFELLKKEISRSGEIEFNSLLNAMSHLCSNN
FT                   KEHSKVVFGFLKASRKKEIPNIKAFERICNEIEAEDSWEYFDQISGILFSSKGRDNANL
FT                   VISICIKIGSEPRVFKRILDHYSNPLNAGMISRIFSKVQKLKFEGEEVEIYLRAICNAI
FT                   RSDETTASLVLPLASKMFLQKRHVSVLASESFKLLKNPSQDVRIRSLKAIDGLAKILER
FT                   KELMHYGNILMENVDGSDQDTLSFVIKAICSIYNSYRFRPASEIVPTILPILKSREQRT
FT                   VASCVALLRTICMNAPEECEKISMREWMRISYELIATLSSWSKEIRRNTTVSLGCISRI
FT                   VGPQEILDILMDSLESEDKNQRAGSSLGISVVGEYNGIFSILPTLLADYGAPSAFVQQG
FT                   ILKAMCHFFQQTYRVPLRYVYSILPMIEDAMMDEDPSYRSLGMDLIRHIVLNHSPSTMD
FT                   IELAIHLLNLVWANILDPSLAVQQSFDGCMESFVTILSSQAVYGYVLQGLFHPSSAVRR
FT                   RYHTVLEAMEHFDSTSLAQCFLVEEDLLGLEK"
FT   gene            complement(<96316..>97287)
FT                   /locus_tag="Eint_110780"
FT   mRNA            complement(<96316..>97287)
FT                   /locus_tag="Eint_110780"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(96316..97287)
FT                   /codon_start=1
FT                   /gene_family="HOG000149731" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110780"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0910"
FT                   /db_xref="GOA:E0SAF3"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF3"
FT                   /protein_id="ADM12578.1"
FT                   /translation="MVVNKISVADLVKFEEGDRIDIGELEENKESVYAAVREEAFDAIE
FT                   QGRRKMAKKKDEDFYEIIPSTNLEKSMDRILHGERKKESRAIVFEKNLKYEFDKKMRRI
FT                   KRIKSKTYRRIRRQSKLKSKEAGEEKEGEDVHEDERQKRIPDILLKEIEEPEDEKTPIL
FT                   SFGGDEEEEDGQEKLVRLAFKDDMEENEKAFIKEKAETVEKEAPRIEETVLPGWGEWAG
FT                   PGLEIVKTKSNTIRNVVEGIKYSNRKDFNRSHVIINENISSVDKKFLAELPFGYTEGEY
FT                   NEKIDASISRERNTLRIFRKLVRTKTGYRNGEVIEPFHYNLE"
FT   gene            <97345..>97824
FT                   /locus_tag="Eint_110790"
FT   mRNA            <97345..>97824
FT                   /locus_tag="Eint_110790"
FT                   /product="hypothetical protein"
FT   CDS_pept        97345..97824
FT                   /codon_start=1
FT                   /gene_family="HOG000149730" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110790"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0920"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF4"
FT                   /protein_id="ADM12579.1"
FT                   /translation="MEYYDPDDILLNETRIQVVFKHKVQNFGFLGQRSRILPENKKVEV
FT                   PYFLVAFLLKNDHCKLAEGFPDKSLLEDISAKPGVIDLRSVCPYFFYLHSILLKEEVSL
FT                   PEFFYERIGDHSSLVLKKAFSEDDVWRLDVIERGLIVRSRRTFQRFHNFLILGHN"
FT   gene            <97888..>98739
FT                   /locus_tag="Eint_110800"
FT   mRNA            <97888..>98739
FT                   /locus_tag="Eint_110800"
FT                   /product="translation initiation factor 2 subunit alpha"
FT   CDS_pept        97888..98739
FT                   /codon_start=1
FT                   /gene_family="HOG000149227" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110800"
FT                   /product="translation initiation factor 2 subunit alpha"
FT                   /note="similar to ECU11_0930i"
FT                   /db_xref="GOA:E0SAF5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF5"
FT                   /protein_id="ADM12580.1"
FT                   /translation="MIKYECRLHSRKYPREGEIVMGRVVSIGGEGLTLNLLEYGDLEGL
FT                   VLLGELSKRRVKSIQHVTKIGNIEICNVLKVDEQKGYIDLSMSKVTESEKSECKETSAK
FT                   NKLAYHIMLKAAKKLGMEVSELYEKMGYDKEEEFGSLYYFFARVKDNGDIIEDDEVGLT
FT                   IKSLIREQFQASTYKVRADIDVVCSSRGGIISIKKVFDDALKLDPRLEFCLIKTPTYSV
FT                   TRVSSNKDKAYEVVREACDILISNIKKEGGTASVVSQPKLYGEKSRYNLLNFEENEISS
FT                   SE"
FT   gene            complement(<99037..>99366)
FT                   /locus_tag="Eint_110810"
FT   mRNA            complement(<99037..>99366)
FT                   /locus_tag="Eint_110810"
FT                   /product="ribosomal protein L7Ae-like protein"
FT   CDS_pept        complement(99037..99366)
FT                   /codon_start=1
FT                   /gene_family="HOG000149225" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110810"
FT                   /product="ribosomal protein L7Ae-like protein"
FT                   /note="similar to ECU11_0940"
FT                   /db_xref="GOA:E0SAF6"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF6"
FT                   /protein_id="ADM12581.1"
FT                   /translation="MIPIASPIASESTTEMIASLVRDQAERGVLSTGIKKCQKRILEGS
FT                   RGLLVLTADTTPMDLITHLPAVCEDRGIKYVFVRRKVSLPNGFTCVFLEMDGSDMLAKV
FT                   LETLA"
FT   gene            <99436..>100344
FT                   /locus_tag="Eint_110820"
FT   mRNA            <99436..>100344
FT                   /locus_tag="Eint_110820"
FT                   /product="hypothetical protein"
FT   CDS_pept        99436..100344
FT                   /codon_start=1
FT                   /gene_family="HOG000149729" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110820"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0950"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF7"
FT                   /protein_id="ADM12582.1"
FT                   /translation="MGGKNFMTSKEKDYVAECLKRNMRYFRSDIDYAVLFREGEEKIEV
FT                   KCDDGEPKRSVNLIFGKENKKSSRRPRPFCGVEVENIREPMRDMFLLEELIDLYTARRY
FT                   CKLSPEDLRENIEMFREKLLCKFDVFISIAKFVSFLGEYFPFAEEEEKKEVVVLLLRTF
FT                   HLVKDVPSFYNSIGSLAGCMPQVSEAELEEGFVSTFLFFPSGLILATLLLIQNEALCGV
FT                   FYEAIIKESGWSFTKSKHGWQFLSVMISIADEEKQKSIVRKARPYLSEVSKEPESDEAK
FT                   GARLFLEAIGIDMEDLRCWGE"
FT   gene            complement(<100398..>101387)
FT                   /locus_tag="Eint_110830"
FT   mRNA            complement(<100398..>101387)
FT                   /locus_tag="Eint_110830"
FT                   /product="cyclin-dependent protein kinase 9-like protein
FT                   kinase"
FT   CDS_pept        complement(100398..101387)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110830"
FT                   /product="cyclin-dependent protein kinase 9-like protein
FT                   kinase"
FT                   /note="similar to ECU11_0960"
FT                   /db_xref="GOA:E0SAF8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF8"
FT                   /protein_id="ADM12583.1"
FT                   /translation="MELPEEGEILAHKRFTVTEMSYEKIRVIGEGTFGQVILARKGRAR
FT                   YALKKVTKEKEGIPVTTIREIQVLRAMSHPSIIRLMEMVVEPGGDVYMVFPYFPYDLNR
FT                   FIRNNRLAPEEVKHIFHQIAKGVWYIHNKGIMHRDLKSANILLDHKLNAAIADFGMARY
FT                   VAKAGMHTPGTVTLWYRPPEILLGSYNYTYAVDIWSLGCILTEMYLGYMIFQGNTEISQ
FT                   LEMIIHACGSINENSYPGVQNLPGFRNFRLPQSPRRIEKIIESHDESAVQIISRMLCLD
FT                   PSNRITIDQIVKDEYLKDRSCKDASNAPLRNFNPKEDESSLCKRKNDD"
FT   gene            <101434..>101805
FT                   /locus_tag="Eint_110840"
FT   mRNA            <101434..>101805
FT                   /locus_tag="Eint_110840"
FT                   /product="Dcp1-like decapping protein"
FT   CDS_pept        101434..101805
FT                   /codon_start=1
FT                   /gene_family="HOG000149728" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110840"
FT                   /product="Dcp1-like decapping protein"
FT                   /note="similar to ECU11_0970"
FT                   /db_xref="InterPro:IPR010334"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAF9"
FT                   /protein_id="ADM12584.1"
FT                   /translation="MLGEKEGKILMREVRKTDQSLRDLLYVSNFVSVYYYTDGNWDKAG
FT                   IEGTFVMYSRECYPLVGIHVFNRKDLKDFSLYLSKELSFGIKGNLMTITEQEENRIHGL
FT                   WFHNDVHPKAILECLESSL"
FT   gene            <101876..>102511
FT                   /locus_tag="Eint_110850"
FT   mRNA            <101876..>102511
FT                   /locus_tag="Eint_110850"
FT                   /product="synaptobrevin-like protein"
FT   CDS_pept        101876..102511
FT                   /codon_start=1
FT                   /gene_family="HOG000149224" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110850"
FT                   /product="synaptobrevin-like protein"
FT                   /note="similar to ECU11_0980"
FT                   /db_xref="GOA:E0SAG0"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAG0"
FT                   /protein_id="ADM12585.1"
FT                   /translation="MAILYTQIIKLPDYRILSGEYSPQSNSLRPGNDIVKELRNTIKSI
FT                   PGSGTSSFYTFNSLDTRFVFYFKVHTGIVFAVISDRYTSSKLASEYMDLVVEGFAKIYV
FT                   DNPKTTYYTFDPTIKAMSDRFNRDSNYAQGMAVVEETKGLLAESLNMIIKRDENINNLK
FT                   GLASRMTVEAQMMQKNIQRMHLKSMLNDYWIYVVFAVLIILFVYYIAH"
FT   gene            <102579..>103073
FT                   /locus_tag="Eint_110860"
FT   mRNA            <102579..>103073
FT                   /locus_tag="Eint_110860"
FT                   /product="hypothetical protein"
FT   CDS_pept        102579..103073
FT                   /codon_start=1
FT                   /gene_family="HOG000155758" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110860"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0990"
FT                   /db_xref="GOA:E0SAG1"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAG1"
FT                   /protein_id="ADM12586.1"
FT                   /translation="MEIGSPRKEEQATAGENLNGESGAREREGQSMRKARGSDVPQVLE
FT                   SQSCAARECARDEIRKFVRVPVEVDTVGGKPLMFTMWASEEKPIHKKKHATEAYRDVFG
FT                   CESCEGVFDSFKKLELHRALHKGSSDVPNPLFCPVCKKTFDEKRKLMLHSRYHKINKDG
FT                   E"
FT   gene            <103129..>103407
FT                   /locus_tag="Eint_110870"
FT   mRNA            <103129..>103407
FT                   /locus_tag="Eint_110870"
FT                   /product="hypothetical protein"
FT   CDS_pept        103129..103407
FT                   /codon_start=1
FT                   /gene_family="HOG000149726" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110870"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1000"
FT                   /db_xref="GOA:E0SAG2"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAG2"
FT                   /protein_id="ADM12587.1"
FT                   /translation="MGNDFEEGVEDIVRELFFIEERMDPELPLIFQEKTKELEEEPEEI
FT                   CCICLEYIKGSQALLVCRHSFHLTCIYSWLDTKRVCPSCRMAIKWEE"
FT   gene            <103438..>103836
FT                   /locus_tag="Eint_110880"
FT   mRNA            <103438..>103836
FT                   /locus_tag="Eint_110880"
FT                   /product="hypothetical protein"
FT   CDS_pept        103438..103836
FT                   /codon_start=1
FT                   /gene_family="HOG000149725" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110880"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1010"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAG3"
FT                   /protein_id="ADM12588.1"
FT                   /translation="MPKNKYNILAEKPQDPKDSPANEENLSLAFESSLILSGTKYPEPR
FT                   TRIAFNFISTCEHGVVKLFFVTVTHAKSDQEYYGLDASDNCVIVSSDKLETGKRYEIYG
FT                   RLEGGTPKTLHCVEIREICYRRLCYEIF"
FT   gene            complement(<103882..>104970)
FT                   /locus_tag="Eint_110890"
FT   mRNA            complement(<103882..>104970)
FT                   /locus_tag="Eint_110890"
FT                   /product="poly(A)-binding protein-interacting protein"
FT   CDS_pept        complement(103882..104970)
FT                   /codon_start=1
FT                   /gene_family="HOG000149724" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110890"
FT                   /product="poly(A)-binding protein-interacting protein"
FT                   /note="similar to ECU11_1020"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="UniProtKB/TrEMBL:E0SAG4"
FT                   /protein_id="ADM12589.1"
FT                   /translation="MDNYTIAICFKNNPSRMIGTFLSNEDGMVKLENAFFEMNPGIVFP
FT                   TISISESDIITVKKTNEGVREKSEDKSIPLETTEKASKGKETSSWDSFKTDSQISRAVE
FT                   VTAPPPTPPNESATLERFSEEGSKDWNQFEANSKLFNIDNKFDESEYMEVLDKNSESYK
FT                   RKLSMAKKIEKEIMLSTTTDPHRLEERGLGMSEENEDAYSSVVGKEHKKDSGKCSAKGH
FT                   EEESFDDEKSKQSEDEGTRRKMVIEIEGLSTPKIKEECASKGESNKNEESSNSQEEKKD
FT                   SKPKKSVRYGWMHTKFDSSKNLLRMIKSKFKGILDTNGGEAKWGTGPNWEVAGRNIIKK
FT                   TQKGGRTPPTARRTVKKSPVSK"
FT   gene            <105050..>106327
FT                   /locus_tag="Eint_110900"
FT   mRNA            <105050..>106327
FT                   /locus_tag="Eint_110900"
FT                   /product="AAA ATPase proteasome regulatory subunit YTA6"
FT   CDS_pept        105050..106327
FT                   /codon_start=1
FT                   /gene_family="HOG000225146" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110900"
FT                   /product="AAA ATPase proteasome regulatory subunit YTA6"
FT                   /note="similar to ECU11_1030"
FT                   /db_xref="GOA:E0S9W8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W8"
FT                   /protein_id="ADM12590.1"
FT                   /translation="MDASFYSLQKALGKKGIPEFPSLLPHQLRDLETTCCLGDFYEKVI
FT                   CEVSRDNNLIPILSFVTGLPIEIDIKEVEKLLAEYKPVKGEFFRAGQHLHPLLPEKDGY
FT                   PDFVTGSGKKIAKKEQRDKNEVDGECNVESYIVDRIRNEILEKVMDIGWDDIIGLKDVK
FT                   KTINEIVLWPMQRPDLFTGLRGPPKGLLLFGPPGTGKTMIGKCIASQCKATFFSISASS
FT                   LTSKWVGEGEKMVRALFYLARSMQPSVVFIDEIDSLLSQRSDNENEGSRRIKTEFLVQF
FT                   DGASTSNSDRILVIGATNRPHEIDEAARRRLVKRIYVPLPEHLGRRQMIEHLIRDYRNI
FT                   LGPQEFDEVAGMTEGYSGSDIFNLCREASLEPLREIDDIKDFKNEDTRPISLEDFKKAT
FT                   RQIKKSVSERDLEIYSDWNSKFGSVS"
FT   gene            complement(<106322..>106747)
FT                   /locus_tag="Eint_110910"
FT   mRNA            complement(<106322..>106747)
FT                   /locus_tag="Eint_110910"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(106322..106747)
FT                   /codon_start=1
FT                   /gene_family="HOG000149723" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110910"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9W9"
FT                   /protein_id="ADM12591.1"
FT                   /translation="MEDFLKQISHGYVRFQYTPIEKSFDRIYSFLPYFDSTLVVHRKPG
FT                   TVPPFKLLRMCRGRVKIVVTEEPFQVIVDHLGNFNMFILLDFEFNDFEHEFLRQACIAN
FT                   RKSIFLFSGAQKDHTIEGQSYQTVKLDLDLFDSPVGL"
FT   gene            <106829..>108268
FT                   /locus_tag="Eint_110920"
FT   mRNA            <106829..>108268
FT                   /locus_tag="Eint_110920"
FT                   /product="dipeptide/tripeptide permease"
FT   CDS_pept        106829..108268
FT                   /codon_start=1
FT                   /gene_family="HOG000149223" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110920"
FT                   /product="dipeptide/tripeptide permease"
FT                   /note="similar to ECU11_1050"
FT                   /db_xref="GOA:E0S9X0"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X0"
FT                   /protein_id="ADM12592.1"
FT                   /translation="MNTTTMNRTTLFLIICNEFCERFCFYGLKSLLFSFAKTEYNFSIK
FT                   ASTMILHFFISMSYLFTLLGALLADRFLGRYNTILVLSPLYLTGTSILTYCSVVSGSPW
FT                   VLMASLAMVAVGTGGIKPCIATFGGDQFGPNEAEGLRKFFDIFYFVINIGSMVSMMLVP
FT                   AMSNVACLGKLSCYPLAFGMSSALLGASIFLFVAGEKLYVIKPARKEQFSNEFRFLVEN
FT                   LKSLFQKRPESCEEQTQESGKTAAEAVSASHSQDTKKRIWKILKILGPAMFFWTLSDQQ
FT                   SSSWVEQGQKMGIRQSIFGYGVDILPSQMQALNPIFILFFIPIFSGFVYPLLGWLGVFS
FT                   SREDKMGLGIVFGSLAFFYSGYLEHRIVQLVSSEEKLSILWQVPQYAIMTVGEIMLNVT
FT                   GMEYMYVEAPETMKSLALSMWLLAVAVGNLLIMALTFLDPISLLSSHRHDMWSFAMYGA
FT                   LGLVASSYMFKTSRSNRNSKG"
FT   gene            <108651..>109007
FT                   /locus_tag="Eint_110930"
FT   mRNA            <108651..>109007
FT                   /locus_tag="Eint_110930"
FT                   /product="hypothetical protein"
FT   CDS_pept        108651..109007
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110930"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1060"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X1"
FT                   /protein_id="ADM12593.1"
FT                   /translation="MKIQWIILSIVTFFFGVFHLPLITSNTEKFLKMDIMALMTATILA
FT                   LQVSEKVNFRLLCSSLYTPCIQTCLESSITERFGTMWKDLKQSLVGKTGCDSRLLQTIS
FT                   FKNKLRFTPIYRNF"
FT   gene            <109180..>109299
FT                   /locus_tag="Eint_110940"
FT   mRNA            <109180..>109299
FT                   /locus_tag="Eint_110940"
FT                   /product="hypothetical protein"
FT   CDS_pept        109180..109299
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110940"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X2"
FT                   /protein_id="ADM12594.1"
FT                   /translation="MFILYFSSLTPKSSPQVPINAIWEFSVMKLLWLIMLNCK"
FT   gene            <109547..>110407
FT                   /locus_tag="Eint_110950"
FT   mRNA            <109547..>110407
FT                   /locus_tag="Eint_110950"
FT                   /product="putative short chain dehydrogenase"
FT   CDS_pept        109547..110407
FT                   /codon_start=1
FT                   /gene_family="HOG000149722" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110950"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="similar to ECU11_1070"
FT                   /db_xref="GOA:E0S9X3"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X3"
FT                   /protein_id="ADM12595.1"
FT                   /translation="MFAISLIFVALAIAYFAVRLGTTHEIKNKKILVIGGSSGLGLAFA
FT                   RVLKKEGNNVTITSRSMERLVPLGKKWGFETKVLDINVVGGQESTDFDYIFCCPGVSYP
FT                   AYFVDQPLETFQDTMSTNYLGTVAMLKHYAEVNKKPFKFVMIGSTLVLLTFPGFSSYSP
FT                   TKTALLSLFCTVRDEMERQGVELYLYNTASILTPGFERENKTKPSYTKAIEEMVPPSSA
FT                   EERAVAFLIGMKKRRMVASDVFTYLCQIRFECECLIDYILFPVSVAVVFIVRAYVKWRF
FT                   MAEKM"
FT   gene            complement(<110445..>111125)
FT                   /locus_tag="Eint_110960"
FT   mRNA            complement(<110445..>111125)
FT                   /locus_tag="Eint_110960"
FT                   /product="superoxide dismutase"
FT   CDS_pept        complement(110445..111125)
FT                   /codon_start=1
FT                   /gene_family="HOG000013583" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110960"
FT                   /product="superoxide dismutase"
FT                   /note="similar to ECU11_1080"
FT                   /db_xref="GOA:E0S9X4"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X4"
FT                   /protein_id="ADM12596.1"
FT                   /translation="MEFKLPELDYPYDALEPFIDAETMKIHHTKHHQGYINNLEKTLQS
FT                   NNIKGRSLNYCVTKSRGIVGVRSSVRRDISNFSGGHYNHSLFWKMMCPPGTSDPISPTL
FT                   QEYINKSFGSYEKMVEEFNSAAVSLFGSGWVWICYRQSEGILVIRKTHNQDSICMKTSN
FT                   TIPILGLDVWEHAYYLKYKSARAEYVEKWWNVVNWGTVNKLFEEIALGNKKLCVMSDGS
FT                   IKFN"
FT   gene            <111203..>111556
FT                   /locus_tag="Eint_110970"
FT   mRNA            <111203..>111556
FT                   /locus_tag="Eint_110970"
FT                   /product="hypothetical protein"
FT   CDS_pept        111203..111556
FT                   /codon_start=1
FT                   /gene_family="HOG000149721" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110970"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1090"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X5"
FT                   /protein_id="ADM12597.1"
FT                   /translation="MRRNSMYIQIPRDPRTDRTSFIVSMPEQMKGKIESQKWEEIVSGL
FT                   NNIFYELESPSLMSFIKTVFIIPFLVGSPKNVFVRVEEYLSDANKLLGKHGLRIVHPGN
FT                   HQYVELEVEIYQD"
FT   gene            <111639..>114689
FT                   /locus_tag="Eint_110980"
FT   mRNA            <111639..>114689
FT                   /locus_tag="Eint_110980"
FT                   /product="isoleucyl-tRNA synthetase"
FT   CDS_pept        111639..114689
FT                   /codon_start=1
FT                   /gene_family="HOG000246403" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110980"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="similar to ECU11_1100"
FT                   /db_xref="GOA:E0S9X6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X6"
FT                   /protein_id="ADM12598.1"
FT                   /translation="MYKKNANFVECEEEVLEYWKSRRCFERACEMSKGRKKFTFYDGPP
FT                   FATGLPHYGHILSGTIKDTVTRFFYQQGYDVDRRFGWDCHGLPVEYEIDKKLGISSRDE
FT                   VLKMGIDKYNKECRGIVMKYSSEWEKVVERLGRWISFENGYKTMDKTFMESVWNIFKEL
FT                   FNRGLVYRGFRVMPFSTACSTPLSNFESNQNYKDVSDPSVLIAFPLLKPFEGYKLSLVA
FT                   WTTTPWTLPSNCALVVNPEFSYGIFEEKQKFYLMHVNRVEEYFKDAKILKRISGSELEG
FT                   LEYEQPFPYFEEYRKKGFFRVYGSGFVTDTDGTGIVHSAPGFGESDYNVFVEKGLIREN
FT                   DLVPCPVDENGRYTSEVKDYAGKYVKDCDKAILLDIKDKVLLNQRIVHKYPFCWRSDTP
FT                   LLYKLVPNWFVRVKDHVDSLLRNNEEINWVPPDIKYKRFHNWLENARDWSVSRNRFWGT
FT                   PIPLWTTLDYKDVICVGSVEELERLSGRKIDDIHREFIDDIVIHKDGKEYRRVEEVLDC
FT                   WFESGSMPYAQDHWPFKERLEAGLKNLSVEEGKEGKLVKENFPADFIGEGVDQTRGWFY
FT                   TLHVVSSLLFGQPAFLNVIVNGIVLAEDGRKMSKRLKNYPDPSVIFNTYGADSLRMYLI
FT                   SSPVVEAENLKFNENGVKEVLKTLIIPWYNSLGFYLENRHLEPRGERLLMDDWIRTTFD
FT                   NFTVSLTDKMKRYELSSVLSLALRFVDDLSNWYIRMHRKEIRAGHHTVLGDTLRKFSIV
FT                   MAPFTPFFSEYSYQSINPGESVHFQQYPVCKSGIHPFETAKSIITAVRRLREMNSISLK
FT                   TPLKSATLISSTELYQKIRDYMDLIKSECNVLELLHKEEGKSMFDITVKPNFQNLKKNK
FT                   DTMKRKMELIRKLTSDEAYVLLSSSLNMEGLEILQDDVLIVKKIKHAEGISQEFGDFSI
FT                   AIDNTLNEDIVEMKVAREFHSYVQKLRKSMGLSISDDVVVDVECSDLKSIVGKHFDISF
FT                   GNLGVLCGKGEYEFDGTLYSVSLYKKA"
FT   gene            complement(<114729..>115997)
FT                   /locus_tag="Eint_110990"
FT   mRNA            complement(<114729..>115997)
FT                   /locus_tag="Eint_110990"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(114729..115997)
FT                   /codon_start=1
FT                   /gene_family="HOG000149720" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_110990"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1110"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X7"
FT                   /protein_id="ADM12599.1"
FT                   /translation="MRLFAEDNGKKPFPPCENTRDVSLGSPDTSQQLGKYIVNGLEMLS
FT                   LSDIKVVVDEKKTSLDSVSSESPDTLSGFGSLSGESNEDCVYLPSIYKTYVKVSEKIDR
FT                   LIKGEYFSKEFVKCILREVCRGNLEGARSIICQELQERDPFFSPDTYLVESGGWNSVGE
FT                   LSRRTHELMEDLKEIEEISHKLHRIFFEMRSRSFEAELGYAKATGEFVKQLDKCSREME
FT                   GMRKINGLVSKDITEAAEDFGVDVDIRDDDLHGVQKALRSVFKEMRRRIKNMESSGLEV
FT                   QQKEKEHEKVLRDYLELKKGMDGIKAENSNFSEAVAKLSSKNSKIRRDYDTLRETLKRT
FT                   LESSKRKSITIDRQKKIIDILQSRVGDGYVLPVNELQSKIDEIKRRADAEPDSDKKRRL
FT                   EDEITDYERRMSDFISLMNRVSK"
FT   gene            <116065..>118098
FT                   /locus_tag="Eint_111000"
FT   mRNA            <116065..>118098
FT                   /locus_tag="Eint_111000"
FT                   /product="translation elongation factor 2"
FT   CDS_pept        116065..118098
FT                   /codon_start=1
FT                   /gene_family="HOG000149222" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111000"
FT                   /product="translation elongation factor 2"
FT                   /note="similar to ECU11_1120"
FT                   /db_xref="GOA:E0S9X8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X8"
FT                   /protein_id="ADM12600.1"
FT                   /translation="MESRDTTITSIVAHIDHGKTSLMDSLVASQGRISKALAGSIRFLD
FT                   TREDEQARGITLKLSAISLDYGGHRYVFIDTPGHVDFESLIQSSSILSDNFLILVDVNE
FT                   GITPRTYSLVKYAKGKRCVLAINKIDKISSPQELLQKTQSVVTSINGLSGREVFGWDAN
FT                   NIILCCATLCYGINKKMFQKVVGRDGSLKNAIDLLFHVYNRIDQKDVARICERFKVAVR
FT                   SRKNILLAMLPLSECVFNSIGVDTEDCMKQFYGSDLIKLNPIPSDKKPSLMGVTVYGVL
FT                   KTPREYSKSSVLFVTRLFYGTLRVGDTVYSADGENISECAVESLYRFGINELIERDEVS
FT                   GPDLICIGGSFRKNSVITDVPAYRMDIQSKITPFYKFKIVLNNIDRLDELKEVFRVMSC
FT                   TEQFLKVKLNKYKEIEVSCTGKVQSEKIITDLGDSGFEFSVGDLEEKFCEYSTKSSSGV
FT                   FTLEDLSLRVWISQVCGVEESAVHFRRWEDKNGNRFGLVSTLCLEMATNVLEMFVSSGA
FT                   LIRENIYSTRFVLDIQGNADAIEPDLLYSFLKNSLVSVYLSSSPSIAPTFYECTISIQE
FT                   MFIGETYKSLPKDSYVVIQESYEDKTGFYVLTVLIPQFLYSNFLEEIRIRTKGTAYLLV
FT                   KDVGYKFGLDFSKQIEGIRKKKGLFVEEKIVERPSQQRTYKK"
FT   gene            complement(<118135..>118662)
FT                   /locus_tag="Eint_111010"
FT   mRNA            complement(<118135..>118662)
FT                   /locus_tag="Eint_111010"
FT                   /product="RING-finger-containing E3 ubiquitin ligase"
FT   CDS_pept        complement(118135..118662)
FT                   /codon_start=1
FT                   /gene_family="HOG000149719" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111010"
FT                   /product="RING-finger-containing E3 ubiquitin ligase"
FT                   /note="similar to ECU11_1130"
FT                   /db_xref="GOA:E0S9X9"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9X9"
FT                   /protein_id="ADM12601.1"
FT                   /translation="MRKGNDYPMKTREKSEEWGDKAPRSTYIEDNCREKERRRVGREYA
FT                   CNICYSRPEGPVLTPCGHLFCWGCLYIWSQSIRGCKFCPSCRSRMGIEEVISVLAVDSK
FT                   KESRGPPPRPANNRKLVKVITPGVKINGTRFGNCLLQEEETNVFSYRTAIGLFTLMCLL
FT                   ISITLRSYGPDC"
FT   gene            <118661..>119746
FT                   /locus_tag="Eint_111020"
FT   mRNA            <118661..>119746
FT                   /locus_tag="Eint_111020"
FT                   /product="hypothetical protein"
FT   CDS_pept        118661..119746
FT                   /codon_start=1
FT                   /gene_family="HOG000149718" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111020"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1140"
FT                   /db_xref="GOA:E0S9Y0"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y0"
FT                   /protein_id="ADM12602.1"
FT                   /translation="MNLLDLSVKLVEEVNLFLRQGRHSLDVLEMEKLVNKINEVQLLVK
FT                   DSERNFKQILKEIEGEHARSDSVVIVTKNKKLVCVLGEEIVKPRIESIDAEDSKCSHTP
FT                   FFYEFKPFGSTVYVETLDQLLDVDKRITQAAIEVFDHTYRSYRGFSCLISVGDTEGCIY
FT                   IIDAIRFRAAIPRLALLKCGVPKIVHCEQCVQRLLQDFKHIGCFRNYEISSDMVFIDWR
FT                   IRPVPKFLLEVLCKGVQKIREMLERGVETRTYCSKEIDEVEDIAVRYGIKSNNDNDILK
FT                   ALLKLRRFLAKNNDESVHYVMTDDQVVRLLRVKPDTQDKFLGEIGRLSPLARQHAMDFL
FT                   LVFNGKKGSFQLQDLLPPSQK"
FT   gene            <119831..>120277
FT                   /locus_tag="Eint_111030"
FT   mRNA            <119831..>120277
FT                   /locus_tag="Eint_111030"
FT                   /product="Orm1-like membrane protein"
FT   CDS_pept        119831..120277
FT                   /codon_start=1
FT                   /gene_family="HOG000149717" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111030"
FT                   /product="Orm1-like membrane protein"
FT                   /note="similar to ECU11_1150"
FT                   /db_xref="GOA:E0S9Y1"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y1"
FT                   /protein_id="ADM12603.1"
FT                   /translation="MGSKNKGRKVDVSQNVAWTLQRGSWIIHVLVILLLKMTLSVVFND
FT                   SIGWQLSLIIYNISTFVFFHMIPGDPFNDRYSLYTFWEQISEQLEGTPDLIFIALFPLI
FT                   AFTAVNFIIRWNIFLFWICVASLFIVTIPKFGFMHLRRILIFKE"
FT   gene            complement(<120309..>121736)
FT                   /locus_tag="Eint_111040"
FT   mRNA            complement(<120309..>121736)
FT                   /locus_tag="Eint_111040"
FT                   /product="putative nuclear scaffolding protein"
FT   CDS_pept        complement(120309..121736)
FT                   /codon_start=1
FT                   /gene_family="HOG000149221" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111040"
FT                   /product="putative nuclear scaffolding protein"
FT                   /note="similar to ECU11_1160"
FT                   /db_xref="GOA:E0S9Y2"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y2"
FT                   /protein_id="ADM12604.1"
FT                   /translation="MDTKLIGKICKSIRYRDYETAIFLASCLLHDRPEYRTLMSIVLYL
FT                   NGEYSRALFHLHKLNTCTSKYYESLCYKKRKDYKKAIKSLELILEGKVERDPDVDARIQ
FT                   EMFVDPDDDEFLESLLGDLYTLFGCREEGIGHYLRSFGKSFLFSPMENLLLENKIPQKR
FT                   DKENIQQAGKGGIEEEYVWDSIEFHESLANSLVKKYLEYVPGIGSYFISNAARRYFNLG
FT                   MNDKSKACFELVRRKDPMFLYSMDYYSTILWHSKDVYELGMLCKNLIKHAPDSPITWKA
FT                   LGNFYSHQGDYQKSILCFKRSLRIEEDSYTYTLLGYESIQRNEYDIAMKYFNLSLKMLG
FT                   DNYRAMFGCGLVYTKTEKMENAEFFLKKAVETNPGNLQIKVHAMKFYTRKGLTDQSIRL
FT                   FKEAFGMKYTDIHKIVECILSRKGSFSSVEEFLILEFVEILVLQNLSKLAADVLGCVEY
FT                   RGESYSKKKELLMDKVE"
FT   gene            complement(<121805..>123148)
FT                   /locus_tag="Eint_111050"
FT   mRNA            complement(<121805..>123148)
FT                   /locus_tag="Eint_111050"
FT                   /product="hypothetical WD40 domain-containing protein"
FT   CDS_pept        complement(121805..123148)
FT                   /codon_start=1
FT                   /gene_family="HOG000149715" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111050"
FT                   /product="hypothetical WD40 domain-containing protein"
FT                   /note="similar to ECU11_1170"
FT                   /db_xref="GOA:E0S9Y3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y3"
FT                   /protein_id="ADM12605.1"
FT                   /translation="MVYFRSNNFGIKDSSRENFDTIYEQKEGVFHLCSGKDGVFVVNKN
FT                   YVAVIRKEEGRKKKIVKFHRDVSAIDVYEELTVCGDESGCVKVVGKMRSIVRQYHEHEA
FT                   RVNEVKLNGTMIISCSDDMKIKIFELSKEESVATILDNTDYVKSIAVGDGVVFSGSYDG
FT                   FINGYCLTTFKKVFGYNTHRRVSRICMLGSGRVAFLSENEVCAIDVQNGGVEVGRAFHI
FT                   KEATSMVFYEGRLYTASVDGNVRVFTRDLKMISKVGVRGGILSLSIFNDVLYLGIEDGG
FT                   VLELARNKTEKDSPQLKDREDGIHDEIKIEIVRNRQTKLTYLEKKLNAFEYKKSMMHAV
FT                   RKRDIQEVFSVMSYIYERREFVHALQDLNRRELESVLDVMIEFFTVKELVPVFSEFIGF
FT                   ILFLYERDIKDDGMLCKKIEILGSVIDDELCFQEQNLRSIAFLECFLR"
FT   gene            complement(<123400..>125943)
FT                   /locus_tag="Eint_111060"
FT   mRNA            complement(<123400..>125943)
FT                   /locus_tag="Eint_111060"
FT                   /product="phospholipase D"
FT   CDS_pept        complement(123400..125943)
FT                   /codon_start=1
FT                   /gene_family="HOG000149220" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111060"
FT                   /product="phospholipase D"
FT                   /note="similar to ECU11_1180"
FT                   /db_xref="GOA:E0S9Y4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y4"
FT                   /protein_id="ADM12606.1"
FT                   /translation="MEIPDKTSEDGIPRRSMESEFEDGNFVSKSACVYGGLLESVFMIP
FT                   FRRLGFQSSAPVFPVLLDQIKVNVDSQSSSATKYTVNLSYGRQKWKINVGIVQLFSLNA
FT                   YLHYRGVTDLRRDKPNICGEGQFRGVEEFLRTVLHRSRILDIGKVYDFFRISRYSFNGT
FT                   KMFEDKFHVSIMDLNESRCRTSCYGVLEISGKIYVVSKRSHLVFVDYRNGYRDMNVLFY
FT                   RRDLDVKYKADVFYSKITMVRDGRKYVIKSFRHDSVLQLFNEIQKGLEERRGSERLFSF
FT                   SPVRRGSMINFYVDGKSYFWNLYETLHLARREVFIAGWWIYPTLYLRREYVGGKLDEKY
FT                   RIDYVLKELAEEGIRIRILVYGEVFGALKMNSNHTCEFLSNLHKRIEVLRHPDSIGHAP
FT                   IYWTHHEKLVVIDQRIAYVGGIDLAPGRYDTQEHSLFRTEWACGGLGTDRRKEEVFSKI
FT                   LELPWHDVQCKVVGGSAFDISQHFIERWNFVISKYDGEGGSARLLIPNEEFIEIEQTLG
FT                   DLEVNRAFPKTQVLRSVGKWSLGYDEDSISRGYSEVIRNSKRFIYMENQFFITKCDLAP
FT                   GYPENTIGRALVERIIQADRAKEEFKVYVVIPLCPIFDGGFMVGLTPAAEIVRIQSESI
FT                   SRGDTCLHQVLKRNGVDSGRYIVFMCLRKIHFDGKRIGQEQIYVHSKMIIADGTSAIVG
FT                   SANLNDRSMLGNRDTEVALLVRDEREVVCKLLKRLLKEHLGAWEEDQNRYGPKDFLESW
FT                   LLGNELDLASDDVFTRIVARARGNTEMFEKMFGNIKSYAGGHLNLYSVESDFIWEVLNG
FT                   IKGHLVLFTDNFPVDREVGRSIFGIQALIPSVIYY"
FT   gene            <125990..>126859
FT                   /locus_tag="Eint_111070"
FT   mRNA            <125990..>126859
FT                   /locus_tag="Eint_111070"
FT                   /product="Nbp35-like nucleotide binding protein"
FT   CDS_pept        125990..126859
FT                   /codon_start=1
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111070"
FT                   /product="Nbp35-like nucleotide binding protein"
FT                   /note="similar to ECU11_1190"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y5"
FT                   /protein_id="ADM12607.1"
FT                   /translation="MGESCPGVSSKDAGKAKECKGCPNASYCSQPAQPDPDIKIIQENL
FT                   RGVKTIVAIMSGKGGVGKSTVVRNIAESVSSRGITTCILDLDLSGPSIPRLTGTDGMSM
FT                   CETSGIIQPIEVNKFLKVVSVGYLQDCGEGIMFSSSFKTGIIKKFLAQCNYEGVDVLLL
FT                   DTPPNVTDEHLGMVNFIKPKFAIVVTTPQKFSLQDVIRQIDFCRKAKISVLGVIENMKR
FT                   FVCPRCSHQKNVFVNTEVESYSKSNGIPYLGSIDLRQDIAKASDIGRPTREEIFDRMAD
FT                   AVLSIHES"
FT   gene            complement(<126906..>128642)
FT                   /locus_tag="Eint_111080"
FT   mRNA            complement(<126906..>128642)
FT                   /locus_tag="Eint_111080"
FT                   /product="ATM1 mitochondrial ABC transporter"
FT   CDS_pept        complement(126906..128642)
FT                   /codon_start=1
FT                   /gene_family="HOG000149219" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111080"
FT                   /product="ATM1 mitochondrial ABC transporter"
FT                   /note="similar to ECU11_1200"
FT                   /db_xref="GOA:E0S9Y6"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y6"
FT                   /protein_id="ADM12608.1"
FT                   /translation="MGGKKKVSELQTLSIIVRKYILGIPQARIIVFPVLLSIFAGKYFE
FT                   VKVASCISYISEGLDLEEVPRSRIIMFLVISLTGIIFTELQGFVFVSAIQYVYRYTLRT
FT                   TFEYFIRMETEMFESYGSGTIQSIITRKSKAISDFVEVSIQNLFPVVASLTFVGLEVYL
FT                   KLGVLASFIVALAVAAYGFMTISIALRRNRIRGALNSAENAASNIVYDTLSNHESVMSF
FT                   NNYCIEVRRYDGKLMEIERFGTNLFRGLYILNMLQKLIFAFLNSSMIALGVYGLLSSKM
FT                   DGRVLIFYVTTSRILLINLNNLGYTYCRFTEAMLNAREVLSEDYDLKTNENISMVRFGK
FT                   NIVFKNVRLYYGDKKILNDVNLTIKKGDKVAIVGSNGSGKSTILKTFLRFNRYQGSICI
FT                   DGISIDAIENGSFRRIIGYVPQNSSLFNETVMYNIKYGNPNVSDYTVVELAKRFNIHDS
FT                   IMRLEKGYFTNVGEAGRHISGGERQKIIILRALLRRPEILAMDEPTSNLDKEAEIDIIK
FT                   NIIDFESSVTVMAIVHNLDLLPLFNKVCFVDRGSVRMIDQTGTSSESAAEGLRSYEIPG
FT                   VK"
FT   gene            complement(<129034..>129921)
FT                   /locus_tag="Eint_111090"
FT   mRNA            complement(<129034..>129921)
FT                   /locus_tag="Eint_111090"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(129034..129921)
FT                   /codon_start=1
FT                   /gene_family="HOG000149714" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111090"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1210"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y7"
FT                   /protein_id="ADM12609.1"
FT                   /translation="MFLMTSSPLLLLIGLVREGFALASEYNFGGFEADPACTKDDKIYL
FT                   VSLYAHFDRGTIDAIFSAFSDCKDEREAVEHYLKSRVVGPYNEFLSKYKVKIGFDAKDY
FT                   DVNELVPTKRFDSSCELVEPVSTRTTTVHEHLLSTYKDKKIGIHLFLWSCPSHNENIMS
FT                   KIVIGEPKECARSIGVLWRGTEDTIDFIKSGISEAISGAKDLFLNQEYPSPRDEDKLSY
FT                   VCQYVDTCIASKPSVNGAIVFGIDDTSDEDISTHIDVDNHPREVYIPPEKGGKNQRVIY
FT                   INEPSDSGDDDCKY"
FT   gene            complement(<130008..>130772)
FT                   /locus_tag="Eint_111100"
FT   mRNA            complement(<130008..>130772)
FT                   /locus_tag="Eint_111100"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(130008..130772)
FT                   /codon_start=1
FT                   /gene_family="HOG000149713" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1220"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y8"
FT                   /protein_id="ADM12610.1"
FT                   /translation="MEHRCIICTAAPNIRISNLDYCDTCFEKQFLHKVFRHFRKLPRGS
FT                   KILLYLDGTLQSLVIAHALSRLKNRSIHKFSVASSFIQELKNYLGDMGFSSWIDLRPES
FT                   DKYVSSSTRLDPLPRQTIEIAQSLGFDIVVFQADAEIESLIALRSICNGLGVSESIESY
FT                   VSGIRGIRVENALNRIRSKEVGYYFYLNRGEIPTTWTKLSMSTMEAALLMFIEKIEDRN
FT                   NLAVFNILNTVKKIQEGKEGIDTSDGGGESGV"
FT   gene            <130771..>131511
FT                   /locus_tag="Eint_111110"
FT   mRNA            <130771..>131511
FT                   /locus_tag="Eint_111110"
FT                   /product="chromosome segregation protein Spc25-like
FT                   protein"
FT   CDS_pept        130771..131511
FT                   /codon_start=1
FT                   /gene_family="HOG000149712" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111110"
FT                   /product="chromosome segregation protein Spc25-like
FT                   protein"
FT                   /note="similar to ECU11_1230"
FT                   /db_xref="InterPro:IPR013255"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Y9"
FT                   /protein_id="ADM12611.1"
FT                   /translation="MDKFFDRRSHLMGTEHTPANVEKIKGVMDGIIGDLEGYLEMYKSH
FT                   ARFLRGRISRDKQEGEVLLQTVTSTLNEMKERNERLVDERNGLRLRIEQDVRDLRASED
FT                   EKHELVNQIRELEMGNLNLKEVFREKKSIENAFTKKMELVSERSRQREVLMEAKAEWFR
FT                   RYLGMDIIPVRENVIKIVFSRICPEDSVECFVTLDLSLEGPVVDLFPRMYDLEKANNLF
FT                   REHSNFHDFLRTVRREFRREYSGV"
FT   gene            <131585..>132421
FT                   /locus_tag="Eint_111120"
FT   mRNA            <131585..>132421
FT                   /locus_tag="Eint_111120"
FT                   /product="hypothetical protein"
FT   CDS_pept        131585..132421
FT                   /codon_start=1
FT                   /gene_family="HOG000149711" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111120"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1240"
FT                   /db_xref="GOA:E0S9Z0"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z0"
FT                   /protein_id="ADM12612.1"
FT                   /translation="MKSYNLVYKPEHGEKRFLFTNMDVKELSPPVMISRERPLREEVVF
FT                   STKKKSEQVEYEDEEYKKLKEKEGCLLILEDGESRIYSGKMQDLGASNSCYFVFINTGT
FT                   YLKVVPVRKWYRFSQKSQLDIIQEYEGEGIGEENGDGDGDGTSTEEREEIDFDDDFDDD
FT                   DGEDANVFIVREKRLNSAGRRMRNIMENYEEKERSESSEEKDTKGVEKVDKVLTKDEIR
FT                   GMFKGGRIALRDLLRGVKVRFGLNDEEKELVKEFIRESCTFETDEGSKEKYLVLRK"
FT   gene            <132468..>132986
FT                   /locus_tag="Eint_111130"
FT   mRNA            <132468..>132986
FT                   /locus_tag="Eint_111130"
FT                   /product="hypothetical protein"
FT   CDS_pept        132468..132986
FT                   /codon_start=1
FT                   /gene_family="HOG000149710" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1250"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z1"
FT                   /protein_id="ADM12613.1"
FT                   /translation="MRRILEDRLMRYLREVGYEVVEKRALEVYMGSLETYMLEHLKAVV
FT                   SVSRHGLKSHSTLLDFLRFIEGKRFEFPFFENVVYEEEVKEEEKEFASPLASSIEKYIH
FT                   IYDFMPSFPPIHAFRQTIVKAGNKGSKSMNVKNRLEQSLRTEGNLLKLIKASGSLPPFV
FT                   NFLYKNEWS"
FT   gene            133089..133160
FT                   /locus_tag="Eint_111140"
FT   tRNA            133089..133160
FT                   /locus_tag="Eint_111140"
FT                   /product="tRNA-Gly"
FT                   /note="tRNA Type: Gly, Anti Codon: CCC, Cove Score: 58.37;
FT                   similar to ECU11_1255"
FT   gene            <133235..>135142
FT                   /locus_tag="Eint_111150"
FT   mRNA            <133235..>135142
FT                   /locus_tag="Eint_111150"
FT                   /product="DNA mismatch repair protein MutL"
FT   CDS_pept        133235..135142
FT                   /codon_start=1
FT                   /gene_family="HOG000149218" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111150"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="similar to ECU11_1260"
FT                   /db_xref="GOA:E0S9Z2"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR015434"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z2"
FT                   /protein_id="ADM12614.1"
FT                   /translation="MIKRLPEDIGRRIKAQRSIPNTYIVVKELVENSIDSECTWIRIQV
FT                   DDSIVVEDNGCGISDLRDVGVEGSTSKESMAYYVLGCVDRVEKPSYGFRGQALSSLSEV
FT                   CDLEIISRSEHPFGLKKDFSTGIVSRCAREKGTTVRVRNLFKNCPLRRSASESRLKKDL
FT                   GRICALIESYRCTNKINFTLFHKRKVLLSCGGYETPREYFESNYPSFVGKYMELCNGQV
FT                   EFFMLPASVREPKQLMFLERRPISNKRISAAIKNEFNLYSEGIPTFVLVIKGYGDVNVS
FT                   TDKSEVIFSDEGGILSLLKSEIGRFFSSEVHMHSRSIPKTLGSYSPARNETEDNSGEGF
FT                   MGSNFSGTAVHHPAVRLSRVAPSLGKRERKQNEMTEENEERSKDSSSVEEPSSGIGSLD
FT                   NTEVKPSSSNLSEELEPPLEEKQQEEIYENEGHLATGAYSFFKYDELVHPKISFSKSDF
FT                   NRLEIIGQFNNGFIIAKLEKNEKTYLIAVDQHAADEIRNFENIKKTFYLKKQSVIVPVK
FT                   LDLTPIEEMIVNENSEVFEKNGFVVKNGMLETIPVYRNQVFGIKEFRELLEDVKNEEYE
FT                   FKKIRSIIASKACRTSVMIGDALSAADMKRIVRSLGVLDRPWKCPHGRPTFMILNEAEI
FT                   "
FT   gene            complement(<134990..>136420)
FT                   /locus_tag="Eint_111160"
FT   mRNA            complement(<134990..>136420)
FT                   /locus_tag="Eint_111160"
FT                   /product="DNA helicase TIP49 TBP-interacting protein"
FT   CDS_pept        complement(134990..136270)
FT                   /codon_start=1
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111160"
FT                   /product="DNA helicase TIP49 TBP-interacting protein"
FT                   /note="similar to ECU11_1270"
FT                   /db_xref="GOA:E0S9Z3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z3"
FT                   /protein_id="ADM12615.1"
FT                   /translation="MVESNKGGKIVLIKGDRGSGKTALAIGLSKSLGGVHFNSISGTEI
FT                   YSLEMSKSEAITQALRKSVGLRIKESVRTIEGEVVSLSGRRIVLKTVDMESSFDIGEKM
FT                   RNELDKEKVSAGDVIRIIKERGRVYKIGTSMVKKNEMVGMDARFVPCPEGELIKIREEI
FT                   QEISLHDIDVINNKAEGYLALFSGETGEIRTETRDEVNKKVWNWINEGKAEVVRGVLFI
FT                   DEVHMLDIESFAFLNKAIEEDFCPVILVSTNKKECVIKGTDETSPYGMPKDFIDRALII
FT                   SMEKYNREDLEAIIRHRILEEDVLIDGSAVDALVSISEESGLRYSMNLLTISSLRASKR
FT                   GGKVVLEDIKRVSELFLMRPAGSKASWLNKSYVLHWLYLCLIQYHERRPSVRTLPRPVQ
FT                   DAQAPYYPLHVRCRKSVAYHYACSTCL"
FT   gene            complement(<136483..>138309)
FT                   /locus_tag="Eint_111170"
FT   mRNA            complement(<136483..>138309)
FT                   /locus_tag="Eint_111170"
FT                   /product="vacuolar ATP synthase catalytic subunit A"
FT   CDS_pept        complement(136483..138309)
FT                   /codon_start=1
FT                   /gene_family="HOG000161057" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111170"
FT                   /product="vacuolar ATP synthase catalytic subunit A"
FT                   /note="similar to ECU11_1280i"
FT                   /db_xref="GOA:E0S9Z4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005725"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z4"
FT                   /protein_id="ADM12616.1"
FT                   /translation="MMNVVQQTFAKLSIEEPVKGMEGKVYSVSGPVVVGCDMVGCAMYE
FT                   LVKVGNEGLAGEIIKIDKDRATIQVYEDTSGLCVGDVIVRTGRPLCAELGPGLFESIYD
FT                   GIQRPLKEIQERSEGIFIPKGVNIPSLDREREYEFVPEVSVGDYVVGGDIFGKVYENSL
FT                   IETKILVPPKESGKVVFIAARGNYTLKDVVMELETSKGRVEMFMYHTWPVRVPRPIEEK
FT                   RNATHPLFTGQRILDSLFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDAIVYVGCGE
FT                   RGNEMSEVLMEFPKLTVGGKEDSIMKRTVLVANTSNMPVAAREASIYTGITISEYLRDQ
FT                   GMNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGAKLAFFYERGGSVVCLGSPK
FT                   RTGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWNLSYSKYF
FT                   SNLEPYYNKVDPDFIVNRTKCREILQLDDDLSEIVQLVGKNALSETEKLILDISKLIKE
FT                   DFLQQNGYSKYDNYCPFTKTRMMLRNIILYFDNCKNAIMNYRFSWSTVRKETEDVFYGL
FT                   MKMKFVIPGKEMESKLDKLKREIDEVFQRMLG"
FT   gene            complement(<138381..>139343)
FT                   /locus_tag="Eint_111180"
FT   mRNA            complement(<138381..>139343)
FT                   /locus_tag="Eint_111180"
FT                   /product="cyclin-dependent protein kinase"
FT   CDS_pept        complement(138381..139343)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111180"
FT                   /product="cyclin-dependent protein kinase"
FT                   /note="similar to ECU11_1290"
FT                   /db_xref="GOA:E0S9Z5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z5"
FT                   /protein_id="ADM12617.1"
FT                   /translation="MLLKGGRKCDSIEKYEKLCRISSGSFGNVYRVRRKTDKKEFALKR
FT                   MNPSMCHDTNGFSILYMREVMILKHARNKNVMGIEEVVEGCEINDFFIVMECCDIDLKS
FT                   IVLKTGGIGMEVAKFFTYQILQGLEFLHGIGVVHRDLKPSNILLMRSGDLKIADFGLAR
FT                   AVGSTMTNLVVTLWYRAIEVLLGSETYNESIDMWSVGCIVGEMLKGGPILPGEGEIDQL
FT                   DRIFKLLGYPADEDFAGLCLPHLKNIRRPGSFEASFGQDFGCYGQEVVDFVGNLLSFDP
FT                   RKRHSASQSLSSLFVANGRDCPRELIKDMMDLCIRTPNT"
FT   gene            complement(<139427..>140530)
FT                   /locus_tag="Eint_111190"
FT   mRNA            complement(<139427..>140530)
FT                   /locus_tag="Eint_111190"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(139427..140530)
FT                   /codon_start=1
FT                   /gene_family="HOG000149709" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111190"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1300"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z6"
FT                   /protein_id="ADM12618.1"
FT                   /translation="MDVLKQKIDMVNKKLDRVIEIVGELKSSNRSSLEKDEFNKSESTY
FT                   HVPKYSYRYSERTPLSSKSLFNKPYYLGEKTQIGDISDVELPEKSLGVSSVINSQGSKY
FT                   SGDLDLHGKATGVEIHGISISGKPSSSAEIERKPESSSTPSSRGFGVSGLPASSSSSNT
FT                   VENVVSSGESLEKLIGEFLNESFSTVLKPSTSEVLIEDGKQAQDKSKALKESNSMKNGN
FT                   GQLDLGSSQGSVSRSPLSSKEKKEDIVYAKKDGEETKTSSSPIVDRKLEGPISREASVS
FT                   TERTSKPLKPEAKALSSGLQGGNEKGLSHTTTLHLSDGSTRERATLVYPSESEASYEDV
FT                   SSSGGDDEGATDLRNRGPRPRISVIKL"
FT   gene            <140848..>141876
FT                   /locus_tag="Eint_111200"
FT   mRNA            <140848..>141876
FT                   /locus_tag="Eint_111200"
FT                   /product="NADPH adrenodoxin oxidoreductase"
FT   CDS_pept        140848..141876
FT                   /codon_start=1
FT                   /gene_family="HOG000149217" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111200"
FT                   /product="NADPH adrenodoxin oxidoreductase"
FT                   /note="similar to ECU11_1310"
FT                   /db_xref="GOA:E0S9Z7"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z7"
FT                   /protein_id="ADM12619.1"
FT                   /translation="MKVCVIGGGPAGLYTAASLLSRDVNVTLYEKEPELGGLYRYSLLP
FT                   ESRMSPFTKLLEHKNFSLKLNSKIDLEKLSGMEKEFDAFVIATGPGGPRKLAIPGADHC
FT                   IGSLDIAKSWAGEEPKYTVGSKVLIVGMGDVSMDITKYLFGWAGPQFKFPKNALERVKE
FT                   VRDVTITSRRNVLESSFSNHGLRSVLEIPRLGFSWSSPKDISCPDKDKTKDLEQKFTYL
FT                   QKDDGKKDNINKWKERRLRLFQGVREGAKRLRLMFNTNIKSIERVGRQYKVKMEQGGIP
FT                   IEEYFDTVISSVGFSRADPRSLGFTKPVYYVGWAKHPKGNAERAKEDAQDVVNKIVEMK
FT                   KM"
FT   gene            <141922..>142362
FT                   /locus_tag="Eint_111210"
FT   mRNA            <141922..>142362
FT                   /locus_tag="Eint_111210"
FT                   /product="transport protein particle complex subunit"
FT   CDS_pept        141922..142362
FT                   /codon_start=1
FT                   /gene_family="HOG000149708" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111210"
FT                   /product="transport protein particle complex subunit"
FT                   /note="similar to ECU11_1320"
FT                   /db_xref="GOA:E0S9Z8"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z8"
FT                   /protein_id="ADM12620.1"
FT                   /translation="MSYLICGIVEYLLEQKKDVEASLKTIGYEIGIKLLEVCNFEREVH
FT                   IPTLLYRIAFDFLSLVGDSDKRIDKSEDSDKTYFLTDADGVLSRFMSVPTEWDGFSADS
FT                   VVCGMIEAVLMASGYRSEVTAFPKPSESLSNRVIFQINILDP"
FT   gene            complement(<142412..>143176)
FT                   /locus_tag="Eint_111220"
FT   mRNA            complement(<142412..>143176)
FT                   /locus_tag="Eint_111220"
FT                   /product="Forkhead/HNF3 transcription factor"
FT   CDS_pept        complement(142412..143176)
FT                   /codon_start=1
FT                   /gene_family="HOG000149216" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111220"
FT                   /product="Forkhead/HNF3 transcription factor"
FT                   /note="similar to ECU11_1330"
FT                   /db_xref="GOA:E0S9Z9"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9Z9"
FT                   /protein_id="ADM12621.1"
FT                   /translation="MSWSTTFQDLLDTELLESDMDQDVKDLCMEEGGKAESSLWEFLEQ
FT                   EVEGESAIHRFYMRFMENRMRPSSPDARINPRSLYGNFLEMKEMDENVEEEKTREFGGC
FT                   DVLRAKPSLSYAQIITRAIRTSKTGKLTLSEIYKWIEDSFEYYRYANPVWKNSIRHNLS
FT                   LNKCFKKVPRDPGTRGKGGKWMLDHEFLSKEEFKRRRRVRQYSTKILDRSESSGDCSND
FT                   ERDFESCDVDVSTSLVSQMKRFVVSEVNPSKM"
FT   gene            complement(<143383..>145368)
FT                   /locus_tag="Eint_111230"
FT   mRNA            complement(<143383..>145368)
FT                   /locus_tag="Eint_111230"
FT                   /product="White ABC transporter-like protein"
FT   CDS_pept        complement(143383..145353)
FT                   /codon_start=1
FT                   /gene_family="HOG000191893" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111230"
FT                   /product="White ABC transporter-like protein"
FT                   /note="similar to ECU11_1340"
FT                   /db_xref="GOA:E0SA00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA00"
FT                   /protein_id="ADM12622.1"
FT                   /translation="MKNHHLQLKDVVLVAPGQDMSYNERFDIMIKDVDVEFRSEEIYAF
FT                   MGTSGSGKTTIMEGISGLFPEESMTSGQILIDNEERDYYKWHSEHSCGRQSGYSIEDLT
FT                   LDEFIYYTVLFSFPNEDKERINEVIDIVLKDVLNLNDVRHHKMNMLSGGERKRTNIATA
FT                   LIKMLLLEGKLRVVLLDEPTSELDSGLAVKVVRFVKEYARRSGAIVILTVHQPGPELFN
FT                   LFDSLLFLNRGAKVYAGPPDKFIDFLNTKGIYNSGLSKTNMEFLFSLFTKGSKESQQYE
FT                   TQINNMLREMKEEKEKRRKVKEIKLKVEEDTRISLVPSLSSAILLIKRQLILSGVRSRE
FT                   ILLSLAIVLGLSIAIFFAEVNTKTGRQVACIRDLVFLLSLIPFSNAILEKSLHYTREEI
FT                   SKGLYNTATFWLSSVIFEFLMIVIRCTLGLGTLYCFGTIETRNLPFFFTNLILMFFSSC
FT                   LPRMMIVSVAEPSTGLGKILSFVANLVVPILVTLGIPKVIKNLLLPKEILGFLPQSISS
FT                   FLELFYETIFYVQKPFRSRIDKFCNLLVESVKEKKEKENIGSIFPMLVMLFISFLIISI
FT                   ISILLLDRRLTPSVRLQLSDDKTKEEKSLKKKFQSLFRGPWLKRFLVSLAMVLGITVVW
FT                   LILWKYLFGFSRMEEKKPCAG"
FT   gene            <145514..>146047
FT                   /locus_tag="Eint_111240"
FT   mRNA            <145514..>146047
FT                   /locus_tag="Eint_111240"
FT                   /product="eukaryotic translation initiation factor 4E"
FT   CDS_pept        145514..146047
FT                   /codon_start=1
FT                   /gene_family="HOG000149214" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111240"
FT                   /product="eukaryotic translation initiation factor 4E"
FT                   /note="similar to ECU11_1350"
FT                   /db_xref="GOA:E0SA01"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA01"
FT                   /protein_id="ADM12623.1"
FT                   /translation="MNKLPSRFHVTLKVLENSGNEISKDTYEKDLKSICTLESQEHVSY
FT                   LLHHLKDFDKIDKQFYINVFKEGISPVWEDENNMNGCDWSLMLKKEVCQRYFERLLVNL
FT                   CTGYFKTFEPTGIVGIHKDNRFKLSIWSKNIPSTADCGAIINELKAALEIDFVITFHYK
FT                   NHSKILAYHKSLDA"
FT   gene            complement(<146173..>146427)
FT                   /locus_tag="Eint_111250"
FT   mRNA            complement(<146173..>146427)
FT                   /locus_tag="Eint_111250"
FT                   /product="Pdcd5 programmed cell death 5-like protein"
FT   CDS_pept        complement(146173..146427)
FT                   /codon_start=1
FT                   /gene_family="HOG000149707" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111250"
FT                   /product="Pdcd5 programmed cell death 5-like protein"
FT                   /note="similar to ECU11_1360"
FT                   /db_xref="GOA:E0SA02"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA02"
FT                   /protein_id="ADM12624.1"
FT                   /translation="MDQSDELIRRVLDERSLEALSTLKHINKEKGEMLQSALAQHFYSV
FT                   RRPISYSEYIEIAKKIEEKNSKPSVNFRRRGNFFELDDI"
FT   gene            complement(<146468..>150850)
FT                   /locus_tag="Eint_111260"
FT   mRNA            complement(<146468..>150850)
FT                   /locus_tag="Eint_111260"
FT                   /product="cell division control negative transcription
FT                   regulator"
FT   CDS_pept        complement(146468..150850)
FT                   /codon_start=1
FT                   /gene_family="HOG000149213" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111260"
FT                   /product="cell division control negative transcription
FT                   regulator"
FT                   /note="similar to ECU11_1370"
FT                   /db_xref="GOA:E0SA03"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA03"
FT                   /protein_id="ADM12625.1"
FT                   /translation="MDEKGYKHEIKDILEKSDPKEVDRGFMDDVLEKIKRRREVTPQEV
FT                   ARAILFMADFPDREWNLPAIVGSMKSNLEEINWRDVYSCFLDVNFSIWTLESLYVIVDC
FT                   WVHISGIITVPYEIFFKRWKNERAQMYFLRLIIESDEKRTQLYSNVFFSRIISIEDSRS
FT                   HRFKNVMGYESNFNCVELFQCIGMLGSIPLVELIARKSPEWCAAGLGFVQPKFGRIFED
FT                   LLSGFARGAPNSFILHVLFKNHPEMMLQKSLVLIREGIPVSRILDMFLEHKMLPLVSEL
FT                   LNPPELCFDIIVLSSIRDHLNLGIWLSNNLTTRKDEFVRSLVLYLDSKISKSNEPEKMF
FT                   PLNVEIMGVFTKAVEQYVRILKPETVGMYNEFKSRIPHGLRTQRSKEVRIEEEASNFIS
FT                   QIINSQRGIESSINQIKEFLKGNALSKVLASRIFSALLENYGSLYKLPNSDLIALLYGG
FT                   LIKEGVFPKPYRRMAIEYIKGSLKYPENDREYSFGFRCLEVFLPSCPTILAEIEEIESV
FT                   NSILVKKELILVDSTSHPLLDEEDIVKLIFKCGSKNERTEEMIKSLEIEAEGGIERLGE
FT                   FLEKGILDREEVVLYIIQNIEVENGRRLVAIVEGLGKEFYLRFVRRSFEFLKMFLDYRS
FT                   ENEIGIAKGLGYVLGGVMLAKNRIVTSEQFDFKKFVVKSVECRRIRFGVSFITSFLKQG
FT                   KSGIIFIPNNPWMMSILNLLSEIYSCTPKPVRDEIQGLFNHFSVDLVPREFKNLGLKSK
FT                   KYLAEYVIEDRDLVVRHVISLALDLSVREICGPIVEKACSVAIQTGMELFRTMAVEKGM
FT                   EYILFRNMVVNLTKFLCLVSAQEPIRACISGNVSYFMKLCSLDFSTERVFKIAQENQEV
FT                   CCDLIQKSGASKVSELISTCYNNLEYSNGEPKGMHLSLLEDPGHIEKIVIKAIDNGEYQ
FT                   EIKAHLVQLSKKIPYSKKNIIADEWHGLLNEGREEVFRRILESVESSEDKDEECIRLCR
FT                   YITGHLIKSGSKEDFLFECMEKIFKISFKTQKEVLGWLIYSNDPRKFSVSLVSKFIEHN
FT                   LINVVEYDQALSKTPLADGNLDFVISLLTSLITAEVQICTVYDFICTLEMLAGHGDNPR
FT                   VFDFFQKISNLMMHIEAKGASDYDEYVRSCKFTTVPEMFLPEFMERANYPGSVDIRSAF
FT                   KVSWDHFIRYHRIPTSYCYLKIDPLPGLIKEKLYESIKESLFVFLEAYRKRNYLFFKLY
FT                   TRFIVKTLDIMEDTPTNRSLVYSVLEVLSPSQVPGFTSCFLEILGHRFVLRCFDSEEGV
FT                   ILAMEALKCGSYSSKLMYPITQIMQFFKRSSGYVKMYSSYLAYCCPQEYPHVKNFINQF
FT                   RDRIVPVEGQNPFFRLRTALQNRTSVKVTDLGIGKNLWVYLIDNLNEMDAISSTVIESI
FT                   KFMIERKMHLEEILTILWIRMKAPGAPKALAACYDEISSFDFCRVFLKSLENHGYNKL"
FT   gene            complement(<151040..>151654)
FT                   /locus_tag="Eint_111270"
FT   mRNA            complement(<151040..>151654)
FT                   /locus_tag="Eint_111270"
FT                   /product="60S ribosomal protein L15"
FT   CDS_pept        complement(151040..151654)
FT                   /codon_start=1
FT                   /gene_family="HOG000229584" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111270"
FT                   /product="60S ribosomal protein L15"
FT                   /note="similar to ECU11_1380i"
FT                   /db_xref="GOA:E0SA04"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA04"
FT                   /protein_id="ADM12626.1"
FT                   /translation="MGAINYLREIHRRKQSDVMRYLLRIRVCEYRQRGECFRVEKPTFL
FT                   ERARTLGYKAKQGYVLYIARVKKGNMKRNYHNGNTRGKCVNAGINQIKPSLRKQATAEM
FT                   VAGKKCSNLGVLNSYWVGQDAAYKYYEVIMVDRHHQAIRNDIKINWICKNTMKHRECRG
FT                   LTSASRKSRGLGKGIRFNKSKGGSIRSCWRRRNTLVLQKYR"
FT   gene            complement(<151756..>152334)
FT                   /locus_tag="Eint_111280"
FT   mRNA            complement(<151756..>152334)
FT                   /locus_tag="Eint_111280"
FT                   /product="polyadenylation factor I complex subunit Fip1"
FT   CDS_pept        complement(151756..152334)
FT                   /codon_start=1
FT                   /gene_family="HOG000149706" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111280"
FT                   /product="polyadenylation factor I complex subunit Fip1"
FT                   /note="similar to ECU11_1390"
FT                   /db_xref="InterPro:IPR007854"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA05"
FT                   /protein_id="ADM12627.1"
FT                   /translation="MNVFGALWMQNDEEFFVGDQEDENTSSDLELIVDKASGKEEQKEE
FT                   AEGQNILDYDIESFTDKPWNKPGADITDYFNYGFNETTWREYCNMQRRKSEFARGGTEW
FT                   TDEKYGGVRRGFSEIKKEGEGDGGRGRRGSRGEREGGRRGTGEGRWEGWNGRKDGGRRR
FT                   GDREERSQGRYEERGEGRRQGYRDGGKRQ"
FT   gene            <152407..>152733
FT                   /locus_tag="Eint_111290"
FT   mRNA            <152407..>152733
FT                   /locus_tag="Eint_111290"
FT                   /product="DNA-directed RNA polymerase subunit M"
FT   CDS_pept        152407..152733
FT                   /codon_start=1
FT                   /gene_family="HOG000228134" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111290"
FT                   /product="DNA-directed RNA polymerase subunit M"
FT                   /note="similar to ECU11_1400"
FT                   /db_xref="GOA:E0SA06"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA06"
FT                   /protein_id="ADM12628.1"
FT                   /translation="MSDRFCKECNNLLYPKEDDNTLFLACKNCEHVQEAKSHRLYVRSF
FT                   RPKYASIELYARDLAQDPTLPSVKINCRSCGFNRGLYFQTRGSEDDVALNIYYLCCRCH
FT                   HLWS"
FT   gene            complement(<152758..>153573)
FT                   /locus_tag="Eint_111300"
FT   mRNA            complement(<152758..>153573)
FT                   /locus_tag="Eint_111300"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(152758..153573)
FT                   /codon_start=1
FT                   /gene_family="HOG000149704" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111300"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1410"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA07"
FT                   /protein_id="ADM12629.1"
FT                   /translation="MLLFLRDFWIEKTIYKQVYNTEHWKEEQQMSFHGQLTRIGRELKD
FT                   GSFEVCVSDSRHFIGGVLAKESIEMFRREIACGIEDIQGCYITVDRFHYEYSFESKKFF
FT                   LRIEKFTYCGGECDTYGDPADINEVHFLKTLSNSPLYMRPVCEELVIHRASIEDMCEGK
FT                   EGAYLMEVLRQNNDICGDECRLCSGLKKGDSQESYRPQKQKARRYNPFMERPEEDMDIE
FT                   ARRKEMKKIYLSDGVYVEKKADERDVSGPKNRYLDLCSDSEGEEHKDLL"
FT   gene            complement(<153647..>156184)
FT                   /locus_tag="Eint_111310"
FT   mRNA            complement(<153647..>156184)
FT                   /locus_tag="Eint_111310"
FT                   /product="ATP-dependent chaperone ClpB"
FT   CDS_pept        complement(153647..156184)
FT                   /codon_start=1
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111310"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="similar to ECU11_1420"
FT                   /db_xref="GOA:E0SA08"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA08"
FT                   /protein_id="ADM12630.1"
FT                   /translation="MNAKRYTERAQNALRGCLEEAIANSNNVVEPEHLLKVILNDQTSV
FT                   LYSVLNPTERNDIKNALIKKIGGFAKQYNCTEPRVGEALARVLAAAEKGGDGYVSVNAL
FT                   VLQLLSVKSIKELLINSEDIKKRVEEQTKNKRFDSRNSDDATNAMSKFAVDMVEQARQN
FT                   VFDPVIGRDEEIRQVIEILSKKTKSNAILVGKPGVGKTAIVNGIAQLIANGEAPTLQNA
FT                   RIYNVDVGSMVAGTAHRGDFEERLKSLVKEAETTPGVILFIDEIHIVLGAGKTDGAMDA
FT                   ANMLKPGLAAGTIKCIGATTHDEYRKYVEKDPAFERRFVQVVVNEPSIEDSITMLRGLR
FT                   ERLEAYHGVKIADNALVYAANSSKKYISNRRLPDVAIDLVDTACASAVIALESEPQEIL
FT                   NARSKAWSLELEKASLEIDLAREKDEHTMKRLENVVEKIEEVKRSIEPMEEAYLKEKRH
FT                   VIEAKKLKKRLEDTKLRLAQAERDTYVAYDLKMNVIPVIESELKRLESVEVILPVNIAE
FT                   VISRWTGIPVKRLTIKENERLMEMSSRIKRRIFGQGHAVDSIVDSILQSRVGLSREDKP
FT                   IGAFLLLGPTGVGKTELAKAVAMELFDDEKNMLVLDMSDYGNEMSITKLIGASAGYVGY
FT                   NEGGALTEPIKNKPYNVILLDEVDLAHQTVLNVLYQLLDEGRVTDGKGTVVDFRNCVLI
FT                   MTSNLGQEIMMRSPELRDEDRKEIERLVLNRFGPPLVNRIDNVIYFNNLDRESMYKILE
FT                   YQMGQLRKKLDEKGISFEISDRVKDDVIEKAYSSTYGARLLKRFIQSNFVHALTKILLM
FT                   RETEDPIRVRCSHVSEEGEGVRISDYVYSVRPQ"
FT   gene            <156635..>157390
FT                   /locus_tag="Eint_111320"
FT   mRNA            <156635..>157390
FT                   /locus_tag="Eint_111320"
FT                   /product="diphthine synthase"
FT   CDS_pept        156635..157390
FT                   /codon_start=1
FT                   /gene_family="HOG000205302" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111320"
FT                   /product="diphthine synthase"
FT                   /note="similar to ECU11_1430"
FT                   /db_xref="GOA:E0SA09"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA09"
FT                   /protein_id="ADM12631.1"
FT                   /translation="MLYLVGFGLHSYKDITLRGLEAAKSSTRVYLENYTSIHGEPLDEF
FT                   EELIGKKVFLADREMMEQTDKIVDESLEEDVTLLVVGSPLFATTHTDIIIRAKEKGIRV
FT                   EVIHNASIINVLGCCGLYSYTFGKVVSIPYFAGKWRPTSFYDNIVKNYQNNLHTLCLLD
FT                   IKADEHRFMSVNEAIDQILEAATLTGSSLINEDTRIFAICRFGSPTEEVAYERIADLKL
FT                   RSFGDPLHSLIIPAKLDRVEEELVGSLFE"
FT   gene            complement(<157458..>161228)
FT                   /locus_tag="Eint_111330"
FT   mRNA            complement(<157458..>161228)
FT                   /locus_tag="Eint_111330"
FT                   /product="polar tube protein 3"
FT   CDS_pept        complement(157458..161228)
FT                   /codon_start=1
FT                   /gene_family="HOG000184688" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111330"
FT                   /product="polar tube protein 3"
FT                   /note="similar to ECU11_1440"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA10"
FT                   /protein_id="ADM12632.1"
FT                   /translation="MLLFLLCLYNMEVRSETKVSPDAIHRSKEANTGKGMDYGNRSTRN
FT                   ARIKMKVHSRHDDDSNRRVHRTHHKGGHRKYGGSIKPHNKNHEKILRNMINSHGNNPEN
FT                   LSHEEKDLANMAAHGNLDALDMLYNDGSITPDVAEDVESSILGSPSARPATVAPLESEL
FT                   VSVETPPDYSNPEETYFSGGVATGRTNKEQAEINALTYNESPIDDEIPENAYSSLVLMG
FT                   HSVPVAQGVADEIKDANAKKALRKKRANTISQPLVNPSYIPQAQLAKIVNSKDVVSEAD
FT                   RDMLVKSVYEKYIEKGSPEEKAGFEAYQAGFLIDKYNEALASGLSPEVAYAKAMSLADL
FT                   NYQHATRSAAIAGGGQTAAQSAEDRSLIEEKNAREIVRTPSGLRPKALKKKEEEINEKR
FT                   LERARDISDYLSKVHITEPINRALQKLSQAAALKEAASVEGLSNPVVQEKILTDVAISS
FT                   AEDLAKAHENLENAKAQLKPRGRKTNALNFLSKVSTEKAIEEMNRRNEEMQNEAIRVQK
FT                   EANENNAVKEAEEHLAKAAEQEIINNEGKSAFTKVFESTGDIMQAEKAREEAEKITEET
FT                   LNHEREVRKEEVMKMLGPMGMNDSIQEAVDHMATAHAGLNVVGSNLEELNKKYEEEMAH
FT                   QSNIEALRKETSTSNLNVKEIIPPTTSRIGISDGKVKLPLKGFSNEEPKSEEEVIVQSR
FT                   QKNRRNQVRNKVVGTAVESGLNVIEMENGAVHISEAAKALKVNKGKVIFPEGTKELMEN
FT                   QKLDTSLLEHQYNTGERPELDKGVGYYEANVDGFVLPLPSPLDPVPPSTMTDGKKSLNI
FT                   GSASELDIEDGELIQTPWNEFVKEMRPMINGRLAHESEVAAASEMKARVEEEKKAKNLE
FT                   GITTEVYTNPDGSKFVEISSPYGVPEIMTMDQAIESLNSVGSSTVGAVSEELKKKSPDV
FT                   PLDMAVTDSVKGSEETFISNVLSEIQKSGNGNEVAKKNVFNGKIDGEKAAIVDEYNKEL
FT                   ISEHISTSTSTESQVRNNIISKAESYAKGMNISTETFLNMISQLPDSTIKEMISYNEAS
FT                   PEARKDITGTNFYSQITNILPDSKTNVGSITEMIFNNISTVTHQPNTVGGEILEQMIVP
FT                   NLKSVEQIETKKTPTGTTEISVSVPNDPRKTQVLGEVKFKGNPTVTPTPTKNSTGVQAG
FT                   ASSTPGRTGTASNTGAGQIPGSGVPSSQQNPLKPEVKASPATSNTFTRQVQPGQPDHTM
FT                   NGLSYSFPGANVPTTGTPQLPATGFTGQIAH"
FT   gene            complement(<161451..>162269)
FT                   /locus_tag="Eint_111340"
FT   mRNA            complement(<161451..>162269)
FT                   /locus_tag="Eint_111340"
FT                   /product="protein transport Sec13-like protein"
FT   CDS_pept        complement(161451..162269)
FT                   /codon_start=1
FT                   /gene_family="HOG000149212" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111340"
FT                   /product="protein transport Sec13-like protein"
FT                   /note="similar to ECU11_1450"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA11"
FT                   /protein_id="ADM12633.1"
FT                   /translation="MDIHKDTIHSIETDFSQKKIVTSCSDGIVRVFSKGTADSPHNLAL
FT                   EMELNGNSGPATKAIFLNQGEFIASSYFSGKVIVWKYENGKFNKKYEKQLLNGSVNDIS
FT                   GRWNGGSFTLFCGCSDGNVRVLAVDSSFGVTESEIFSHRFGVSCVSATENGFVSGGMDY
FT                   SVAVWEGSEEVARFRDHKGFVRDVSVCPPNSFKLFCMASCSEDGTVMIYTRNEGEYKLQ
FT                   KIVLDEPCYSLSWSFSGFSLSVGYGDSRFKCFVPDSSGEFKEVGLKKIES"
FT   gene            <162453..>165005
FT                   /locus_tag="Eint_111350"
FT   mRNA            <162453..>165005
FT                   /locus_tag="Eint_111350"
FT                   /product="translation elongation factor 2"
FT   CDS_pept        162453..165005
FT                   /codon_start=1
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111350"
FT                   /product="translation elongation factor 2"
FT                   /note="similar to ECU11_1460"
FT                   /db_xref="GOA:E0SA12"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA12"
FT                   /protein_id="ADM12634.1"
FT                   /translation="MVDFHISKVHELMTNQKNIRNISVIAHVDHGKSTLTDCLVIKAKI
FT                   VSKDSGGGRYMDSREDEQQRGITIKSSAISLHFQIEKDVLEAYTKKEDTNGTEFLINLI
FT                   DSPGHMDFSSEVTAALRVTDGALVVVDCVDGICVQTETVLGQAMGERIIPTLVLNKLDR
FT                   AILELEYPQEKLGEVLRRRVEGFNAKLSTLGYNFKVESLMPEKNDISFCSGLQGWGFTL
FT                   RHFARFYLEKFNMSGFEGEKKLTNFLWSHKVSCTSDDPFDPNIKHIAKPNPARSPFVVY
FT                   VLNPIYKVKDFCNNGQIEEIKEYLKFYKVDFKGVTLTGSGKSLFKEVMKAWLPAADCIL
FT                   EQIALKLPSPLQSQKLRYDYLYEGPKDDEVGTAIMNCDASEEAPVTMYVSKMISSNDNR
FT                   FIAFGRVFSGKIYPGMKIRVQEPGYTPLPEDSEGSPLLHIKSVLRTVVMMGRGYKDVPN
FT                   CPAGNIIGIVGVDDCLKKTGTITNRKDSYNIRSMKFSVSPVVKVAVSTKRPEDLGKLQE
FT                   GLKKLAQSDPLCLVERNDKGQNTIACAGSLHLEICLKDLQDQYAKVPIISEDPLVTYFE
FT                   GISSSITEPKMTKSANKHNRIYMTVEPLEEKIVDNLNDVKSDQIKTMTTNFREMLDIRD
FT                   DWIKKIWCYAPEINPLNLLVDGTKGISIINEIKEHVNTGFRAAVNDGPLIGEVMRGLKF
FT                   ELKDAVLHADAIHRGINQLLQPVKSLCKGLLLAATPILYEPIYEVEITSPNDFSGAATT
FT                   ILLSKRGTAEDFKTLPGNDTTMITGTLPVRESFTFNEDLKSRTGGKAGASMRFSHYSIL
FT                   PGSLDDPNSLMFKTVETVRKLKKMNPEPPTADSFFDKL"
FT   gene            complement(<165088..>165375)
FT                   /locus_tag="Eint_111360"
FT   mRNA            complement(<165088..>165375)
FT                   /locus_tag="Eint_111360"
FT                   /product="class 2 transcription repressor NC2 subunit
FT                   alpha"
FT   CDS_pept        complement(165088..165375)
FT                   /codon_start=1
FT                   /gene_family="HOG000149211" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111360"
FT                   /product="class 2 transcription repressor NC2 subunit
FT                   alpha"
FT                   /note="similar to ECU11_1470"
FT                   /db_xref="GOA:E0SA13"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA13"
FT                   /protein_id="ADM12635.1"
FT                   /translation="MPRQESQKKKLTKFPISRLKRIMQLNEDIGKIGASVPVVASKAIE
FT                   MFLAEVVGLTLKEAKKKNSSRMSPEFIVRAIESNSKFEFLKGMEQLKNKE"
FT   gene            <165476..>165826
FT                   /locus_tag="Eint_111370"
FT   mRNA            <165476..>165826
FT                   /locus_tag="Eint_111370"
FT                   /product="hypothetical protein"
FT   CDS_pept        165476..165826
FT                   /codon_start=1
FT                   /gene_family="HOG000149703" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111370"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1480"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA14"
FT                   /protein_id="ADM12636.1"
FT                   /translation="MDREALRCRVLTTLSKSSLFRFIENILEEGKVNSMAVNITEYLLN
FT                   NKYSRERAQQHISDYLEDELERSGIDLDDSVDGVSLAILFVYEELLENKSEFFLKIEEK
FT                   AGHTIPLSDSDE"
FT   gene            complement(<165834..>166823)
FT                   /locus_tag="Eint_111380"
FT   mRNA            complement(<165834..>166823)
FT                   /locus_tag="Eint_111380"
FT                   /product="splicing factor 3B subunit 2"
FT   CDS_pept        complement(165834..166823)
FT                   /codon_start=1
FT                   /gene_family="HOG000149210" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111380"
FT                   /product="splicing factor 3B subunit 2"
FT                   /note="similar to ECU11_1490"
FT                   /db_xref="GOA:E0SA15"
FT                   /db_xref="InterPro:IPR006568"
FT                   /db_xref="InterPro:IPR007180"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA15"
FT                   /protein_id="ADM12637.1"
FT                   /translation="MDRIKSKAHMRAEINDEYGFIHEIRPNRNPLNKRQRKKRALQHRY
FT                   EDLKLVVPYPELFEFEDVTCPDPIAHNKMKGQSSVPVPSNWRSSSGRMFPHGYHKPGYQ
FT                   IPWNVMKTGIPELRRMMKEREAGMSLRERVREKLYPKLGKSLVDQRILYEAFSIEEKPH
FT                   LSSYGEFFKPGTDYFIKKSSSGTMSVELMEALGIDNTTPPPWLFKMQKYGMPPSYPNAR
FT                   IPGLNAPIPEGCMYGYQPRGWGEPLVEAEAGIAENGILQESVEVIYNTENQYTKPVYIE
FT                   ELEERVTLESSRAEKDEAPEEKAVAKEEVEAKEKRRSRKEKLYKSIKF"
FT   gene            <166831..>167667
FT                   /locus_tag="Eint_111390"
FT   mRNA            <166831..>167667
FT                   /locus_tag="Eint_111390"
FT                   /product="NimA-like Ser/Thr protein kinase"
FT   CDS_pept        166831..167667
FT                   /codon_start=1
FT                   /gene_family="HOG000149209" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111390"
FT                   /product="NimA-like Ser/Thr protein kinase"
FT                   /note="similar to ECU11_1500"
FT                   /db_xref="GOA:E0SA16"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA16"
FT                   /protein_id="ADM12638.1"
FT                   /translation="MRRFRFIQKLSRGVHGTVYLLETTDSKREKVVCKSVLWRYRKHAE
FT                   NEARILSSISYKRIVKLIDFFPSDFGLFIVLEYMDCGSLDEMMIYFMESNFRATDRLAW
FT                   SVLTQIAGGLRYLHSKKIIHRDLKPSNILANRARAEGGLMLEFKLCDFSVSKKLGKDGQ
FT                   ISGIAGTPSYMAPEMVSGRHYTTSVDIWSLGVSIYELLALKKPFEGKNRNELFEMIKQA
FT                   KLPQEMCKDMDLERLIRRCLSKKNRISARDICNYRKSDLTCRCRDKSRDVFRNGIS"
FT   gene            <167814..>168818
FT                   /locus_tag="Eint_111400"
FT   mRNA            <167814..>168818
FT                   /locus_tag="Eint_111400"
FT                   /product="Co/Zn/Cd transporter"
FT   CDS_pept        167814..168818
FT                   /codon_start=1
FT                   /gene_family="HOG000149208" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111400"
FT                   /product="Co/Zn/Cd transporter"
FT                   /note="similar to ECU11_1510"
FT                   /db_xref="GOA:E0SA17"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA17"
FT                   /protein_id="ADM12639.1"
FT                   /translation="MHNRKHLSQCSHTTCSNDADIKKISKVLFIILMFMFLELWGHWKT
FT                   NSLSLLADSLHLLVDIFGFIVSLLSLSWAKRPPNKKMTFGYHRIEIIGSLVSIGLIWAA
FT                   VGYLAIESFHKYLHPSEIDGGMFFAIAVVGFFVNCICIYVLHYDEYQHKLKHKNLNIRA
FT                   TYVHVIGDLIQSVGVIIAGMVTYFYPSKAIVDVVCTLFFSVLVLTSTGFVFRDAIHILA
FT                   EGTPMDLDIDGMKTDVLGVENVYKIVDLYAWSISMNRNAVSIKILADDLLISDYESILL
FT                   EVNHIITTKYFVDIVIIQIDTPNTFYGEKGFVVDGVAIDLEALETPGMMIPQA"
FT   gene            <168875..>169564
FT                   /locus_tag="Eint_111410"
FT   mRNA            <168875..>169564
FT                   /locus_tag="Eint_111410"
FT                   /product="putative S-adenosylmethionine-dependent
FT                   methyltransferase"
FT   CDS_pept        168875..169564
FT                   /codon_start=1
FT                   /gene_family="HOG000260965" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111410"
FT                   /product="putative S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="similar to ECU11_1520"
FT                   /db_xref="GOA:E0SA18"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA18"
FT                   /protein_id="ADM12640.1"
FT                   /translation="MDFTPEMEAKSIKKGLYRQRAHANPFKDSNIVIPQSPESIDWSSY
FT                   FVENKRPDFVDIGCGYGKFLLKVAEKSPEHNVLGLEIRDKVYEYVKARIEVLRIPNAGV
FT                   MRTNALIFLPNIFSRGQLSKIFILFPDPHFKKRKQKGRVVCQQMMEMYEYILADGGRLY
FT                   VSTDVEELFDYMVEVILAHGRFRPLSKDEASKDPVFPMTSKDTDEALRAGVKTGKVFSE
FT                   VFEIKKD"
FT   gene            <169643..>170575
FT                   /locus_tag="Eint_111420"
FT   mRNA            <169643..>170575
FT                   /locus_tag="Eint_111420"
FT                   /product="hypothetical protein"
FT   CDS_pept        169643..170575
FT                   /codon_start=1
FT                   /gene_family="HOG000149702" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111420"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1530"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA19"
FT                   /protein_id="ADM12641.1"
FT                   /translation="MGNDKVIVELLFVLSLLSLSLTFFPELIKDSVDEMGYFKGNRASE
FT                   NFNVLGIPKENKIEFYTMSGSRSNISITDFPNGSPISRAMLSLYKRKKRFSIYIDEKAR
FT                   SVSIYSESVIPKYIFKMKEVPKRSLTPAETIKGLDRFYLPNGPMDQKLIETLVYLELRG
FT                   CLEDKLFILYENTLILINEEKQMIFFDIDLEHLFGMMVEEVVSQTERKDGSNRLLIAFK
FT                   VESNIFFLFSPGDEQKGFGRRITGNTLSEGSIKLFPSSRDVQIKNAVSKDDYVGISKII
FT                   SDEERKEGIEVLKKLIIDPFRSEDLSFFR"
FT   gene            <170724..>172094
FT                   /locus_tag="Eint_111430"
FT   mRNA            <170724..>172094
FT                   /locus_tag="Eint_111430"
FT                   /product="hexokinase"
FT   CDS_pept        170724..172094
FT                   /codon_start=1
FT                   /gene_family="HOG000149701" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111430"
FT                   /product="hexokinase"
FT                   /note="similar to ECU11_1540"
FT                   /db_xref="GOA:E0SA20"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA20"
FT                   /protein_id="ADM12642.1"
FT                   /translation="MKQINLFTFFLVGMPGIQLLVVNGEETSKNTTTFPIQNSEAIEIK
FT                   RTFAERIAKAQEIFSDGDFLNSYIDPDKVKTYYRGVYETVVVDVGGTHLKISKVFIDSS
FT                   LPKREGALSFDGAMECIPSFYRYPDTSNLQNEDKITWNDWVAERMVEFYGQDLPKKKIN
FT                   ASLTFSYPLFQTSISNAKMERATKNFCFRIDDHTFDEDVVEALNTSLRNRNVNVHVSCV
FT                   INDSTATYMAGALRGYDNIIGIVLGTGTNSSFCVKKNGTDSVTLYNSEWGSTSVPRSML
FT                   TEADLAVITDLETKKISYSIIDVLVGGCKLNDMILNSLKTLHPELYEKYIDCEEELSLA
FT                   ISLAIKRQNEGILKEDVDLSQTLASIINDFNARGMKILASLVSAVIESCMKDMQYVTLI
FT                   LNGTTFSYEDLRRALKENVKEIHPNIDIRLEFLGNASLEGAAFVSLMSSDNSNPERL"
FT   gene            complement(<172124..>172951)
FT                   /locus_tag="Eint_111440"
FT   mRNA            complement(<172124..>172951)
FT                   /locus_tag="Eint_111440"
FT                   /product="DNA lyase/endonuclease 4"
FT   CDS_pept        complement(172124..172951)
FT                   /codon_start=1
FT                   /gene_family="HOG000224893" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111440"
FT                   /product="DNA lyase/endonuclease 4"
FT                   /note="similar to ECU11_1550i"
FT                   /db_xref="GOA:E0SA21"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA21"
FT                   /protein_id="ADM12643.1"
FT                   /translation="MAKIIGAHLSISKGIHTIQAQMELLGLDTCAIFLKSQRRYLAPPM
FT                   KDGAAEMFQAHVLHPELIVPHGSYLINFGNPSLIDKSMECLVDDMERCRSLGIKMYNMH
FT                   PGSDKGKNRRECLRGVSSHINTALSRVQGVTVLIENMAGQGNVLGSSFEELRDIIGGIE
FT                   DKQRIGICLDTCHLFGAGFDISTEEKFTEVMERFDRIVGLSFLKAMHINDSKEALGSKK
FT                   DRHESIGKGMIGERAFRFIMNSRIFDNIPLILETPDPEKYKEEASFLRGLVNK"
FT   gene            <173017..>173841
FT                   /locus_tag="Eint_111450"
FT   mRNA            <173017..>173841
FT                   /locus_tag="Eint_111450"
FT                   /product="t-SNARE complex subunit syntaxin"
FT   CDS_pept        173017..173841
FT                   /codon_start=1
FT                   /gene_family="HOG000149207" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111450"
FT                   /product="t-SNARE complex subunit syntaxin"
FT                   /note="similar to ECU11_1560"
FT                   /db_xref="GOA:E0SA22"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA22"
FT                   /protein_id="ADM12644.1"
FT                   /translation="MQDFLKDSKRILNDIETLNSYTNSIDYLSSQKNSSVLSKEEEKGL
FT                   NNQIDVLNGRFRVLSRKIKERIDKFSSETVELEKHNQKDKFYHETRKIHLHAQSKKLTE
FT                   AINRYRESQIKHREDEVDKFRLQYIIAKPDATEKEIEDFIGDDDGTKVASAYALGAHSA
FT                   QGILEEAENRKKNIKKIEEMVQEIVDLLNLISQEVSKRTEVVEAINDDLIAGEENTAAA
FT                   NADLESALEYQIRATRIKRIFVYGILIIALIFLIYFVFRTNFFGAFDRVRYY"
FT   gene            <173922..>174965
FT                   /locus_tag="Eint_111460"
FT   mRNA            <173922..>174965
FT                   /locus_tag="Eint_111460"
FT                   /product="putative zinc finger domain-containing protein"
FT   CDS_pept        173922..174965
FT                   /codon_start=1
FT                   /gene_family="HOG000149700" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111460"
FT                   /product="putative zinc finger domain-containing protein"
FT                   /note="similar to ECU11_1570"
FT                   /db_xref="GOA:E0SA23"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA23"
FT                   /protein_id="ADM12645.1"
FT                   /translation="MLGLSSNKVVKKENIICIYLNQPKDFIYDIDDIVIEYNEVKKDVE
FT                   VVNDSIPAFIKANMKGFFRGDLEEYTRFLEENLEIFFKGEVPKTKEPEKKEEVIRPFEL
FT                   PSDYKFPIGRKGPMNINIEVEKRYVSIVSCECLNLQVGCNRCGRVLRMPGAGECPGCRS
FT                   VLEIRYIPSVDSEFLGSLSFHGCRFICFNPSRYQLSCDGCHMNYETNELSIGDAFRIKC
FT                   YECLSNIFLKISSINLIQRKRETLKPGQPLPEKGTCRHYKKSYRWFRFPCCNSLYPCDI
FT                   CHDEESGHVHQMANKMVCGLCSKEQGVGKECSCGMNLKKSTSFWEGGKGTRNKATMSRK
FT                   DRKKYTK"
FT   gene            complement(<174989..>176863)
FT                   /locus_tag="Eint_111470"
FT   mRNA            complement(<174989..>176863)
FT                   /locus_tag="Eint_111470"
FT                   /product="ATPase/RNase L inhibitor"
FT   CDS_pept        complement(174989..176863)
FT                   /codon_start=1
FT                   /gene_family="HOG000222803" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111470"
FT                   /product="ATPase/RNase L inhibitor"
FT                   /note="similar to ECU11_1580"
FT                   /db_xref="GOA:E0SA24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA24"
FT                   /protein_id="ADM12646.1"
FT                   /translation="MGRGEEKTNPTRLAVVNFELCKPSQCASECRKACPVNKTGKECIK
FT                   IEKKSIIMENLCIGCSACQKKCPFKAISIINLPTNLNKEITHRYGMNGFKLHRLPIPRP
FT                   GKVLGLVGTNGIGKSTALKILSGEIKPNLGKYDDPPGWEDILGYFRGSELQGYFTKILE
FT                   GHLKITSKIQYIDRLPKLLKKKFNAKLKSSLESLSLDESRETLSDKLLVKDVLEEMDRR
FT                   GKKSYYIEKMYLGNILDRDVEELSGGELQRFSLALACMQESDVYIFDEPSSYLDVKQRL
FT                   SAAKEIRDLCEDNSYVIVVEHDLAILDLMSDFGCVLYGQSGAYGVITAPYAIKSAINIF
FT                   LDGYIPTENMRFRPSELKFDISERPTKDMEKRAQYWYGGMTKTHGSFKLEVKEGSFSDS
FT                   EIIVFLGENGMGKTTLVGLIAGLIKPDGEEEFTKLSYSLKPQKILPKYKGTVRELFMSK
FT                   IRSSFLDQSFVNEVIKPLGIEYTYDQRVQNLSGGELQRIAIAICLGKDANIYLIDEPSA
FT                   FLDSDQRIAISKIIKKFIYSNGKIAFIVEHDLIVGTYLADKVIVFEGEPGVSSVASAPM
FT                   DLLTGMNIFLKNLDVTFRRDPSNLRPRINKPGSAKDRMQKENNQYFFS"
FT   gene            complement(<176929..>177723)
FT                   /locus_tag="Eint_111480"
FT   mRNA            complement(<176929..>177723)
FT                   /locus_tag="Eint_111480"
FT                   /product="spindle pole body associated protein"
FT   CDS_pept        complement(176929..177723)
FT                   /codon_start=1
FT                   /gene_family="HOG000149206" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111480"
FT                   /product="spindle pole body associated protein"
FT                   /note="similar to ECU11_1590"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA25"
FT                   /protein_id="ADM12647.1"
FT                   /translation="MNRRDRLQVKRTPDSTLNLGMDETIILQAAAPKARANKSVEPMEG
FT                   NGYGQERKGIKDYPIYMAIAIPYVLFFYMAIKRPMDSMILTNLMEEINILREENSRISS
FT                   QIEMMKHIKEVNYAKIEEGARIRIESMSQLFSYGFLGFRKHKEPSTIFDENVGIGECLA
FT                   FKGAGCKFSIDLEKEAAISKIGLYHPVTKDTSSAIREFEVFSNSPEGNLLLGRFEYDTS
FT                   TCGFQTFEWEETPISSVEIVVRSNGGNKKYTCIYKVYLFGNK"
FT   gene            complement(<177786..>179111)
FT                   /locus_tag="Eint_111490"
FT   mRNA            complement(<177786..>179111)
FT                   /locus_tag="Eint_111490"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(177786..179111)
FT                   /codon_start=1
FT                   /gene_family="HOG000149699" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111490"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1600"
FT                   /db_xref="GOA:E0SA26"
FT                   /db_xref="InterPro:IPR002666"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA26"
FT                   /protein_id="ADM12648.1"
FT                   /translation="MSWTIKLYQYFGLKSFTPFLSFMVPYLVEQKGFHNRELHNNFSPL
FT                   FFMSSIVVSLFSFLIIELLGNKMSLFVDTFIEILVYLIFMFMPFKNTFLTKTVYVLHGA
FT                   TTSFGVVMKSILNSTAEEKEDKKVILSTAINIKTSVGVISSWIGQDIIMCGGNHFVNIS
FT                   ISLLGLSLALLTVLLLPATSPSKKEEKFIDYMWNPMDAWKKIKDTYKSHVVLVSLLSSS
FT                   ASILYICLSFYSAGIFLEKRKNGMENSIKVNKMLFFVAKPVRLVSYALIKIFSNFDNSI
FT                   SYHSNPVKPVIIHGYIEGCSKILSSFAGLQISRFVPENRCVSLAFLTSITTVAFTYLLG
FT                   ASNSMPYSYLFYILASLSSSLCKTVSNIGLQSVCEGSGYKFVLGFNLFVSSIIHISITH
FT                   YSKAYNLSVKSKLMSYFYVNTLFITAAFAMYLLSRGSTTIDG"
FT   gene            <179265..>180218
FT                   /locus_tag="Eint_111500"
FT   mRNA            <179265..>180218
FT                   /locus_tag="Eint_111500"
FT                   /product="tRNA pseudouridine synthase A"
FT   CDS_pept        179265..180218
FT                   /codon_start=1
FT                   /gene_family="HOG000149205" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111500"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="similar to ECU11_1610"
FT                   /db_xref="GOA:E0SA27"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA27"
FT                   /protein_id="ADM12649.1"
FT                   /translation="MKSGVCENLEDLDAENTERRSKEKQRKTFQCLSRRTVALRISYDG
FT                   RRYSGMAPQSGKETVGGHLENALKFTGLGEKLVYAGRTDAGVSAISMVVSGVFISRIEM
FT                   PNRSYVVTESDYKEYKYDMILNSHLPSDIRVIGWAPVPDTFSARFTCIQRQYRYYFHKE
FT                   DLDADRMREMASRIKKMENFYYFSKHSDKNARYERKLDECRIVDEGDVYYLDIRARAFL
FT                   HNMVRKIVWAIQKAGKGETYDAERVGTSEPDPLVFCGAIYPHELCFINNPRCHEEFRRQ
FT                   MENDQISYKISQARLESLRNELCKETKRKEEEASHK"
FT   gene            complement(<180225..>180638)
FT                   /locus_tag="Eint_111510"
FT   mRNA            complement(<180225..>180638)
FT                   /locus_tag="Eint_111510"
FT                   /product="40S ribosomal protein S19"
FT   CDS_pept        complement(180225..180638)
FT                   /codon_start=1
FT                   /gene_family="HOG000149202" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111510"
FT                   /product="40S ribosomal protein S19"
FT                   /note="similar to ECU11_1620i"
FT                   /db_xref="GOA:E0SA28"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA28"
FT                   /protein_id="ADM12650.1"
FT                   /translation="MMEEIYDVRPEKFNEALKSYLKSTNKVVPIKDHDIMKTGEGREQA
FT                   PIDEDWYFTRMASIVRQISIRGTVTPEYLANKYGSSKNRGCRPSKYVGAYPEIGISVLE
FT                   NLKNMGWINDHPQDMLTEKGKTVVKEIIEKVRE"
FT   gene            <180709..>181191
FT                   /locus_tag="Eint_111520"
FT   mRNA            <180709..>181191
FT                   /locus_tag="Eint_111520"
FT                   /product="hypothetical protein"
FT   CDS_pept        180709..181191
FT                   /codon_start=1
FT                   /gene_family="HOG000149698" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1630"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA29"
FT                   /protein_id="ADM12651.1"
FT                   /translation="MTPSYFISTKCCMVPHIPDAKSISSTNKNIKIYVDDILYKDSAYD
FT                   GGFDLPIREFCAISDIKTCLGFRNKPSVLVSKRGHYKLNKERYEGLLEVWRPDYHADFE
FT                   TGKIIIEGNELIEPKDTRDFVELLNSGHLLFGTEFINTLVEQGMMLALEGCRLDVL"
FT   gene            <181478..>182011
FT                   /locus_tag="Eint_111530"
FT   mRNA            <181478..>182011
FT                   /locus_tag="Eint_111530"
FT                   /product="inorganic phosphate transporter"
FT   CDS_pept        181478..182011
FT                   /codon_start=1
FT                   /gene_family="HOG000149201" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111530"
FT                   /product="inorganic phosphate transporter"
FT                   /note="similar to ECU11_1640"
FT                   /db_xref="InterPro:IPR012098"
FT                   /db_xref="InterPro:IPR019263"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA30"
FT                   /protein_id="ADM12652.1"
FT                   /translation="MSLSVVSVDQFVNFALSIVSMKISGKPMFQTPKAIWILRVTYLCS
FT                   NLIQLMFSLYIMQRIKKTNDTRKVKIKREASLFRDNNEEEEEEMTYASYDESELTKISR
FT                   TSIIQFLIITVLHLKWKVIQPLFVQSFVPIRNLLLSPLYAAYVWNRPVLRPFESNMLFQ
FT                   KAPTPSEKKRVKED"
FT   gene            <182131..>182502
FT                   /locus_tag="Eint_111540"
FT   mRNA            <182131..>182502
FT                   /locus_tag="Eint_111540"
FT                   /product="hypothetical protein"
FT   CDS_pept        182131..182502
FT                   /codon_start=1
FT                   /gene_family="HOG000149697" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111540"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1650"
FT                   /db_xref="GOA:E0SA31"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA31"
FT                   /protein_id="ADM12653.1"
FT                   /translation="MGNDITQEKNEDANGIQEETNTVEGTPTSLYGESDIIEEERSIVR
FT                   VKVQQKKGTKKVTIIENIPKELRESLLSSLKKEMGCGGILLDDKSSIQLQGDKTNMGIA
FT                   TYLKRYIKGCKVELNGRIR"
FT   gene            complement(<182579..>183175)
FT                   /locus_tag="Eint_111550"
FT   mRNA            complement(<182579..>183175)
FT                   /locus_tag="Eint_111550"
FT                   /product="ring zinc finger transcription repressor"
FT   CDS_pept        complement(182579..183175)
FT                   /codon_start=1
FT                   /gene_family="HOG000149200" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111550"
FT                   /product="ring zinc finger transcription repressor"
FT                   /note="similar to ECU11_1660"
FT                   /db_xref="GOA:E0SA32"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA32"
FT                   /protein_id="ADM12654.1"
FT                   /translation="MPKEPMLIASGQPGGNFSNVRVVQKNLVYIICIPQKYADEGVLSR
FT                   HEFFGQFGAIRKIVVNKRTSSLESTASAYITYSTDEEAKICIQEVDESLLDGKVLKCTY
FT                   GTTKYCTFYLRNALCQNSDCMYLHEHRSQKDILTKDEMCNSKHKLHDFEVKNKNKKRIG
FT                   KRYDFDVLNELFKHKTSRVFRAPDRILFEPLDFTN"
FT   gene            complement(<183419..>184111)
FT                   /locus_tag="Eint_111560"
FT   mRNA            complement(<183419..>184111)
FT                   /locus_tag="Eint_111560"
FT                   /product="20S proteasome subunit alpha"
FT   CDS_pept        complement(183419..184111)
FT                   /codon_start=1
FT                   /gene_family="HOG000149199" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111560"
FT                   /product="20S proteasome subunit alpha"
FT                   /note="similar to ECU11_1670"
FT                   /db_xref="GOA:E0SA33"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA33"
FT                   /protein_id="ADM12655.1"
FT                   /translation="MGSQARYNMFKIFNPEGYVKQLDFIQQTTELGNTVVGLRNKGAGV
FT                   LIAHNEKRSKLADTQKKVFPIDRRSLFTFSGITNDGQQIVDYLIDKSVQEEVIKGRPIH
FT                   FLDVFEDLLRDTFERTIVDGRRLYGVSGLYMAEYEGIRLVEFNPKGYAKEVSGMSIGSR
FT                   AQSSRTVLEAYCSEYEKMNVEELVRVGIMALKNAHPEDDALTKENVEIWILEAGKVVYN
FT                   MDAGMFLN"
FT   gene            complement(<184175..>184633)
FT                   /locus_tag="Eint_111570"
FT   mRNA            complement(<184175..>184633)
FT                   /locus_tag="Eint_111570"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(184175..184633)
FT                   /codon_start=1
FT                   /gene_family="HOG000149696" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111570"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1680"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA34"
FT                   /protein_id="ADM12656.1"
FT                   /translation="MYVILNKLVMYIGILSLVLAPRMMLYRVMDLIVREDTFKLFTSRT
FT                   GNGIFERLEEAPRMETVEDLEERIKGYFQEILKAAPADSLYFNEAFRMFNFVERIFKEL
FT                   RDLNESAMERSIRSPMDDVIRLYSESLGKFIEDMDIPILQEHVRFIIS"
FT   gene            complement(<184618..>185232)
FT                   /locus_tag="Eint_111580"
FT   mRNA            complement(<184618..>185232)
FT                   /locus_tag="Eint_111580"
FT                   /product="Myb-like transcription factor"
FT   CDS_pept        complement(184618..185232)
FT                   /codon_start=1
FT                   /gene_family="HOG000149695" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111580"
FT                   /product="Myb-like transcription factor"
FT                   /note="similar to ECU11_1690"
FT                   /db_xref="GOA:E0SA35"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA35"
FT                   /protein_id="ADM12657.1"
FT                   /translation="MASLDQLSQNQKDANIKLVKGPWRHEEDEKLLKLVKEFSPKNWSF
FT                   IAKRLGSRVGKQCRERWHNHLNPQITKKPFTVEEEALIIELHSKFGNRWSEIAKYLPGR
FT                   TDNAIKNYWNSSIQRRSEKVRRRSMFCSIDEFQKAHGITQEKGEYGFGLQKGDMGRKTK
FT                   RSISVQNLPEYVPNGGSLDEDDFDEMDEIASQALLRICMSF"
FT   gene            complement(<185716..>186678)
FT                   /locus_tag="Eint_111590"
FT   mRNA            complement(<185716..>186678)
FT                   /locus_tag="Eint_111590"
FT                   /product="GTPase-activating protein"
FT   CDS_pept        complement(185716..186678)
FT                   /codon_start=1
FT                   /gene_family="HOG000149693" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111590"
FT                   /product="GTPase-activating protein"
FT                   /note="similar to ECU11_1700"
FT                   /db_xref="GOA:E0SA36"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA36"
FT                   /protein_id="ADM12658.1"
FT                   /translation="MKNERCIRDLYNANSMSEEIFCTNEYGFVVDSFNSQARDNPVSIK
FT                   NEWYDLIARCKNNGEKLRRSEAARRLIYQGIPLSLKYRLWGLFTPKASGFSYSSLISKR
FT                   SGYEHQIHVDVQRTFRRHCLFSREYGRGQCELFNILTAYSNYNPEVGYCQGMSSAAALL
FT                   LMYFPEEEAFEMLVSIIKNNNLEALFDKKLSKVPRVQRVQDEIFRALIPEVYGHLLHQS
FT                   IDIGVYAVGWYLTLFTRFDIKLALRMWDFFLFFDFSVFMFFAAAILRFFAKKILELQGE
FT                   QLIEFIGALDSKEVDVERIVSYVVECFRNGEYEYYRDRI"
FT   gene            <186886..>187467
FT                   /locus_tag="Eint_111600"
FT   mRNA            <186886..>187467
FT                   /locus_tag="Eint_111600"
FT                   /product="hypothetical protein"
FT   CDS_pept        186886..187467
FT                   /codon_start=1
FT                   /gene_family="HOG000149692" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111600"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1710"
FT                   /db_xref="GOA:E0SA37"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA37"
FT                   /protein_id="ADM12659.1"
FT                   /translation="MHHKSTVKKTFKVLFFFIQALVFISGVGGSIVGTTVYLTAHELLQ
FT                   IPKKALVISYTLGILEVTSGILGYTALVSRRKIRMLVYILITLILMNAQAMAVVKNSAI
FT                   YEKSHSWADQRWSLLSEEQRNFIQMKFRCCGFFNPADRNGSSCGGEYGCAETIDKLSKS
FT                   TVKLLQKILMFLFFLESVGVGILSMLRLRK"
FT   gene            <187615..>188781
FT                   /locus_tag="Eint_111610"
FT   mRNA            <187615..>188781
FT                   /locus_tag="Eint_111610"
FT                   /product="hypothetical protein"
FT   CDS_pept        187615..188781
FT                   /codon_start=1
FT                   /gene_family="HOG000149691" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111610"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1720"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA38"
FT                   /protein_id="ADM12660.1"
FT                   /translation="MHQENRKKRIPGIHSYLAVIGELRQELGKVNESINDLRDKISAIY
FT                   KQERENSPKNNLYKKLEELGNEIKALKEDRSKAFNSKNDVVGVYENVKSEIQPEKGKKM
FT                   MSAQEIDARMKEINLKLISSKCDSKTEKIFEMEMENLRKQKKNIGMMEQKSKLAVDMKA
FT                   KLDSLNAEIKDLSQKIAERQSVVDGIKAELKEISDQGKPKNPAVEGYEKNIQILKAKRS
FT                   DLSEKIKAQQEKIREKEVEYDKFLEEMAIAQALEKQKEEIKQRINALEEQKNILSKEES
FT                   KLNPSKFDSIIFRMGSLNLSGEKISLPVDLALYLSQHKIPIPTSPSQVEPTIETLKSQK
FT                   ENFANQVVEKRKEFESKISDLERKISEEKKTLMEMPPTDIKVLKFKRD"
FT   gene            <189640..>191226
FT                   /locus_tag="Eint_111620"
FT   mRNA            <189640..>191226
FT                   /locus_tag="Eint_111620"
FT                   /product="Puf RNA-binding protein"
FT   CDS_pept        189640..191226
FT                   /codon_start=1
FT                   /gene_family="HOG000149154" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111620"
FT                   /product="Puf RNA-binding protein"
FT                   /note="similar to ECU11_1730"
FT                   /db_xref="GOA:E0SA39"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA39"
FT                   /protein_id="ADM12661.1"
FT                   /translation="MKREEIDDSNDCRIYHDDFRGGRHRPISAPPVDKFFIEDEVELGD
FT                   IQTDLNYSIFYRRNCKNEPRLQPPSFFIRGQSGYWASQYDDLITKAFSNTGFFDIKVTG
FT                   ESSAELENNRSLAERIDEDYPESEKSSEYKGTSRATTPIGNMNVLDTEAFSAMLNLKGG
FT                   KGTETTSQGSRPSPPDGGIEGIPMDSKFLRELLEVYEEQSGRGSKNIFGGNTMKEICIN
FT                   VSKDQEGSRCIQRKMDSISREEISWFFNNIVEAASELSANLFGNYVVQKIIPLLTEGER
FT                   TILITKLVGQIHLLSVHPYGCRVVQKLVDVSSDVDFILEEVKGNLLELIEDQNGNHVIQ
FT                   KCIEKCKDRKIILQQFSENSLFLATHKYGCRVIQRMLEFCKKDEIKGIVEVLIGNIKTL
FT                   VDDQYGNYVIQHILAVGKEEERNLVIERIIEKSYELSKCKFSSNVVEQCVKLSNNGQRE
FT                   QFLEKFLEPVGGKPGMYSMCTDMYGNYVVQRLYDSSGEGVRKEIKNTLRPFVKDLKKSP
FT                   FARHILFKINT"
FT   gene            <191338..>192555
FT                   /locus_tag="Eint_111630"
FT   mRNA            <191338..>192555
FT                   /locus_tag="Eint_111630"
FT                   /product="putative amino acid permease"
FT   CDS_pept        191338..192555
FT                   /codon_start=1
FT                   /gene_family="HOG000149463" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111630"
FT                   /product="putative amino acid permease"
FT                   /note="similar to ECU11_1740"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA40"
FT                   /protein_id="ADM12662.1"
FT                   /translation="MTKGLNNRDAIIAMILAMMGTGITFMPYAFKSAGYLNAIFLMMFF
FT                   GMGTAVSCYCISYAAKRSGQNHPTYSSLASDISTTLGYAVNISIFFNGYLAGVNFYRYL
FT                   SDLIVKNSYYIQNLTGDYEKSRKAVVLALSIPFLYLSFKKTLSGLVFTSYLSIASVLYL
FT                   SFLMIYLFLVVGTSSVGGKARPFNGSLEEAVPFFISSMVCQANMVKIYTEMEKKGNRNI
FT                   VIVSLGAAVGGMLINCFIGLFGYLVFGNGVSGEIITELSDMDSPINKRLREGWDKNNIM
FT                   SGMAIYGIMITLFGGYPVQVNPVGDMIFKLLPLERRTEPNRKAMVVLLWFVAVLLNLMK
FT                   ELKTKIIKKFLGATFSNSVAFVYPFIYYLSMRKTRSLVPTMVCCFMIIMSIVVSIYTVF
FT                   RFSLGG"
FT   gene            complement(<192594..>194264)
FT                   /locus_tag="Eint_111640"
FT   mRNA            complement(<192594..>194264)
FT                   /locus_tag="Eint_111640"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF5"
FT   CDS_pept        complement(192594..194264)
FT                   /codon_start=1
FT                   /gene_family="HOG000212424" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111640"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF5"
FT                   /note="similar to ECU11_1750"
FT                   /db_xref="GOA:E0SA41"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA41"
FT                   /protein_id="ADM12663.1"
FT                   /translation="MSESIRESTSSKTLSKDQMETSYVSLKTWIEDSLDLFKNDLLPLL
FT                   YPLFIHIYFDLIQQNKTNEAKEFFEKYRDDHYNKSEEIKQFESIYTVQHIHENNFAYTF
FT                   KSSKYHLSMGRYAFDLLINFLEERNLTYILKILNQHLDIKVYIGPKSEDRPQGIETSVV
FT                   DAEIDLTTFLVSKECEDAILGDEQYRYDHLETYVLQLRKQREMKPKDSAYKPNASQIHA
FT                   EIEKLKDLCKRVAVNKNNLPSICCYTIHNTYEGLTAAEISNDLKLLACGFKDSYIEVYS
FT                   LTNEPLKKLKSSSELAKSDIKTLNEEKFEEVGNSYKLIGHSGPVYGLKFFSSNKFLVSG
FT                   SQDCTVCLWSLDLLCLLAVYKAHAFPVWCVDAAPNDYFFASGAGDRQAIIWSVATSKPE
FT                   RLIISSLSDVTAVKFHPNSNYLFTGSSDHRIRMHDISTASVVRIFCGHTDTVTCMDVSH
FT                   CGKFLVSGSKDRTVLLWDIQSSKLLGKYAGHENTVFSVSFCFYGSVIASCGADNSVRLW
FT                   DRTDHKGSCLGTYYTKSTPLLCAKFGYRNIISCAGPFIS"
FT   gene            complement(<194453..>194872)
FT                   /locus_tag="Eint_111650"
FT   mRNA            complement(<194453..>194872)
FT                   /locus_tag="Eint_111650"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(194453..194872)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111650"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA42"
FT                   /protein_id="ADM12664.1"
FT                   /translation="MENTSKVQHLDGNRKKKKKTLKHLTILNSSRANKNKEHIPSIYEV
FT                   TIDLLVLIAIIVIVVAVIYFYKVFKDSSQNELGADSPTLISSSGGPHSFPRPPFQFEGN
FT                   PPADFPPPPSYSSLFGPDATPQPSYTYGPPPPYTP"
FT   gene            complement(<194950..>196563)
FT                   /locus_tag="Eint_111660"
FT   mRNA            complement(<194950..>196563)
FT                   /locus_tag="Eint_111660"
FT                   /product="karyopherin alpha"
FT   CDS_pept        complement(194950..196563)
FT                   /codon_start=1
FT                   /gene_family="HOG000167616" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111660"
FT                   /product="karyopherin alpha"
FT                   /note="similar to ECU11_1760"
FT                   /db_xref="GOA:E0SA43"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA43"
FT                   /protein_id="ADM12665.1"
FT                   /translation="MARSYMFDSKTTENRRKMREEQQVELRQQKKEELLNKKRNLSISA
FT                   STISNFIPMKEKLFSNDLEQAHQGVYEFRSLLSVEDSPPIQPVIDSGCVPRFIELMNIS
FT                   FLMSSEMTMSGIPISRIQQDMPEFGVAMDIINKIRVEAAWVITNISSGSTQQTKVVIDC
FT                   GAVPLLIQMLLDTNDAVLDQSVWALGNIAGDSEGMRDIILETGAIDTVLGLLQKLHESV
FT                   IHIKIVRNLTWLLSNLNRGRNPPPNEQNMKKSLEVLFKLINIRDPEVVSDAYWALSYIV
FT                   DVSMECGDIVIGSGTMSRTYSLLEALTNRLIGISYSSEDAKICLCAISPIIRMIGNIVT
FT                   GSDDQTSALIQMGFMKFFRPIFYRLENKKQPRLRKEICWTLSNITAGTAEHAKSVVDAD
FT                   LVPLLIDSMSSYELFIRKEACWAVLNLMYHCNNLPSSSDTKFEWLKTLMDNSFIDALQS
FT                   YLDVVPNVPEMQCQILDCFRYALNGGRQWELRYGKNPIYEKIVEADIVDAIEGLQDSSD
FT                   RTVSDKAYSIIVDFFDGIDN"
FT   gene            <196707..>198002
FT                   /locus_tag="Eint_111670"
FT   mRNA            <196707..>198002
FT                   /locus_tag="Eint_111670"
FT                   /product="cysteine desulfurase"
FT   CDS_pept        196707..198002
FT                   /codon_start=1
FT                   /gene_family="HOG000017510" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111670"
FT                   /product="cysteine desulfurase"
FT                   /note="similar to ECU11_1770"
FT                   /db_xref="GOA:E0SA44"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA44"
FT                   /protein_id="ADM12666.1"
FT                   /translation="MAGILKSLAGQSPSLKPALPPQIPPGNLVQKRIFFDAQSTTPVDP
FT                   RVLDAMLPFYTTVFGNPHSRTHQYGWQAEAAVEKARSQVASLIGCDPKEIIFTSGATES
FT                   NNLALKGVASFKLKEGKPVHIITVQTEHKCILDTCRNLEEDGVEVTYLPVGKDGIVDIE
FT                   DIRRNIKDNTVLVSIGAVNSEIGTIQPLKEIGRLCKEKKVLFHTDAAQGAGKIKIDVNE
FT                   MNIDLLSMCAHKIYGPKGIGALYVRRRPRVRMMPIINGGGQERGLRSGTVASPLVVGFG
FT                   KAAEICSKEMKRDFEYIKKLSNKLKSMFKKNIEGVIINGSSEGNPGCVNVSFPFVEGES
FT                   LLMYLKDIALSSGSACTSASLEPSYVLRALGRDDELAHSSIRFGIGRFTIPEEIDIVAS
FT                   KTVEAVKKLREMSPLYEMVKEGIDLSKINWAT"
FT   gene            <198202..>199215
FT                   /locus_tag="Eint_111680"
FT   mRNA            <198202..>199215
FT                   /locus_tag="Eint_111680"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT   CDS_pept        198202..199215
FT                   /codon_start=1
FT                   /gene_family="HOG000149198" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111680"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="similar to ECU11_1780"
FT                   /db_xref="GOA:E0SA45"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA45"
FT                   /protein_id="ADM12667.1"
FT                   /translation="MGYINMNSSSLIKPYDGVELNESGKKYKKIGEDMLKQKKLGVVIM
FT                   SGGQGTRLGSDAPKGLFKIKGKTLFEWHMETIKELISKYSADITVFVMTSSFTDEAVRN
FT                   YFQKEKGNFGLKIYFFKQKNSLCVGTDGKPLELYDGYAESPYGNGDIFKAIQQVNFEEV
FT                   EVLNVISIDNILARILDPVFVGAFYSGDYDILSKSVTKEEKESVGAFLMKEKLIIKEYG
FT                   ENDANGQGIQGNICNHLFRTSFIKKMKNVDLPEHKAFKKIPYTENGKLIKPEKPNGFKK
FT                   ETFIFDSFEYTEKNGVMNVPREKEFSPLKNGMDSTVDNPLTCALAVEKHRIQTSIQ"
FT   gene            complement(<199320..>200879)
FT                   /locus_tag="Eint_111690"
FT   mRNA            complement(<199320..>200879)
FT                   /locus_tag="Eint_111690"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(199320..200879)
FT                   /codon_start=1
FT                   /gene_family="HOG000149690" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111690"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1790"
FT                   /db_xref="InterPro:IPR018996"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA46"
FT                   /protein_id="ADM12668.1"
FT                   /translation="MSKDTVLEDYLNKDFDYTKLTKTQLRKIMYENGIEPIPPATSKKS
FT                   ELLRAYKENIHDRIDVLISRKKNISLENSFQNASPRKKYGFTEVPDVPETNNKDGIPNR
FT                   KSRGTSSSPGTPKKGERASKETPSRNFSLRDFSFSGDAPIQEKKDTLKETEEQDPSNQT
FT                   PGSTMFNNSTVDFSGSSLSSSFILSSSEERSSLSRRSEKETGNIKMKKRAFTSDPTLDK
FT                   PDFQSKHSSPRSMSSNSTRINISRPRPQRRKGKWCFATLLMIMVSVGIYFRFVCPYCSG
FT                   DKLPCIPPPRHSRIVDGRLVCDKGFMVRHGIFKDYCIKDDRREKKMEKKVKELRKILER
FT                   RSGDFMYRMAPTKSIPIELLTKDSEVIERLKKEVGIIISNEMIYSVNSRVSVKTFFRYY
FT                   FKRILMISIPLSIVVVVIRVIRMFRRKKQERLQTARKIVKDIADVLVRQIYVSTKNTSF
FT                   PSYVYIEQLRDCFGVDKKIWKEVEDIIFKNSNIRESCVEGRKAWEWVGPILYKPEFNGS
FT                   LF"
FT   gene            complement(<201035..>201688)
FT                   /locus_tag="Eint_111700"
FT   mRNA            complement(<201035..>201688)
FT                   /locus_tag="Eint_111700"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(201035..201688)
FT                   /codon_start=1
FT                   /gene_family="HOG000149689" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111700"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1800"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA47"
FT                   /protein_id="ADM12669.1"
FT                   /translation="MNPAKLLRTDCPALYAAFVVSPIVGYVPQILARDILLSPLISTFF
FT                   IMTNILKIFHYSFERYSQFLLAQYVFTIILHVFLIAINKRPLSTYEAKILGNRTMRVIY
FT                   RRYGPKGSVLGIICVFVFSINLYGTLYGSYEHCGRFSSVLEIAVNLFQLVLEREEKTFE
FT                   SPKKETKRSPKEVYFCWIIGDVIKIWLMSSIKAPIVFVGTIAIQIFINLFLILS"
FT   gene            <201786..>202664
FT                   /locus_tag="Eint_111710"
FT   mRNA            <201786..>202664
FT                   /locus_tag="Eint_111710"
FT                   /product="farnesyl pyrophosphate synthetase"
FT   CDS_pept        201786..202664
FT                   /codon_start=1
FT                   /gene_family="HOG000149197" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111710"
FT                   /product="farnesyl pyrophosphate synthetase"
FT                   /note="similar to ECU11_1810"
FT                   /db_xref="GOA:E0SA48"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA48"
FT                   /protein_id="ADM12670.1"
FT                   /translation="MIKEIVKRKVLQLSDYYNKSEILFLLDYNLEGGKELRYKAYIHVL
FT                   NALNGEMNEKNLTVGYTIELLQAALLITDDLMDNSEVRREKPCYYLKRGTKVIKDAFFL
FT                   LGVIRKMIDKRMKRPYSYSIFKTCIGQTHDTIRKTRAEYNIEAYTAIAESKTGAYTFYL
FT                   PAIFGYISAKKKEPEYLWDFCNLGALIFQMQDDYLNFFPEKSGKSMNDLEEMKCTWFTS
FT                   KISQMKNPAVERYFSKGEVSSDLLSIVKDLFKEYSFTLDKLLARLTFVVDENGKKVLGV
FT                   FISFLEKRALV"
FT   gene            <202885..>204162
FT                   /locus_tag="Eint_111720"
FT   mRNA            <202885..>204162
FT                   /locus_tag="Eint_111720"
FT                   /product="hypothetical protein"
FT   CDS_pept        202885..204162
FT                   /codon_start=1
FT                   /gene_family="HOG000149196" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111720"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1820"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA49"
FT                   /protein_id="ADM12671.1"
FT                   /translation="MNKPNIFGSQPQQGAFGAQQPGGMFNPSSSTGFGGNGQGFGSQGF
FT                   PNKQDQSIGFGSQQPQAQPTSLFGKPASIQPSGNTSIFGGQSTLQPSTDLFKPQTAVPP
FT                   SSGVFGSHQASNTFGTQFQPQTSNIFGAQGAGVGQVTNPFTTSAQNSLSVGTQSAPSQG
FT                   TESSGIGSISGVGTSQPLGGIPGLKPQATQAGGNNLQASNPFANTTSSMAPATGIQNNS
FT                   PSFAAPMQAPHIGSNETFNSQASPSTPDTLGQALETKDSSSSGRKARTPASVFNQPVGE
FT                   KGVSFIQMTLGEIIQQQTRKLEENIRVFKEKAKEVFEQDERIIRSLNNYKLIRNKIEEE
FT                   ERVIAETEENVDFFEKWLCSFQEEVPEGTGDELLTCIREFERVCDKYNKTIETLKDEED
FT                   EVMCLVNENYNLITTIEEKLELLEKY"
FT   gene            <204294..>206288
FT                   /locus_tag="Eint_111730"
FT   mRNA            <204294..>206288
FT                   /locus_tag="Eint_111730"
FT                   /product="DnaK-like protein"
FT   CDS_pept        204294..206288
FT                   /codon_start=1
FT                   /gene_family="HOG000149195" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111730"
FT                   /product="DnaK-like protein"
FT                   /note="similar to ECU11_1830"
FT                   /db_xref="GOA:E0SA50"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA50"
FT                   /protein_id="ADM12672.1"
FT                   /translation="MEFVGVDVGNYKTVIASSKDNGKVYGDEQGKRSIKTIMELSMPIR
FT                   RFGNSVTNDTENSLEVRSRSFRDSLSDKKDWGNFGMFMKYIDRVVKRNTPTHPPVCMTI
FT                   PVYFKEKERRTLVDIANAMGFKLEGLVADISGMGMFACVRREGMPSQFLLFDFGYSKST
FT                   AGIFSFEKNVFKPLYTKAVKIGSMQFDEKLIDIIIEKHSLEKSQLIRERVKRNLDKIKT
FT                   TLNSTKCCSIQLFITENPLEVVVTQDEYKEAVETYLNDLGSFVDSVMEETKFDGLIEVV
FT                   GGNSISFLIKNMLKDKIKYQSTLDVSDASAIGAALGLACRSLRARYLLHDIVGREISIK
FT                   IEGEDVNPTVIFSPTELIEGNPKKITYNRKGSFGIEILEDGEVISTLEIQKMETEEPKA
FT                   IHVSFSIGKFGTVCVTSVECEDSVDYKYKPFGLSEIDMDDIKALEIKYRDEELGLERIG
FT                   AMRNELETMAVGLGDVLYSRFGDIISEDELNTVKEVAMDLFDMAQSETVAQEEEVRNSI
FT                   LSRFEFVSKKLSDYEDAVSEDLRKHKEAIEEFKRENSKVFTPSFYKLQGLLYKLDEYLK
FT                   TFDLNLFNVESFDGNFITEVKSDIQKYLEKAKAEVEEKKREAEKEKEKEDEKTKEKSEE
FT                   DTSDDSKNKKESESKDNSHEESDVASIDE"
FT   gene            complement(<206350..>207045)
FT                   /locus_tag="Eint_111740"
FT   mRNA            complement(<206350..>207045)
FT                   /locus_tag="Eint_111740"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(206350..207045)
FT                   /codon_start=1
FT                   /gene_family="HOG000149688" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111740"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1840"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA51"
FT                   /protein_id="ADM12673.1"
FT                   /translation="MLFNTFLILGSVTAIAEYYNQNLIPYIDRISNREAYSDYNGESSM
FT                   ISVSESNLLEAGENNASKETIVGEKSKDLDFSTLDSSKAESPAGAIKSLRIGKFKINPE
FT                   SINDLIHREMADMSPDLHNKIVNTLERNNVDHRRYRDLFLIKKRVIDDGRRKIINFNIK
FT                   EKIIPKDGEENLPVTRDFGTRALLGGILFLLAGLVFTTTLKMYQSLIQKNYFGFEEKGE
FT                   MFPETKQTS"
FT   gene            complement(<207143..>207457)
FT                   /locus_tag="Eint_111750"
FT   mRNA            complement(<207143..>207457)
FT                   /locus_tag="Eint_111750"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(207143..207457)
FT                   /codon_start=1
FT                   /gene_family="HOG000149687" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111750"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1850"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA52"
FT                   /protein_id="ADM12674.1"
FT                   /translation="MLKFIISLLTLIVSTMTLVVSLMNNQNKTIDIPHTKGTGGSEMAM
FT                   PSESGSDDNNTGEVLDQQGSSLVSRSGLSPFKISANHFLRGRHSGLASKGPISGLKNRN
FT                   "
FT   gene            complement(<207504..>208001)
FT                   /locus_tag="Eint_111760"
FT   mRNA            complement(<207504..>208001)
FT                   /locus_tag="Eint_111760"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(207504..208001)
FT                   /codon_start=1
FT                   /gene_family="HOG000149686" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111760"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1860"
FT                   /db_xref="InterPro:IPR005606"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA53"
FT                   /protein_id="ADM12675.1"
FT                   /translation="MEKKINEELLKKEFASQEDLRNHVSLIQTMIRDYEKDLYERGEYD
FT                   DLSKNKVKDWRNKVYRIIQEHKETSESMENIDELENTIKLVHRQIGKADSNQQILGKST
FT                   LKLMGLNYTNTDIEKALMDTRKKLKESQRQEKIEGFLVLAALLVFILVCILILFDKFVS
FT                   GR"
FT   gene            complement(<208089..>209492)
FT                   /locus_tag="Eint_111770"
FT   mRNA            complement(<208089..>209492)
FT                   /locus_tag="Eint_111770"
FT                   /product="putative sugar permease"
FT   CDS_pept        complement(208089..209492)
FT                   /codon_start=1
FT                   /gene_family="HOG000149194" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111770"
FT                   /product="putative sugar permease"
FT                   /note="similar to ECU11_1870"
FT                   /db_xref="GOA:E0SA54"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA54"
FT                   /protein_id="ADM12676.1"
FT                   /translation="MIESIKKLNRKFLITPKILYFFVNLQYYTLHQFRGVFAKKKFGAS
FT                   DGDLAKYMGPMLGTIFFTNIFIGTMNDKFGRSHLFIVGALLLTCALLQLFYVDLYVGIF
FT                   PGMFWINFLLYMAFNNGIPPLLDKAVLDYLNGIPEAGARAYGKQKLWGTAGYGLSCKVI
FT                   EKCIKFGDDFKFENLRYYSLVTTAISASLVFLLLKSPASEGRAVRRDITANCKELMRNR
FT                   SYLFFILMILLNGITRQALSIYHTVYLTDVLQIKGYDLPDTWPSWLQSLVGFFNESPVA
FT                   TTTMCGMVFEVIMLYNFPAISKRIGLVWPFFIAQLFQILRVGCYFVLDYDDPNVFLYCC
FT                   LIELTRGVYFGLLQPSAVQLAMNLCPPHLKSTSQMIYHGTFTALGSLATSLVFGNLFSE
FT                   DKMKGKDIPIEDRAANYKLFFFVNICFASVTTGLFVYKYFILDRISRHSTDQEKKAIIE
FT                   SQEEGVANK"
FT   gene            complement(<209740..>211122)
FT                   /locus_tag="Eint_111780"
FT   mRNA            complement(<209740..>211122)
FT                   /locus_tag="Eint_111780"
FT                   /product="putative nucleoside transporter"
FT   CDS_pept        complement(209740..211122)
FT                   /codon_start=1
FT                   /gene_family="HOG000149194" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111780"
FT                   /product="putative nucleoside transporter"
FT                   /note="similar to ECU11_1880"
FT                   /db_xref="GOA:E0SA55"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA55"
FT                   /protein_id="ADM12677.1"
FT                   /translation="MDLLSRLNKKYLLGPKALYVAISMQYYTLHKFRPLFAKEMFGIGE
FT                   SELGAMGILLFVTFFTNILLATMNDKFGRPKIFMVALLSLSCIFFQLFYIERYFKGVRS
FT                   MFWINLFAYLGTNTPIMALLDKIVLDYLNKFSDENTKAYGKQRIWGTAGYLISIFALEG
FT                   IIRTTNSKSGIDFSGLRYYSLATTIIAVILVATLLEDSKSECRGPSYNIMSEWKELLRN
FT                   REYLFFILIIFLNGFTRAAMTLYLPIYVKYVLKVKPYILPASWPAWVRSSLWALNNFPF
FT                   GTITMFEISLEIGILFYFDIVSKKTGLLWPLLLSQISQTIRFVLYLILPPTNPHVFAFC
FT                   CMFEIFKGINFGLSHGAGVQLAEKLCPPHLKATSQMIYNGAFTAISSVTAGLYFRYVFR
FT                   NNETLDPEEIIARRIESFRIFFMSNILVTTISIFLFLIKYGVRDKKPLNVLFFCRRISQ
FT                   KA"
FT   gene            <211308..>211904
FT                   /locus_tag="Eint_111790"
FT   mRNA            <211308..>211904
FT                   /locus_tag="Eint_111790"
FT                   /product="hypothetical protein"
FT   CDS_pept        211308..211904
FT                   /codon_start=1
FT                   /gene_family="HOG000149685" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111790"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1890"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA56"
FT                   /protein_id="ADM12678.1"
FT                   /translation="MEKKVKAGLVNSVLISIIIILGIIITHLSFYNSLRDMIFKNPENI
FT                   ILMNKRDIEKNIYGDRMKIQIPPESLSEEMWAGFESLCTNAIIIVSQGDYVKVFNIISR
FT                   KMNQYKHNEYIKHLESIGNYLFFLNNSNYSIRNFLRDSLGYDGRNVIEDSPMIYGCLIL
FT                   PNTDGGLKFMSKSKIMDVNCNWENIMGYIYLDQNM"
FT   gene            <212000..>215011
FT                   /locus_tag="Eint_111800"
FT   mRNA            <212000..>215011
FT                   /locus_tag="Eint_111800"
FT                   /product="hypothetical protein"
FT   CDS_pept        212000..215011
FT                   /codon_start=1
FT                   /gene_family="HOG000149684" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111800"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1900"
FT                   /db_xref="GOA:E0SA57"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA57"
FT                   /protein_id="ADM12679.1"
FT                   /translation="MEKAEMNIEAGLMERLSSKNWKDRQEAYNMLGSFWKEGRAVEPEV
FT                   VQMLQSEGNIPALEAAIDALLNVNNLKVGDVKKIFGNIGNSKTSIKTRIDALIGRLEDT
FT                   EELMDALCEILDSKSPRNVSGALSAICNVVRSRGCGLKPIGERIGEVMGHADKGVRNEG
FT                   FKLCIELYKRNGELLLPYLSNLKPIQQKELMEEFGKCNLVEEKEDKKELVGLSGDLLKG
FT                   ASDDNWKVRLEAMRGIKKIARCVEYNSELNSLLCRRIGDVNNQVFYTTLEVLGELKPRN
FT                   IEIIKGLVERLKEKKDVTSEKIKEILFKVGVRISGSNAEFLGHKNPQVRLNLLDYSLRD
FT                   LQNDKEFIKMVGNCLLDPVGEVRNKAMEVVSEIHKKYGNIFEGTVTHNALPRINKIIGN
FT                   NSKKEAGDGNSSGLEKKTTPERRMKIEDPDTRDSKVLRGKKSTPSNHTRENSKDVALSS
FT                   REDDSASKKKHSKVGMDVLLNNISRQRAKGSGNREEIFTPQFIQMMDKGPFHQVYDLFD
FT                   SIDKTIVSDFLIDFLIQSNASEAFINSTLLSFISNKYILKEFECKKLVEYLLSNGMSEE
FT                   LGMMDRVYPVTKLFLVYQKIGNKEANNEILKLVRKYRMFRGDKKQFIEGIKKRGKTEVE
FT                   DAIKGCPDFLSFVDELEGSFMSTGNEDCDDVKIEKNFEKTSDEVGSQKSEYIEKVIDGE
FT                   EIDMEVPSIHDDSFVVGDADIEASFEALSIHSVSGVFTPNSKKVRKEVIPPEKQRREVS
FT                   GLELVLDHLIDSNPGVSEVAFKRLMNIIDSEIGSLLSFSNSIVSSISIQLFDVLHNPSF
FT                   SDLILQVFFKLSQNKLFCGQLRKETLLSANTDLVKIMKRQNTKDYNAKVSSPGFFSRDT
FT                   SLIGEILINLCLNSRPSLVLEVYLEMLVSSKEEILLKLIWRHSKSLKMDDREELSKVLD
FT                   VLMRFYDSNYHSILSEDNVTLKILQLHLKEMVKFYRKDIYEFGIRGLAKVFVGSMIGNT
FT                   ESIHRRETKKVDSN"
FT   gene            <215097..>215918
FT                   /locus_tag="Eint_111810"
FT   mRNA            <215097..>215918
FT                   /locus_tag="Eint_111810"
FT                   /product="U3 small nucleolar ribonucleoprotein"
FT   CDS_pept        215097..215918
FT                   /codon_start=1
FT                   /gene_family="HOG000172063" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111810"
FT                   /product="U3 small nucleolar ribonucleoprotein"
FT                   /note="similar to ECU11_1910"
FT                   /db_xref="GOA:E0SA58"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA58"
FT                   /protein_id="ADM12680.1"
FT                   /translation="MNRRKRERREYLLQKERERFDKEMEGKKQKLDEALESNTKIPHDI
FT                   KKDAATLLNEMIYEGKIEEEHRLPKIMVTTSRSPSSQLLHFSKHLSLVLNGENVIRGQL
FT                   CEEEISDLAHKHEYTCVIIIHENRGRPSALAVSYFPFGPTMRFTIIDHFLTRRSHPLSP
FT                   KMYFVCDNMEGPVGIKIKEKMALLFPRCDGAKRIVSLVNRNDTIAFRHYLIEKGDKTTL
FT                   SKSLGMDLRAYEIRKGTFEVDGEFEWAYKPYMNSRRTREEIGRAPKEQLKL"
FT   gene            <215976..>217019
FT                   /locus_tag="Eint_111820"
FT   mRNA            <215976..>217019
FT                   /locus_tag="Eint_111820"
FT                   /product="endoplasmic reticulum membrane protein"
FT   CDS_pept        215976..217019
FT                   /codon_start=1
FT                   /gene_family="HOG000149193" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111820"
FT                   /product="endoplasmic reticulum membrane protein"
FT                   /note="similar to ECU11_1920"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA59"
FT                   /protein_id="ADM12681.1"
FT                   /translation="MNNDLLLGQILRVPPITRCMVLLITMVSLLVYVDAVSPYSLYYSP
FT                   LFLRKFEVWRIFTSFLYFGKPTLDMFMHVVFLYRYSRMLEEGCINTSEYFWLVLVISST
FT                   LFAISNIYGISALGTSFSSTITYIWTKRNPRAIVQIFGFISFPAFYLPFILPGFMLLTR
FT                   RSISIDDVLGIVVGHLFHYFKDIYPRWGRDILKTPCWVKKLFKEHPSGCCKTQKGITIR
FT                   EGREKYKRNIENGNFAKTDENNEVGLIDATDPEINKVDDEYVGEESPSQSCTESLREKD
FT                   LSIAFSQRPSIVSSTVMTSSIGPEENCLGVVEACSSKEPVAGNDPESRSNEEWDEKWGE
FT                   SDNESTG"
FT   gene            complement(<217109..>218848)
FT                   /locus_tag="Eint_111830"
FT   mRNA            complement(<217109..>218848)
FT                   /locus_tag="Eint_111830"
FT                   /product="transcription elongation factor Spt5"
FT   CDS_pept        complement(217109..218848)
FT                   /codon_start=1
FT                   /gene_family="HOG000149682" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111830"
FT                   /product="transcription elongation factor Spt5"
FT                   /note="similar to ECU11_1930"
FT                   /db_xref="GOA:E0SA60"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA60"
FT                   /protein_id="ADM12682.1"
FT                   /translation="MAKRPGSKYISIEASEEDSELSHEDLDEVQESVVPRRDWTKLTKE
FT                   LEEKYGSIPEDEEIDEEEEETVEHGIKQANLVPRNTSPRLFIVRVKRGSEREILMKIVE
FT                   NDPKNIFSIVCKDGLKGYLYVEAFQKQHIIDALESLRGVSRNRVSVVPPKEMIEAMTYH
FT                   EQKICGEWGRIRKGKYKNDLVKIIEYDEEMVRIRAVPRIDGEKKLFNPDNFKSGSVIKS
FT                   RGYYVYKRDTYVDGFLEKDVLKSSVDFDVEPTFEELEEFQQICPISVGDKVRVTRGELI
FT                   GVKGIVRSINGSIAVVEGKDGKFEIQSTGLVKNFDVGEMVSYKGENGVVVKIDKKSCII
FT                   AIRDFTEELKVNIDDLKGPVTASPKKERPSGIERKKVRRDPLINKEVQILSGEYKGHSG
FT                   IVKEVDRSICRIQLNSNMKFVLVEKDHIITPSREISSRPLRYNESIVSRTPGYKTPGYR
FT                   TPGYKTPGYKTPSIYASEDVGMDWLGEENNPYRGTLIRVSEKELILEDYKDALFITKEK
FT                   TFSFSEVSFVQPQKNDLVCVLDGEKKGTCGILIAINGDFGVVRSTKGPVVHLPMDQLSR
FT                   KIY"
FT   gene            <219212..>219760
FT                   /locus_tag="Eint_111840"
FT   mRNA            <219212..>219760
FT                   /locus_tag="Eint_111840"
FT                   /product="U3 small nucleolar ribonucleoprotein"
FT   CDS_pept        219212..219760
FT                   /codon_start=1
FT                   /gene_family="HOG000149681" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111840"
FT                   /product="U3 small nucleolar ribonucleoprotein"
FT                   /note="similar to ECU11_1940"
FT                   /db_xref="GOA:E0SA61"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA61"
FT                   /protein_id="ADM12683.1"
FT                   /translation="MRVSISIPHNPHKDTTALQKELLDIIPNSYGGDPDERSEVIIRIV
FT                   EDVGPQWIVFKDEKIQLVLKIVQYKSRDYLRVSKPISKDHPPQLIVNNFTTDIGMQVVE
FT                   FLAGMFPFHPSSRQVVNFTVQGDFIYFRLYRYCFGEKSPIMENVGPHLTLRLWKIIEYS
FT                   GNEKKVMNFKKFIKNSSIL"
FT   gene            complement(<219808..>220896)
FT                   /locus_tag="Eint_111850"
FT   mRNA            complement(<219808..>220896)
FT                   /locus_tag="Eint_111850"
FT                   /product="septin-like protein"
FT   CDS_pept        complement(219808..220896)
FT                   /codon_start=1
FT                   /gene_family="HOG000149192" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111850"
FT                   /product="septin-like protein"
FT                   /note="similar to ECU11_1950"
FT                   /db_xref="GOA:E0SA62"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA62"
FT                   /protein_id="ADM12684.1"
FT                   /translation="MSQQTNMKNIPTIVRNLGTINIKNRVGFSSVPDQVRESSMARGFE
FT                   LNVLAVGRRGLGTSTLINSIFAAPLVDKKRPNTITVTRNEIVENDISLDISIVTYHELD
FT                   ISPVLDYINAMNREYFDNEQGLYKTFKDNRIHVCLYLLPSDTLTDQEIKNMYELSQCCN
FT                   LVPIIPKADMYTPDELACVKESVKQILSENNIFFFVPYFNENDGDLTEEITDIVENMPF
FT                   AVIASETMYEHGGEIVRGRKYIWGFINIDLEESNDFKRLQRLLIYTNLDELVTKTNHMF
FT                   YNTYRKKIFDIEKDCGAMKEARYLKLRTETIRILNDKYESRIKALREEEIEMERFYNEK
FT                   LSEGGHEINDLGKQVEKSLQVE"
FT   gene            <221113..>222102
FT                   /locus_tag="Eint_111860"
FT   mRNA            <221113..>222102
FT                   /locus_tag="Eint_111860"
FT                   /product="hypothetical protein"
FT   CDS_pept        221113..222102
FT                   /codon_start=1
FT                   /gene_family="HOG000149680" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111860"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_1960"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA63"
FT                   /protein_id="ADM12685.1"
FT                   /translation="MELNRIKELQKERKWMQFCNAIIDSMDSFPLNELLDAFLESAGQI
FT                   HPRSSYEVFLAFSERLNPEEGIRVLALGEETIRNSVLYSETFEVEKMFLEMKRCLLLIE
FT                   IGELRGIEKKLFEWKGFRMPKNVRIMYNFFGFKLYQKIQNVEEAFSHLLRYVNLSGSEE
FT                   LMDCLVEYALLSKEFFNFTLITSLPGFDKMNNRDLKEIFLMFREGNVERLEEKYGKFTE
FT                   IFGSNADVVKEKAYMIALINICFSEAEKKVSIKKVEELLKIPNKMVIYIILKSFGLGLI
FT                   SGWIDGEKGILYFDSLIPRALQKEEIQKLKEKYEIWEGKVQEIVAMLK"
FT   gene            complement(<222103..>222945)
FT                   /locus_tag="Eint_111870"
FT   mRNA            complement(<222103..>222945)
FT                   /locus_tag="Eint_111870"
FT                   /product="hypothetical WD40 domain-containing protein"
FT   CDS_pept        complement(222103..222945)
FT                   /codon_start=1
FT                   /gene_family="HOG000149679" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111870"
FT                   /product="hypothetical WD40 domain-containing protein"
FT                   /note="similar to ECU11_1970"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA64"
FT                   /protein_id="ADM12686.1"
FT                   /translation="MKYKLTAILKIHNSWIKSLDIDPYDALLASSSMDGTTRIVDIGTK
FT                   QLLATIPLKSVCEEIKFSKIHPYTFCALLDGLIKCYDLVDREFIREYYGHMSSVLCLDT
FT                   YDRRIFSGSSDCTVRVWDIRARNDVSVMKGHSLPVTHVMFDNGFIYSCSMDGSVRLWDE
FT                   RSNSTAIAAFPSSVTSMCTCGGSLFVSTGKKVFECKDGSYEIGLGLNALSLGSYSDSHY
FT                   LVGSEKCIFIKSRMKGGPDYQLETAGPANVLKTTANKEKIISGGVDKNIEFLEKDQHI"
FT   gene            complement(<223003..>223959)
FT                   /locus_tag="Eint_111880"
FT   mRNA            complement(<223003..>223959)
FT                   /locus_tag="Eint_111880"
FT                   /product="caseine kinase 1"
FT   CDS_pept        complement(223003..223959)
FT                   /codon_start=1
FT                   /gene_family="HOG000149191" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111880"
FT                   /product="caseine kinase 1"
FT                   /note="similar to ECU11_1980"
FT                   /db_xref="GOA:E0SA65"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA65"
FT                   /protein_id="ADM12687.1"
FT                   /translation="MRGEVMGYDIHYEVGRGGFGTVYKVRKKVDYKTYALKIENNTART
FT                   RRRAMVDEIQAYRELQGCDGIPHLVDYGFYKGLAFLVLPLFRYSLKDVLERNPKFFTRK
FT                   SATILGKKLLSIIELIHGRGRLYRDIKPENIMFDHNNKIYLIDFGMSMPYLEDNGDHIP
FT                   ELRGRSISGTLWYMSINTHKGVEQSRRDDIESLFYLLILLYKSELPWVEVGISMSKRQK
FT                   TKTQKVKESLSIHELCDGISGKEHLIKFFEYVRRLEFLEKPDYRYLNSLLDKVLCYKKE
FT                   FWNYKETDSGEIKESTGLIAVSLWYKLISILCPFSIE"
FT   gene            <224156..>224683
FT                   /locus_tag="Eint_111890"
FT   mRNA            <224156..>224683
FT                   /locus_tag="Eint_111890"
FT                   /product="ubiquitin conjugating enzyme E2"
FT   CDS_pept        224156..224683
FT                   /codon_start=1
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111890"
FT                   /product="ubiquitin conjugating enzyme E2"
FT                   /note="similar to ECU11_1990"
FT                   /db_xref="GOA:E0SA66"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA66"
FT                   /protein_id="ADM12688.1"
FT                   /translation="MKPTNLVMGEAGSDSAAIKRIKKEYALLENDKSDEKKKDSTSKYI
FT                   KIIPFVSGDLFTWEAYLTAPEESVYKGGIFKLLITFSNEYPFKPPKITFQTPIYHPNIN
FT                   SSGMICIDILGKEWSPALTLNSVLLSLLTLLDDPNADDPLMPEVADIYKTNKEEYRLRC
FT                   QESARKAMENRK"
FT   gene            <224773..>227850
FT                   /locus_tag="Eint_111900"
FT   mRNA            <224773..>227850
FT                   /locus_tag="Eint_111900"
FT                   /product="chromosome segregation ATPase"
FT   CDS_pept        224773..227850
FT                   /codon_start=1
FT                   /gene_family="HOG000149190" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111900"
FT                   /product="chromosome segregation ATPase"
FT                   /note="similar to ECU11_2000"
FT                   /db_xref="GOA:E0SA67"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA67"
FT                   /protein_id="ADM12689.1"
FT                   /translation="MPGFKDGNVVSMELENFQTFRKISLKFCPSFNFIAGPNGSGKSSI
FT                   ANAMVLAFGGTPRIIGRGKSIGEYVKFGENEARIKVVVWIEGRETKISRHISKDNQSKY
FT                   FIDGKACRKMEYEELIGRLKENIGNLCQFLPQEKVSEFTRLSPEDLLVELLRAVGEEEI
FT                   VEKLGRLEELETGRNKLIDMLDSCVRKKECVKRAIEVLEKDVEKASEKKRKEERIRMMY
FT                   EKQDWIRYKFYTDEYASIKKDISSLKKQVEEKKEESLKIENKIMELRSSEIYSESDRLC
FT                   NILGEYDENLVHLVERLRSVQQETEILKVDEESLKNKKEKRTVNAERLEKEILGLQDEI
FT                   SKVEVPPQPPKLDEARIGVLEEKMSNLMRIRGKIQHESSELKKLVDDLSLKKKKFHEMD
FT                   EMRLQMLRRYHDDTYKAVCWLRENKHLFKDEIIEPPFVQLRIKDARYSLEVENFLGFQS
FT                   LSPFICKSGKDFETFVRIMKDEKKWMINAIEAIKMNEGLHKGEESVPRETLKELGFEGV
FT                   LSDFIECREEIMNYLIVAGHFDQIPVSKENVDEGLVFRKTNVKKMAAGGRYIEIKKSRY
FT                   GSEHAIIYNPLKPRNLFSESLSLQELETIEEELSKKNSTRRENEEKLREILKDGEVIDK
FT                   ELQGLYKERSWYNSQMMEIKRKETQIRVLKGSIDRKGLELKMLLDAKGLDEEEDRIKEA
FT                   RRVLEVKWKKECDKLSEYLSEKEYFDVFRTAAKLFREITNIKKDIELFSESKKTLEEIS
FT                   EELEKKIIEKKKENFKLKKAIGEKKERLEKIEKTEEYDKALSLLPSTMDELDEEIIKEK
FT                   AQLRFYNIDHKALGEFEIREQDVKDLEENISEYSKELERTEKEGTNIRSILVSRIEEMV
FT                   SRIDEQFKNLFRKAGGDGKIVFVHEGLDACKWRLNIMVKFRESDDFEVLNSHRQSGGER
FT                   SVSIILFLLAIQNYRPSPFRLVDEINQGMDKENEKLVHDILVALSKEGKEQFFMITPKI
FT                   APNLSYSRNMKVIVLYSSPGCGDQEDFVKYRLKVLT"
FT   gene            complement(<227921..>228331)
FT                   /locus_tag="Eint_111910"
FT   mRNA            complement(<227921..>228331)
FT                   /locus_tag="Eint_111910"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(227921..228331)
FT                   /codon_start=1
FT                   /gene_family="HOG000149678" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111910"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_2010"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA68"
FT                   /protein_id="ADM12690.1"
FT                   /translation="MNPFMKEEHLQDIRKKVTAELTEIKRATLEKMRQRLREAFDLIPT
FT                   EVKGLPFLSLIEGLERNYTGKAVILKKNEGIVSRRTPKDVKKRPSVMLQVEDQSFIFDG
FT                   DGLKVVGPWNGKEYKGMVEEINGILKKHITKL"
FT   gene            <228414..>230069
FT                   /locus_tag="Eint_111920"
FT   mRNA            <228414..>230069
FT                   /locus_tag="Eint_111920"
FT                   /product="kinesin-like DNA-binding protein"
FT   CDS_pept        228414..230069
FT                   /codon_start=1
FT                   /gene_family="HOG000149189" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111920"
FT                   /product="kinesin-like DNA-binding protein"
FT                   /note="similar to ECU11_2020"
FT                   /db_xref="GOA:E0SA69"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA69"
FT                   /protein_id="ADM12691.1"
FT                   /translation="MEKAPIQAYIRIKPGKSILKYTDRTVLVSKECGETVKYEFDGVFG
FT                   PSSTQDQVFERFRCIVPKLIKGHNQTLFCYGSTGAGKTHTMVGHSKSHGLMYNLVKDVL
FT                   THGGFLVSYMEIYNEKIYDLLDPKELVLRECNGTIVIPGLFTKRVESIEEFEEMFRRGT
FT                   KNRTTAETRLNKSSSRSHGILRIGVGEHKLNLIDLAGSENNRKTGNEGIRLTESNSINR
FT                   SLFVLGKVVNAILKGEKRIPYRDSKLTRLLQDSLGGNSLCYIIANVVGDLSSLGDSINT
FT                   LSFASKSRSIVNVLETIPRNKSLKNKGKGSSNAAERRPLSLKTNMKFNIQRENDMIVRK
FT                   REKENSSNQESLLFGLFPREAPGENGKKRKKAQSTDKKQEEDSRKCISKTDKSKHPKSS
FT                   GQTTNGSSLILKTLLEKPDIVLSPRTKEKSYRAFLKRAQELELAQKYRLALEDYKTMQK
FT                   FCDNDFIRQKIEKIGILLKKSRKKPEVPKEDVLEILNRGNFFDIKKLPKVGDKRAQAIV
FT                   DFVSGGNFFETLSDLKLLFSEKIVNSILLSIDGR"
FT   gene            complement(<230169..>231290)
FT                   /locus_tag="Eint_111930"
FT   mRNA            complement(<230169..>231290)
FT                   /locus_tag="Eint_111930"
FT                   /product="Ste12 transcription factor"
FT   CDS_pept        complement(230169..231290)
FT                   /codon_start=1
FT                   /gene_family="HOG000149188" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111930"
FT                   /product="Ste12 transcription factor"
FT                   /note="similar to ECU11_2030"
FT                   /db_xref="GOA:E0SA70"
FT                   /db_xref="InterPro:IPR003120"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA70"
FT                   /protein_id="ADM12692.1"
FT                   /translation="MNAQSDKELFEFLSNAPKEFRDGERIKKFQLKNGDYIHCVLWNMH
FT                   FFITGTDIVKILVWRFQNAGRCLTSLKKFEEGVFSDLRNLKPGIDATLEGPRSEFLEFL
FT                   YKNGCIRTQKKQKVFYWYSVPHDALFCDALERDLRRETNLFTYNKYINNLTRNSMLPHG
FT                   MVGFVSHTRQNSKRMGGDVDPRYLRGIENKVLPMGMMYSQGRTMPQQDILFDQQMQKKT
FT                   PTAPSVPKSSPNIYDKQFEEIQKNGFLEQAFPAFNIKDKLFSSGDQQLEYDLHRTDGLC
FT                   NDLFSTAIIEKPSVNLDAASPKRSKDYNIAPSSFLEDLPDGFSLDDFDFLKNRAEKRGR
FT                   EDETRSSLKEGANQRIPHDGVTLIPNAKGSLQK"
FT   gene            <231767..>232378
FT                   /locus_tag="Eint_111940"
FT   mRNA            <231767..>232378
FT                   /locus_tag="Eint_111940"
FT                   /product="hypothetical protein"
FT   CDS_pept        231767..232378
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111940"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA71"
FT                   /protein_id="ADM12693.1"
FT                   /translation="MRALKCTCILSIKTILCIRGGFALFEFEDPPEDNLERFNGMTSMK
FT                   ILEFIKEQMEDIEQAVDDIINKSEERNEEEEDEDEEVDEMMEDEDGFESSKQKSILCEN
FT                   CSWATQTLEPCDICKEKRTLKELAYGLVCIGETLVSGEVQVWEVNEKIQFLIESILVKA
FT                   IEEEKQEDTVSIMNIRTSQAAVVQAIVFLESLVGSLDIYS"
FT   gene            <232414..>233019
FT                   /locus_tag="Eint_111950"
FT   mRNA            <232414..>233019
FT                   /locus_tag="Eint_111950"
FT                   /product="hypothetical protein"
FT   CDS_pept        232414..233019
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111950"
FT                   /product="hypothetical protein"
FT                   /note="similar to NCER_101283"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA72"
FT                   /protein_id="ADM12694.1"
FT                   /translation="MYPPNYPFPNRTMKTKIKSLVIENLKYKVSKDQVIKILKSENISL
FT                   KAYNSFLFKILLELRNQFEVIGPTKKFNVGTFLDKEFLQGDLLLENRRKREEAQRNDTL
FT                   FEKENIPTKYYANTMHLSYRLLGKMITKDEVLERFKECSTILGLNRDIGEKCAEHLEEG
FT                   LQTYILRTVSKCNGRTTVPNLKTSLEKYLRLFNGLDMF"
FT   gene            complement(<232997..>233695)
FT                   /locus_tag="Eint_111960"
FT   mRNA            complement(<232997..>233695)
FT                   /locus_tag="Eint_111960"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(232997..233695)
FT                   /codon_start=1
FT                   /gene_family="HOG000149677" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111960"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_2040"
FT                   /db_xref="GOA:E0SA73"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA73"
FT                   /protein_id="ADM12695.1"
FT                   /translation="MEAFGLDELALVRNGIANGLRADLRKNGEARRTNVVHTDIAQSDG
FT                   SIKIRRGLSEIEVSVQFKETAETLEASGILKENFDGNEFSAESIEFSKIAIPNTISSII
FT                   LDLLAPYKIGIRIEFSILSNDGNIFDLFFISLGALLENLDIPIVGNLKETEKQKISIPT
FT                   SKTVALFDNGHFVMDPTRIEEEASCGLIHIFSNNEGILMGCFCEGICNFEEKTLSSIIQ
FT                   EIISKTYLIR"
FT   gene            <234113..>234913
FT                   /locus_tag="Eint_111970"
FT   mRNA            <234113..>234913
FT                   /locus_tag="Eint_111970"
FT                   /product="hypothetical protein"
FT   CDS_pept        234113..234913
FT                   /codon_start=1
FT                   /gene_family="HOG000149548" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111970"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_2050"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA74"
FT                   /protein_id="ADM12696.1"
FT                   /translation="MGHLWKTALDWAGVLGQNLRKEFDGNARLKDACSRIAREWSEWRE
FT                   GVEKTGVFWLGQRAGEISGRVMRLSDASMGLALEAAGIGRVWRGQREFQKRLNRMFRIP
FT                   QYYGGIRKSEGESGRDRRAGGLVQFRPSLMGMGWRVYSWIRRGFGVGWNDLDIEEIENE
FT                   QLSRIFEGMEGQGESGPWTEEGAADIHSLWKEIGGSGMSVVDIRNVSTVGSIGRRRLES
FT                   GFEVEIAGQKGGKWTRHVFVMQAVFERGADGRWSLGRLRWTRVG"
FT   gene            complement(<234935..>235303)
FT                   /locus_tag="Eint_111980"
FT   mRNA            complement(<234935..>235303)
FT                   /locus_tag="Eint_111980"
FT                   /product="60S ribosomal protein L35"
FT   CDS_pept        complement(234935..235303)
FT                   /codon_start=1
FT                   /gene_family="HOG000207749" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111980"
FT                   /product="60S ribosomal protein L35"
FT                   /note="similar to ECU11_2060"
FT                   /db_xref="GOA:E0SA75"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA75"
FT                   /protein_id="ADM12697.1"
FT                   /translation="MKIEASELRQLSVEQLEEKAREIKADLAALRQKKNSGDVGEDDIK
FT                   TTRKNLARLLTIRREKILEKLVDEYKGIPVHKLPNILRPRLNRAKRQALTKHQLRRKTA
FT                   RQRAKERKFPKVIFAYNE"
FT   gene            complement(<235387..>235599)
FT                   /locus_tag="Eint_111990"
FT   mRNA            complement(<235387..>235599)
FT                   /locus_tag="Eint_111990"
FT                   /product="Sm-like protein"
FT   CDS_pept        complement(235387..235599)
FT                   /codon_start=1
FT                   /gene_family="HOG000113395" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_111990"
FT                   /product="Sm-like protein"
FT                   /note="similar to ECU11_2070"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA81"
FT                   /protein_id="ADM12698.1"
FT                   /translation="MLDPFCFLKMYLNERVEIKTKTGDVYTGTLEGFDEHINLMLQSHD
FT                   VQNSAGRVLFLRGENILFVAMSPTL"
FT   gene            <235693..>236187
FT                   /locus_tag="Eint_112000"
FT   mRNA            <235693..>236187
FT                   /locus_tag="Eint_112000"
FT                   /product="MAF transcription factor-like protein"
FT   CDS_pept        235693..236187
FT                   /codon_start=1
FT                   /gene_family="HOG000155430" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_112000"
FT                   /product="MAF transcription factor-like protein"
FT                   /note="similar to ECU11_2080i"
FT                   /db_xref="InterPro:IPR015257"
FT                   /db_xref="UniProtKB/TrEMBL:E0SA82"
FT                   /protein_id="ADM12699.1"
FT                   /translation="MRYLEMSCISKTNKLFQKLQDINPQLNIEVEAYSCKSSRKQRGQR
FT                   DVEKPLRYLQSALGLRFPDYDFHGEPWRSFERKTLEEVLREVAYSISTTHKNSEDVKEF
FT                   VGFLEMILDRSINTGSCLIFSYKNRMGPFEDCFWYFSFLLFSKRQKRVVMLNAFMSRSD
FT                   V"
XX
SQ   Sequence 236244 BP; 68279 A; 50248 C; 47752 G; 69965 T; 0 other;
     tgtcatgtac ttccttctac ttctcctctt atttattttt tccttggaga atctttcttc        60
     tcttttcttc tttctttaac atcgagaaca atcctatcca cttcattttt ataatcactt       120
     ttatattcta aaaatctttc cttcactaac tttggtgtaa cctcacttcc atactttttc       180
     tctatgtcca ttagaaaatt atgatccaag taactaattg atgaaagcat acaattttta       240
     tatttataat ccaaattcac tggtttaatt ccaattctct agcatgtaac tttctcaggc       300
     acatcttcag gataaagctt ggtacaaata acttatccat actccttgat cttcttaaat       360
     tccttttttc tttttcccca aatcttacga ggatttaaca tcttaatctc ttccttagct       420
     ttgaacttaa aaatctcttt aagttcatca agtgttttcc tagactttct gagtattcat       480
     tttctttgtt agatctccaa atgtcatctt atccttctca tagtctttat aaagaggaat       540
     gaagttcaat gctagttttt gaaatctcct aatgattctt ttatcatatt ctcgctgtac       600
     tttgtcatag ggaatatcgt aagctagtta tcgtaaataa caaatggata taataccatt       660
     ttccgatagt tatatatcag gagaattttt gaatgcttct cttgctattt ctttttttcg       720
     tcttttcctt aaaaaatcta taactttatt cctcttatat agcatccctt attatgaaac       780
     ttcttctttt tttcggccta gttctctctt cctacgctga ccctctctac cgcctcttcc       840
     ttccggacct ccaggatcca cctcatccac tcatagaaga ccttctttgc catccccttt       900
     tctccagact ccaccgtgtc gctcagctct cctccctcaa gttttttttt ccccatggca       960
     acatccatag ggctgcccat tccagaggtt cttctattgc cgcttccata tacatcaatg      1020
     ctctcaacca gaactctcct ccgacttccc gtatctctcc tctccaatct cttgcggttc      1080
     aggttgctgc ccttctccat gatattggcc atggccccta ctctcatgtc ttccaacgag      1140
     cctattcctc ccattgccct cccctcaaac cctggtctca tgagcttcag tctactcgaa      1200
     ttgcatgcca tctttttaac gagcttcgtc ttgtttctaa gtacaacctc cctaacgact      1260
     ttttgtatgc cgtctgtgat atgatcctag gaatctcccc gaggcggcat gctcgcaaat      1320
     acggtgcatc ttctcatttc agctcttatg ttattttcac cattgtcaat ggtgatcttc      1380
     aagattctct agatgtggac aagttcgact acatgagacg ggattctcga atgtgctgcc      1440
     acccctccta tgctcgcatt gttgacaacg ccgtttgtga aatcatcctt aactcgcgta      1500
     ttctcaacga tcgtattgtt tactcctctc gtgcagcacc tgctcttgca gtttttgccc      1560
     attgtgttta cctcaattac cgctaccttt actatcatcc ccatgcccat ggtcttaacc      1620
     tactgatcca ccgcatcttc gaagaactca taccccggca ccctcatctt ttcaaccttc      1680
     gagatctcca tgcctttttg gctcttgatg acaacctcct tgatggtttc tccgacatcc      1740
     atccagacct acagtccctt attggaaggt tccatgccag gattccttac ctctttcttg      1800
     cttacagaga ccttcccgac tcttctgccc ttaataatgc caaacaagcc ttcctccatg      1860
     ctctccgaga ttccccttac attcaaccat acgactacgt tcttgattct tgccacttcg      1920
     ctcatattat tagaaatcct ctgcacacaa atatcttacg ccgtgttgtt ttttatgacc      1980
     tttccgaccc cgaggagtcc ttctttctct tccaacccta ccttcaggac cttctaaatt      2040
     cctctccctc cgagctcttt ttctcatcta aagaaatcta ttactctttt gctgttccct      2100
     tccatgagac ttgtattcaa cttaggctct attgtacgtc acaagatcct aaaaaatctg      2160
     ccctccttct tgaaattttc aaccacgctc ttcctcttga ttaaatccta atctgatttc      2220
     tgccttcttt tctcaagcta cttcctttaa acttatcttt ataattaatt aattttcaaa      2280
     tatctccatt tttttaaccc catcaagaac atgaactctc acgaaactcc agaaacaatt      2340
     tggaattcac tataccacat tccagagagt actgaaaaaa aaatacatca ggtcaaggat      2400
     ctatacaacc gatttatttc acctatgtcc actttgttcc cttctctcat atttcttatt      2460
     ttttcggaag gaaaggtcag tggaaacctt tttctccgat tcttggtatt tattcttcct      2520
     ctctcttact tatcaattca ccacttcagt ttgtttttta ccaccaaaaa attggaagac      2580
     aaatctccta acgtgtttca ttctttcctt aagattctct ttctttcact ctccataatt      2640
     tttactcttt caattatttt atttcctatt agaagtttga gtaataacaa tctgaagaaa      2700
     gcagccaccc ttttccttcc tcgtgccgta ttatcgacct atttgctgtc tatctcttgt      2760
     agtcttgagt tgatgtcgtt catagatact gaacaagatg ctttacttga cctagcaata      2820
     tttatatgca tcataacaag cggagtaatt ttcagcaaat ttgagaagat ccatctcttt      2880
     ttgtttgtgg tctcttcttt cattcttatt ccattaagat cgttgaaaga aaaacacaaa      2940
     ccctctccaa aaagtactga agttacacta tggagacaag ctttatttgc tctaattctt      3000
     ctcatcatta taaccaccta tatattctca gcatatctat gcatgttcaa tccttgtgcc      3060
     caagaaagta ttccttctta gttggcaata aatgatgaga cttaatatat cttggaggca      3120
     taaatctatt ttacttgcta atatagctct caattttcca cttacgtcta ttataagctt      3180
     acagaaatat atccaaataa ctagaaaatg gctaggtgtt gttggcaatt aattacccta      3240
     agataaggca aatcaataat attagaatgt ttgatagagc tatggattaa tatacttgtt      3300
     ggtttaaaat ttatttagat acgagtcctt agaaacattc aatagttttg gtttctaaat      3360
     tttccaagga attccgggtc tttcctattc atatacttcc atacgaaaaa cattttcggt      3420
     actcttcttt ttcacttctt acagtagagt atttttatat atctttttat ctccgtcttc      3480
     taatacagct aacgaactca ttatttctta tatagaatcg gagcatcttc tcttcccact      3540
     ctccgcaatt ccgaattcct attctcttcc ccgcaacaat ctcaaaatct tcaacttccc      3600
     gaccctcctc tagccatatt cttgaactat ctccgatcca ctctttatta atttctttcc      3660
     gtgttattcc cattgcaata cacagcttcg atggaccgtt tccgatatct cgttccttga      3720
     ttcctccgcc tcgaagtttt ttcatttctg aaattccgca caatggttcc agagcccgta      3780
     ttagcactcc ggctcctgct tctatggatg aaatgttgaa gcattcatat tttccatata      3840
     ttctgtacac atagcatgtt cctgctttca tatacattgc agagtttcgt tctgttttac      3900
     gccctccgta tccatggcat gctttgtctt cctgccctat atatgcttcg gtttcaacta      3960
     tcattccttt cattgtcttt ccatttatcc tcctgcatag tattttacca agaagctttt      4020
     ttgcaagctc agcacaagga acatccattt ccatctctac agccccaatc tatggatctt      4080
     ataattatag ggtactccga atcttacaca agccttcttg ggcttttaaa acaaagtaaa      4140
     cttgctaatg ttgtcttaat atcagactac atcttttaaa gatccaaata tctttggctc      4200
     aaaggttttt aataatgtcc ttgtatattt cctgtttttt caaactatct tttctaacac      4260
     tcctcgatgg tgtttagcat atttttcccg cagtagatat tatggattta cttctgcttt      4320
     tgatcatttt gtgtatagta ttagcctggt ccaattcatt actacggctt actcaacgtc      4380
     atcaatccct ggccttccca gttgcgacag gagcacctga tctttaaata atttctcaag      4440
     ttcttcccat ccaacccact cggaatcgct ttctcttttt agatcattcc ctcggagatc      4500
     aattttctcc agcatctcat gatcgaagag tctttcaaca atctttctac ttagtctctg      4560
     tatcttatta tctctcatat caagcttctc aagatagtgc atcctgcata ttacttctgg      4620
     tatctcttca aacaaattat ttcggagata aagttttcca aggtttaaga actttctaaa      4680
     tgtgttgggt aaagtgcgta gcttgttgca ttctgcatgc aattcatgaa gacttagcat      4740
     cttctccatg ttaacagaca atctccgaag attgttgtta tttattttta atcggaagag      4800
     ggaccgtaga ttcccaattt ccataggtaa ccaggttatg ttattgttgc ttacatctag      4860
     atcccaaagt tgaagcaatt ttccgatttc cttgggaaga aacgtaattt tgttgtcatt      4920
     aacatagagt tttcctagtc gttggaggtt acctattctc gaaggaagtt tatgtatttt      4980
     gtttctctga aggttgattt cagttatatg tgaggagtat ggtacattaa agatctcgtc      5040
     aggaatacta gtaagtcctt gatttgaata gtcaaatttt cttattattc cagtatgctt      5100
     agctaatgaa tctctttgtt gggacgattc atcatcgcac ctaataaata ttcctgcaac      5160
     catgatcgta ataatcattt tagggtttgc attcatccca ggaatacaat tctctttgga      5220
     aatgacatga gttaatgaaa atcgagagta ttacgccata tcaatcttca agcaattgaa      5280
     ttcgatacgt caacatagag aaccttattt ttcctgcaac cggtcttatg gtgcaagaaa      5340
     accaaagaac atggaagaag tacaataaga tcgtttataa ttgaattgat tattttgtgt      5400
     tcctctttgg ggttagaaac agaatgaaac tttacaaaag gtaaaagatt gacgggttag      5460
     attaaataat ctggcttccg tcattctgca tctctgttta aattgttttc atatgaaatt      5520
     ccgtaaacag atatttttct tctgtcattt gtagatttct gctttttact aggaaggatt      5580
     attcccgtgg tagacatatg tctcatgttc ttacttgcgg ggagaatact ctgttgtact      5640
     ccatttcggc tgtcatgaat cttattaagt tctggagaca catccttgag cttgagataa      5700
     gaatgatttg ctaatgacct ggcgtctggc cttataagat ggctgggttg aagtgccttt      5760
     agcagaaact ctataagcat atcatcgtcg tcttgggagt tacattttga cctgataatc      5820
     ttcttcatgt cttctagtgt aaagttagat gctggcccta taaatctgta tccgttttcc      5880
     ttttcaaaaa agatgtttga atttttccca tgctctatca taaacatagg taaggagcca      5940
     aaaagaccat agattcttcc catttggtcc atgttatctt ttcctggaaa caatggatgt      6000
     ccaacataca gttcatatcc tatgcaacct agggaccata tatcgcagct tgatccatat      6060
     ggaatcccaa gaatcacttc aggagcccgg taatatcttg attggacata gaagtgcgat      6120
     ccttgggggg aggttactgc agatccaaaa tcgataatct ttatcttgaa ggtttcgtaa      6180
     tcggctatga ggatgttttc tggcttcaag tcacaatgaa tgatccctag cattgagagc      6240
     tggatcatcc cttcaagtac ttgctgaagt atagttctaa gggtgatatg gtcaaagccc      6300
     ttgaatcttg tcatttttaa aaatgtatat aggtttttgc caagtaactc ctctacaata      6360
     cacaaatgtt gtttatacat gaagacatcc ttaatcgaaa caaatctatc gtttaggtta      6420
     ttataaagca gtttgtggag aattcggacc tcgttcattt cgtagttgta gtatttcggc      6480
     tgatttttga ccaccttgat agcaacttct tcaccttcag gtcctacgca cctaacaacc      6540
     tgtccaaaag ttccagttcc cagcatatct atgaccatat atctctgggc tttgtttttc      6600
     gacaaataat ctcctcgaga cattacaaga tcaaactcta cattgtctga ggagaggcct      6660
     accttttcag atggaaaggt caaaactttt ttgttcatct cctaggaaaa aaggataatt      6720
     tcaagaaatt ttatatgctt aattattttt aattgtaata ctatgagaat attgatagaa      6780
     aatgattttt atagttttga gatcgcgggt tttttcctca gacattggca agaccctcgg      6840
     ttcgtaggtt gcttttatta agtatgaggg ctatccataa agtaagggaa ggcctagtca      6900
     aactctttac agttcctgca cattatttct atgcattcgt ctgaattaaa cttgattggg      6960
     cataccaggc tctctatttc ctcggaagtg acattaaggc acccctttct agaattcttg      7020
     gccttttcca tggccaaaga tagtttctca aacatcttgg gacaaaatat cgaagtgctt      7080
     ttagacttaa aagtaaaaaa tttacccccg tgttccttac gcaggaggcc tctatcgatg      7140
     acgttcatac ggagatagag agattgctag attggaaacc caaacgattg caattctaag      7200
     tctcgtgtct ttcgtggcat gagcaccctc tttcgtttgc aggaggcgtt atttttggaa      7260
     acagcccaag gggctttgta cagtaaggtt ttgctttcag ctcgctgttt tacatgtttt      7320
     cttcagaact tggagcctat caagacaagg agtttaatga gatccttcac aagaactacc      7380
     ctttttaggg aaaaacccag aactcatata aaaggattcc gactcggtaa tgtacttaat      7440
     cttgtaagtt ccggggctca actgtatctt tagatcctgc ttcaagtatc ctgttatggg      7500
     tggcttctta caagttcttg gcaaaaaagg cccttctttt atcatacctt tgcagagagt      7560
     tagtgtctca aatttctcta cataatcgct ccatttttca ctgtccttga gtcctacaac      7620
     tcctacctca atcgtattgt tggatttttt gaagtaatag atggtttcgt ttccatcaaa      7680
     ttcattcgct ccattgagcg agttaagcaa ctgattattt tcactcagag ctatagcttg      7740
     cttttctatt ttagaaatca ttttctttat gttgtaaagt ttatatcctt tacaatcagt      7800
     gagttctcta attctgtctt caaaagtata tccatcgacg ttctttttca taaactcaag      7860
     gcacaagttc ttgacctcaa gatacctgga agtttcgttt tgtctccccc tctgatcgtt      7920
     tacaaatgaa tcggctacat ccagtttttt gatctccaga agtctttcgt atattataat      7980
     aacaaatctg aaaatgcaaa gaagagggaa gtcagaaaca aaggaaaatt ccttttcctc      8040
     aagcttcttg aaaacagatt ctagtgccga attcacatta gacacaagta tcttctttcc      8100
     ctctgcctgg ttggctttta tgtaagcctt gcagatatcc ataacatcca acactacttc      8160
     ttggtcattt atcatggcct tcagtccctt ctctcccgtc tctacaatat tctttgtagt      8220
     gaaaatgctt ttctccgacg atttatacga tggtcctgta acatccagcg ctttgtgata      8280
     attcctttct atgacctctc tccatatctt tttcttttct ttcatgcaaa gtctaagctt      8340
     cttgttcacc atataaagtc ttttaattac aatcggtatt gctatgtgtg gcttcatcaa      8400
     aattccttcg agtatttcct gtgcagattt gccatagatg ctcttcaaaa tttccttaat      8460
     aattcctgga gacattttta tatctctcat gctaatttcc gagtctttgt ttgagctgat      8520
     tatttgctcc aaagcattta tgaaatattg agttctttcg acagccaagt ctgcttctga      8580
     tctttcgtct tcgatcctaa acaatgcctc ttcatgcaca tttcgcttca aaaacacata      8640
     gtttgaatct tccgattcga aggttgggca ccctatgcat gtgaaattca atacctccct      8700
     agctatagga tcctgtcttt cactctttat cttttctgga agaattctgt aggatccttc      8760
     ttttttgtac ttttcaaggc tcctcggtgt ttctcttaaa ggttctttgt agtttataaa      8820
     tgccttgaat cctcttatga gttcttcatt tttcaaaaga ggtgctacta attccaaaag      8880
     atctttttca ttaatgaatt tctgattaaa gtagttaatg cattttaaaa aatcatcgag      8940
     aagattctta cttttcaaaa gctccttgat ccggtgaaga atattttttt catcatacag      9000
     catatgtctc ctagacggga caaaatttct ctcaaaatcc tcgcataaat caggactctc      9060
     ccacaaaaga ctgttgactt ctgccttcat tttctcaaat agtccatttt tcacttgatg      9120
     agattgaaga atctccacaa aagacctgta aatgcttgga ttatgtgagt agcgtttttt      9180
     caccttctgg ataaaatctt gtgcttgtct tgccttcatc ctttcaaact cctctgttct      9240
     cctttggtca tagggtgcat actttccttc ctgcccagac atcttcatag atgaatgcat      9300
     aacaaggggt tgacttccat aactttgatg aatcccgtga tggggactta tatacgaagg      9360
     tccattgatt cctggctgtg gatggcccat tcttcctgaa gatccatata atcctcctct      9420
     gtattgcgaa gaagatccta tcccctgcat ttgtctatct gatggccgag caactgtccc      9480
     taccgaagga tttccataaa acttcaggtg tacgggtaag taatcattaa atatctcgat      9540
     gagatggggc ttatctctga atagaaccct gacagctctg caaacttctt ccgcatcaat      9600
     ctttccaaat ttaaaatctc tcattgtttc cagaaagttg tcataagtca ccatgtcatt      9660
     tgcatattcc tctttgattt tgtttaggaa catcattgca tcgctcaggt ctgcatcttc      9720
     gtgcgaggtc cttggaggag acgaccctgt aattcccctg gagacaaccc cctgatctaa      9780
     accagaatct cggcttttga ttcccatact agaagccatg tgccctccat cggaatagta      9840
     tcccctcatt ccacccctca tatctccttg atttccatat cttggtatac cctcatccgg      9900
     ataatacctt tttcttacat gcccaccgtc ctgccatgat tcactttctt gattactgag      9960
     atttttctca tagtctcttg gcataagggg tgcttttttc cgccaatttg ttttaacttt     10020
     ctacatatca ggtcttcaag tatgtttagg ccttcaacag aacaataaag gataagaata     10080
     catatgttat aagtcttgtt taatagaaaa tactagtttg tttggcgtac tcgtgagata     10140
     gattccctac aagtgtcaaa aatcctccat catcgcaatt aaatgaataa attacattta     10200
     caaaagggtt aatattatat ttaaggttct gctttgttct ttatttattt tatactcaat     10260
     tgtattaatg gagaaattct accacgacat cttcgtaccg ctgattccct tctttgctta     10320
     ggaacaggtg ttcaaagcat ttcctacaaa taaatttttt cttctctgga agaataggat     10380
     cattagctat ctttagtacc gcattatttt ttaggcagca tttacacaac tgtgctcttc     10440
     catggagatg ttttacagac acatatgacc ccattcttct ttgcgaaaag aacattcttg     10500
     tgatccggat tgaattcaga aatctcccgt catgaaaata gatttccttt gatatatcct     10560
     ttatgcattt atcagcctta aaatcccatt ttttaatatc aaatatcttc aattgaaaca     10620
     tcatggtggc aaactttata gaactttcgt caatattttt caagtaaatt gtcttttcta     10680
     tcacaaaaaa cactttgctt gtcagattat tactcccagt gagtagagct gccaaatccg     10740
     aaagaagagc ctcaccagac atagtgaata ttgctattac ctcttcaccc aaaaaacatt     10800
     gggcctcgta gtaaatattt tcagggttgt ccgtttctgt gaacgaacga ttgcattctc     10860
     caactacaga agtatcttca tatacatatt ccttaccaaa tccctctata aactctttag     10920
     gatacaatat cttgtggttg gtagaaaaag ttcgatccca tggaattgaa tatattctct     10980
     cggttacaat caaattgtat gctttcttac tggagatttt ccctcgttcc ttccattctt     11040
     ttggaaatac ttccagtgct cttcgaattc tatccatata atttttctcc attaacaggg     11100
     ccttccaccg aatgattgta aaggctgtca accacgatga tctctatgta gacggccagt     11160
     tccaaaactt agaggatcta aaatccaaga tataccaaag atatggcatc cccataaact     11220
     cacagcacat aatatttaat ggcaagtttt atgttttagg aatattcaat gctccattgg     11280
     aaacttcctc agacacatat tctaaccctc ttggatactt tggacttcca gacagtcttt     11340
     tcaacaatct tgcatccgac ggtataacac ccagtgaaat tagggcattc gcctttcccc     11400
     ataaagagga cttaaatgat gaagaaagcc cgagcctatc cgaagtttta gatataaaaa     11460
     ctgttgcaaa gcggattctt gaagttcaat acaatgaaat tcatggaata tcggagagtt     11520
     taaacgaaga agaaaaggct gcaattgtaa aaaaccctgg cgaatatgtt gagctagttt     11580
     tgaagcacac tggtggtctc ccttttcttt agttctaaat actaggattc tctattgaca     11640
     atattgcaaa agacacaact gcatcgtacg ataatcctcc aggaatatta ggctgtagaa     11700
     agccctctgg taaataaatt tccttcatag acttttctat tattcttgga agttcttctg     11760
     gatcaaagta atcattagca ataccagttt tttgtgtctt ggcctcgctt ttctcgtcca     11820
     agctcccgat ttgccttttt ctcgctggaa gtatgttctt tcccttatta gggccaacct     11880
     ttggaacagg attgagaata gaattatgtc ccatttcttg aatctctctt attctctctt     11940
     ttacaagaga ttcggttttg aagctcaaaa tctcaaacac aagctcttca aatctttcaa     12000
     gataattgtt atatttgaca acatccccat caaactcctc ttcttctctc ccaaagaccc     12060
     ttagaagagt cctcctgatc ttgcattcct tttcaacaat tatatcctca aaagttggct     12120
     taatatagtt tatctttctt agtaccgttc cgcattcagg gcaaggtgcc tgtcccctac     12180
     taaatatcct aagcatacag gattcgcaca tcttatgaaa gcaaggacct atgtatatca     12240
     ctatatccgg attcaaatag atatcgctct tacatacagg acatctcctt tcttccattc     12300
     agggtggagg aaagagaaat ttatttgata taagaataga catattgata gtgcaatata     12360
     attttattca agctccatat tcctcagttc ttatcttttc aaggagaaga ttatctccca     12420
     tcccagacct tctaaccgcc ccgcttatgt cgtaaatggt tgtctcccct gtcacctggc     12480
     catattgatc cagcgtagct aacacaatct gaactgatcc cttgtcggat gatggaatcg     12540
     gcgtctttcc taatgagcaa attcttcgtt caaaagccat tttagggttc ggtattttta     12600
     tattttaaat aattccaagt agatagaaca tattttacaa gacactatgt aatcatcttt     12660
     ttgtacccat ttcgctagat atcatgcaga agtccatctt caatgaagtt cccccaacca     12720
     aaaacccatc gacctcctca acatcaagaa cggactggca attcaacatt gaaaccgaac     12780
     ctccatatat tacacgccct tcgaaaccca cgctttctcc ccacttctta acattggaaa     12840
     ctacttccct aatttggtca tttgtaggaa ttttccctgt tcctatggcc catacaggtt     12900
     catatgcaat atcaattcca tctcccttga catcctctcc taacgaaagg agttgatctt     12960
     ttatcacatc caaatatttt ccttgttttc tgcacttttc ttcctctcct atgcatagaa     13020
     taactttcag tccttggctt cgggcatttc tgatcttctt tgctataact tcagatgtct     13080
     ctccaaacca tctacgtctc tcggagtgtc caattattac atattcagct cccatttctt     13140
     ttatcattga agcagagact tcccccgtat atgggcctcc ctcaaactga ctacaatctt     13200
     gtgctccaac ctttatatat tcaggaaaca ttttctttgc aaaataaata taaggaaaag     13260
     gtacggcaat aaatgtatcg ttacctgaaa agaagttctg ccggaagttc ttggctatct     13320
     ctaaggtctt tagtgatggg ttcatcttcc aatttcctcc aagtagttta tttttcttca     13380
     tttctgggtc ctggagaata aacaatttcg aacaaattat aaacgtatgt caataagacg     13440
     tgtatcaaag aactttttat tttatacaac aagccaatat cagaattctc ttttttaggt     13500
     acaatgtctt gagccaaata taaaattttt aaaacctagt cccaaaatgg aacagattct     13560
     ggagttagac aaggatctca acattgacat ctttgacgag gttgtgatga atgcaaactg     13620
     cccagataac agaaagaagg aggaggccga gaaggtacta ctgaaattca aggaacttcc     13680
     aaactcatgg acgaaggtgg attacatctt aaacaacagt aaacaccagg aaagtcatta     13740
     tgtggcgtta cagcttctag aaggaatggt aaagacaaag tggtcgttat ttgatgaggg     13800
     gatgaagcag ggcctcagaa tgtatgtatt ccagctggtg gttgagaagt ctaagaccaa     13860
     aagcaaggaa aactatgttt tgcaagagct gaacaccatt cttatcgaga ttgcaaagaa     13920
     agattggccc cgacgatggc ctacctttat aacagatctt atcaatgtgt ctcaaggaat     13980
     aagtatggaa gtatgcagaa atagccttaa tattctcaaa cgtctcaatg aggaagtctt     14040
     tatattttct gaggacagta ttacaactgt cagaaagaga gtcctaagaa atcagctaaa     14100
     gattgagttc ccgcaaatat ttgggtttat aaagacaatt cttgagtact ctcggaattc     14160
     cgagatggac gagagtctcc ttgaaacaac acttgaatca ttccagtgtt tctgtgagtc     14220
     catgcctctt aactttatct ttctcacaga gataatcgac ttggttctgg aacacttaaa     14280
     ttccatgcac agcgttgcat gtctgagttg cttgattgaa attgtcgacc taggaaggaa     14340
     cagaagcctt tctaggactc atgacataga aagtgcagaa aaggaaaaga ttcttattat     14400
     tcataagaga tgcattgagt ttctcaaaat gtattttaat aagttccagg aggagaggat     14460
     ttatgaagtg tacggaggta tggacaagtc agagaaagtt tttgtcctta aatttgccca     14520
     actcttgtcg tctttctatg aagtctacat agacttacta gaagccaagg atattgtaaa     14580
     tgcaaaggca gggcttggct atcttataca aatatccaag ataaacaaca caaacatctt     14640
     ttcgattgct tttgagatgt ggaataagtt tgtgtttgac ttatactcgg agtttccatt     14700
     tactagccag gattcctcga agagattgag aagatctaat tataccagta ttttgaacca     14760
     actaatggga actcttgttg acaaaatgcc ccggccagaa gaagtgttta ttgtggttga     14820
     cgagtacaac caggtaataa ggaaaaaaat gactgacaca gaccaaatag aattctacag     14880
     aaagatgaga ggatgcttat atcacctggc ttttcttatt gaggaagaca tgaagaagta     14940
     ttttataagt aaagttggac ttcagcttga tgataaagaa tgggactgta attatctaaa     15000
     caagctgtgc tgggccatcg gctctatatc tggtgcgttt tcggaggtca acgaaaggga     15060
     gttttttgtt aacatcctta agcatctgct ggcattgtgc gagatgaagt cctttaaaac     15120
     agacaaggca gtcatagctt ctaacatcat gtttataatt ggccagtatc atcggttcct     15180
     tcttcacaac aaaagctttt tgaaaaccgt ggtaaagaag ctttttgagt ttatggatga     15240
     agaccatgaa ggaattaagg acatggcttg tgataatttc tttaaaatag tagagaagtg     15300
     ccctgtagag tttctcactc aaagagaaaa tgacgagatt ttcattgtct acatattgaa     15360
     gaatctttca gtaatcactg gaaccttgga gttttatcag aagagaattg tttatgaggc     15420
     acttcttatg gtcatacggg aggttcccaa aacaagggat tataagtcta gagtcctaag     15480
     ctatgcagat ctccttcttt cttctcttct aaactttaat attctagccg atgagtatat     15540
     aaacagactc cccagcatga tatccaatgt agaagaggcc aagatggttt cacatgtcct     15600
     aaagtcgcat gcactaactt ataggcttct tccagaaaca tgctcttcca gttgcatcca     15660
     gatatttcca aagttctttg caatctttga tatctgcaac tctataacac ttgaaaggaa     15720
     agaaggaaca gcatttaaca atgccaaggc agtgaaaatg gaaataatcg agctgtttac     15780
     taccgtaatc gactccaagt ttgtacagga cggctttgta aatacggtct gcgagaaaat     15840
     tatttttgac tataagacta actcagtcta caaggaacct gcaatattgg ctttgggttc     15900
     aagcatagtg cggaatgtag agaatgatgg atctgttata tacctgcaaa gagaagcatt     15960
     tatgatttca tctttgatcg agccatccat tccctttgta atgcaggcag atgaaaatct     16020
     ggagatctct aaaaactatc tttatcttat agagagcatg cttcagtttt ccttcagctc     16080
     gttcttttca tctctgtttg ggcaaccctc ttttcgccaa gtatacaata ctcttctgta     16140
     ttctctaatc tgtataagag atgtctcgga tttgtctttg aactgtctaa ccatcctctt     16200
     taagaagtgc tatgagcaga agatcttcca gttttatacg cagaactaca tgtccactct     16260
     tgaaaacatc ctgggaataa tatttgacaa ggatatgaga tacaactttg atcagcagtg     16320
     tcttctcctt tcctttatga ttcgcataag caaggacatc ccaagtctcg atggcattaa     16380
     ctctaatatc aatatccttt cggaatacat cgtcggtcta tttgtaaaat cgtttccaaa     16440
     cataactcaa gagtctgtaa agatattttc cgtaggacta tttgagttat gtggagacga     16500
     cgaggtcttt aaagaacatg tggaggactt tagagtcaag gtttatgagt ttggcacaga     16560
     tgaagatctt caagaagaaa ttgatctcaa ggatgaaaga atcagaagat gcagaaatta     16620
     aaccagcttg ttgcttttaa tacactgtat ccaaaaggct cggacatcta ctcacaaact     16680
     attagaaaaa ttacagttga tataattaac aaacaacaat aaatgctaga tccgcgaaga     16740
     tcgagatctc tggctctttc tattagatct ccaatatctc cattgttgtg tataacctcc     16800
     tgggcgagct cgattttttt ttctatgggg agctgtaggg ccaaccgctc tttcagatac     16860
     tttaatgttc ttcccctttc tatctggagt tcttcatcac atgcaatcac tattgtgtaa     16920
     aaataacggt gaagatttaa ctcaaacaac aatggaatct cgacaaatat gactccatgg     16980
     cctgccaaca gcaaataaat tatatttttc attgtctcta tgtatatctt tggccttatt     17040
     cttttttcgt gagcttcctt gaagcccggg tcggtaaaga acttctgaga tatagtcttc     17100
     ctgtcttcgc tcttcagcat cttatggact atcctgtcac agttgacagt cccataacct     17160
     tgccctctca agatgtttaa aaaagtcgtt tttccagttc cggtgtttcc agttatagca     17220
     ataattctca ttcccaaggg acatcatctg cataagtaaa taaatagtaa ccctcaaagc     17280
     ttttaaaaga agtttttaag ttaaatttaa tatacttcaa ttaatcatct gattcctctt     17340
     ttgtccttaa gtttgtttat cttaagtctt tgaaaatcta gaagaactga caatcccttg     17400
     gtatcattga gtgcaaagtc ctcaatgttg ttgatgtatg ccattagaat ctccaggact     17460
     tggatttcct catcatttaa gtcattgggc tccaagcaca tcattgccat gtatgcaaag     17520
     ttctggtaga cgggcttaaa ttcgtcttta gccatcacta ggactctttc aagaagagca     17580
     acaagtatgg aagatgcgag atgttctaag caagatattt caacattgga aacaaaggtc     17640
     tccaggtttg actcagatcc cttgacggca atctcggctg cctcctcaat cagcccttca     17700
     gaaataagcc ctttgatttc gttctgctta ttaaaggaac tatggaggca atccacggct     17760
     tttttaacat ttttaagatg atcttcatta tgaataagcc ttatctcatt gatcacctgg     17820
     atcctcattt catccattgc tgcttctact gctggcacta aggtcccaag aataatcttc     17880
     ttaacacaat ccaaaatctt agactcgtta gataaatcac ttttaagctt ggattcgaga     17940
     ccgttcaaaa ttcctattat cctttccagt tcccctccag ataactcttg tgatcctgaa     18000
     ttcctttgcg attccccagg cctagctgat atttctatca gttttcggaa ccgctcgcta     18060
     ttgtctcttt caatcctatc catcttcttc tcaattttct cttggacctt caggatggaa     18120
     tctatctttt cactcaagaa cttaatctcc ccacaatcac tcttatcagg tatataagga     18180
     ctaaaatggt ccatagaaaa ttcttcctta gttagaacgc ttttttcttc cgttgtcctg     18240
     tgtccatctt tcccttcttc atggctcccc aagaataagt ttggacaagg agagctatca     18300
     agaagaggaa actttccact agcccgagaa tcattcttat ttgtttttac gtctccacca     18360
     tcaaatgaaa tgctatccat catttccgga ttgccctccg gaaggctatc tggaatattg     18420
     gctgaatctt ttgaggttgt gttaatatca tcagcttctt taggaaaaga tgtctcgtca     18480
     gctattattt cagatatttt cacaacattg tccttgaggc aaagacttat atataatgga     18540
     gacgtcttta gatcaacctc tctctccaca aatagatttc cattgcattc attaatcaaa     18600
     tacaaaacct ctcctacaac tacacctaca gtattaccta acggaaatac attagacaca     18660
     cgtttagaca ctgggatctt tagttggctg atcaagatat actcttcatc cagcaagaaa     18720
     gcccagagtt ctttctcctt tccatccaaa acaagaatct ttcctcctat ctcgcacatt     18780
     tggtctcctt gaaccggaag ttcttttccg tcttctcggt ggaacctaga ctcaacattc     18840
     atgaataaaa tcgaattaac atagaaaata ctgatgttaa gcttcgattt tattccagag     18900
     acgcacattc gtcctctaag agctcctcca tcttccacaa ccatgtttat gtacagaagc     18960
     tcattcttgg tggaaatgta gaagacttta ccagactgcc tggtgacttg aagtacattt     19020
     cttgaaatca cactcctctc ttcggcagga tacccattaa taaacaatga atattggagc     19080
     ttgttggatg tgtctaaagt tatgaaatac atcttgtctc cacttctgtg gaatattact     19140
     ttacgtagag gaaatggaag aaaaatataa ggtgacacct gcttagggtt aaacattaag     19200
     tctcttccat caaaagtgca gaagtagtaa tcattcccag cctctataat agggcatgat     19260
     gcaaacttag tgggatcaac tttgactaca aactcatact cgacttcaat ctttgaaacg     19320
     gattcttgtc catcaggctt cttctgttta aacaatgcct tgaggttttc attagacatt     19380
     cgtgttttcc tccttactac ttcttcaatc atcctgtcca tgagggcttt tcttccttca     19440
     gaaaaaatct tttgtataga acatttatta ttagaaatcc ttctaaatct atgatgtaat     19500
     gtaaggccgt ggctttccta cagatccagg aaagatataa acataaacaa tatcaaacca     19560
     tagatctaaa tatttacttg gggctaataa caatgtcaac aagaatagat cccatactag     19620
     ctgcgtttat atcttccttt cgtgaactac ctattcatga aaaagaaggc agaataataa     19680
     aagagagacg caagatgact tcgtctgccg aggccgaacc acacataagg cactccaatg     19740
     tattgaagtt catatatatg aaaatgcttt cctatgaagt aaacgagatc gacttcttaa     19800
     atgcctgcga atcagatatt ctaagaataa agactgccgg gtatcttggt ctgatggcca     19860
     tggaaagtga cgagtatgtt atcatggcaa taaacactat catgaaggac ttgggaaaaa     19920
     aggaaacaag aaatgacgca ttgacttcga tttgcaatct caacaatgat ggaatggccc     19980
     tttccaatct catgggacat gtttgtccaa aagggaaggg agatccattc cacaaaaagg     20040
     ctcttgtagc atttttccga ttgaatcctg gtggaaaaat ctctattgta ggtcaagatc     20100
     catccgaggt ttatgttaaa tcccagattc taatagatat ctttgggaag actggaaaag     20160
     ttgatctgtc tgaaaacgac atattatttc ttctttcgct ttttatgaag agtgataatc     20220
     cctttctccg aatcaagatt ttacaagttt ttggaatact ccattccaag aatcagttat     20280
     ctctggacag agcttttcta gacacaatcg atggggtgat aatccctcct aaagacaagg     20340
     tacgtccaca gatcgaaata gcattggcca ttgaggctgt tgagtttcta ctgaagattg     20400
     gaaagatcac tccaaaggca gaggcatttg ttcttcggct tatagagtca caaaatccta     20460
     actcaagata ttttggactc aagatcgtaa gaaggtacaa aatccataga gatatagcta     20520
     tagaatgctg cataaagctt ggtcttcacc acgaccaatg ccttaaaaca ctcatctctc     20580
     ttataacaag aaacaatcac aaaacaatat acaaaaagaa agaagagatg atattctaca     20640
     tggagaaggg aggagcaggc aaaaaaacgg tgaatgatgt attggccaca gtgttttcaa     20700
     agctcttgca gtatgtaaaa gacgaacata tgataaagat atatcaagaa gttccggaga     20760
     tatgcctgaa aatgcccttg gacaaaaaca ttcccaaagg ttatatgtta aaactattca     20820
     atagaatctg tgtgacggta aacagtaggt attttccttt gatataccaa ctgctacagt     20880
     ctggaatgga aaacgaagag ctttacacta caatatttga aagacatctc aatattttat     20940
     cagttaaaag aaacggaggc tgggagatct ccactttgat aagactactc gattgtatgt     21000
     tgaacttcgg atccttaacc cataaccgta atatactaat tgcaaaatat aaggagatct     21060
     taaaggagga agatacatcg gatatacttg acatgttatt gaacacagca tatttactca     21120
     acactaaact tggagactcg ataatccatg ttgtctcgga acattttatc tactttactg     21180
     tttccaagaa ctacaccatc gagtttagga cacctccaag tcttgagata aaacttctgg     21240
     ctgggaatgg aacgagcata gaaaaagtat atgaaaagct ttctgaagaa gctcggacaa     21300
     cctcttttca cattgaagaa tcctccaagc tgaatctaca agtgtttgta gggaatcaga     21360
     tccacatatt gaatctggag gtatgagcgg gcatactaac caaatttcaa acaaataggt     21420
     tttcccaaga taaaagggaa agataagaaa ctttattaaa gaaaaatact aatacacgat     21480
     cctaaacagc atcaaaagct cggagcctag gctgtgaagc tcttctccat gagcattttt     21540
     aattctttcc cttaagcttt ggactacttc cttggatctt cttggaagat agggacgaaa     21600
     cagatagttt tcctttatta tcaggtccaa aaggaaatca agagttatca ttcttaaatc     21660
     gtttgggaag aaaagagcgt atggcttacc tattcccttt tccattattg tcagcactac     21720
     aggaaaaagc ttgtctcgaa tttgctcttt catctgttca tcttcgtctg gtctattact     21780
     gtcttcgtca atgtccatcg gctcgactcc agtgtagatc tttaaaatct taaatttgag     21840
     atcttcatat gccaggtcgt gtacaagaat agacgcaatg ttgtagcatt tagacttgag     21900
     atggaaggcc ttgtcgtcag tcagtatcac aggatgaact tgcttagatg caaagttcaa     21960
     aatctcatca tcgttgttct ttgtgttctg tatcaacttg gtggtgtcca caagatccat     22020
     tgtactgtct ttcaatcttc cctctagctc ggttattgga gcattatata ccttctccag     22080
     aaatcttatg gcctctctgg cctccacctt ctttttcttg ttatagtcca actctcttag     22140
     gacaactttc gatatagaca taataacatc tacaggaaac tcgtcttcat agagtctctt     22200
     gattacttcc agatgtgata taaaaacatt tgtgtctgga acaatggaga tcctcagcat     22260
     taaagggtac ggaaacataa aacaaagagt ctttcgtcta tttttaaatt atctttcaag     22320
     acttatccat aatctcttta tatgtttttt ctttggctga ggatgatagc atactgtgga     22380
     agccacaaaa agggcatttc tcccatgcag atctacactt caacatactg ttgcaattac     22440
     tgcatctaat gacactcttg atttcctgcc ctgggtaaag aagctccatt tcaagaatat     22500
     gttcaacctt cttgttaata gtggaggtat cccctattgg ctttgagcat atgggacaag     22560
     tgtaagtctc tcttatgaat tcatcaaagc atctttgatg caaagaatgg ccacacctaa     22620
     ggagaactag aacctccatg cacccaagca tatcttctgc acatatgggg cagtttccag     22680
     aagtggtatt ttccacgtga atatggtttt ttgatcctgt ggctataagg catgtctgac     22740
     atatatcaca gtgaaaagca actttaggat ctccctttct gcatgcacta cacttgtcgc     22800
     aatgaaatat ttggtcccca gagctgtccc acaggttgca cttggagcag aagtacttag     22860
     atacgaccga aagacactgc gaacaggatt gtgtttttgg ctgtaatagg ttacagacag     22920
     tacataccat gtgactaatt tcatatctgt tcgccttatg tttctcggca ttgtcatggc     22980
     atagtctaca tggatatagg tttaagcagc attcgaatct aattaaacag gcatttgaat     23040
     agtgttggca aggcataaaa gttatctttt actctttaga tttattccat agatgagaca     23100
     tgttttaggt aagaaatggg aaattgcttg gccctgccat gggaaagttt gaactattcg     23160
     atttaggatt tgaaggaaca acagttagag attgccttcg gtttcaaaaa gaaaagacta     23220
     atgacgtaat attctttgat gataatggga tctatggatc cacatattct ggatattcgg     23280
     gcttgaagaa cagcaaatat atcaagaatt gtattcttaa taagggaagc ggggagtcca     23340
     agctcctgct tgaagcgttt cctgcagtat ttcgtcctac agataaacat atgccaaagt     23400
     tgaaggaaac agggatggca gaatttctta ccttaataga gataaagaaa catttctata     23460
     tcgattcttc tggaaaagca caccaaatac cttatactag aacagagatt gcagactcag     23520
     atgtcttaag tcttcgagaa aagcttttga ttgggaaaac acttaggggt ggaatggctc     23580
     caaatgagct ttatacttta ttatctgaaa agtcaagaga gatattaatt aatgggatta     23640
     ttggtgaaga tagagattac cttgaaaaaa tgtacaggta cataaggaac tttgggaaca     23700
     caccattcct gtatcctcag tatggtttca aggaaatatc agagatgttc tcaagatcca     23760
     attcaatgtg tggagccgga tatgtccttg acagtgcact aaaggttacc ggcagaacta     23820
     gagaatcgct gggcatgttc tctcccgaag aaaatgacgg agaggagatt ccttcggagt     23880
     acatgcacag aatcgacact acctatggaa caatttttac aaagaggatc ataagagcta     23940
     agaatgagaa gctaacagga tatgtaagag ttattaatac cagaagacca acacttggaa     24000
     aaaccttttt tgctcttgca ttaagagaaa ctctgatgaa ggtaattggg ttaaattctg     24060
     acactgactg ctgtccagaa ggaacctatc ttatatacat tatcaaaaag gacaaacctg     24120
     tggatgaaga agatcttaaa cttcttcata tggaagaaaa ggacataatt gaagatatct     24180
     catatcaaac aaaattttct tttgaatccg attctttgga tggatgatct tcctgtaccg     24240
     gataaaaacc ataaatttga atgtatttta ctgtttattc caatcttctt tatgcctgtt     24300
     tagccatata aaatgttgct gttcacccaa agtcgaaaaa aaactttcat tgttcaatat     24360
     actgttaaca tttttgctgt ttagatactc taaaatcacc aaacattgag gataagccag     24420
     aaatcttgaa tattttggtg atttccaata ttctagatac ttcaggtagc ttctgaactc     24480
     ttcagattca aagtagcctt ctcgagctag ccaccggagg tattcgggat tacaaagaag     24540
     ctggacaaat tccaactctc tttcaaatct tgaacctccc atggggataa atgaatcatt     24600
     caatatgaag tctaggaaga atgttcatag atatgagttc ttggaacaga agcttacaag     24660
     catatggcat ctttatcttt gctggctttg tgttcttaca agcaacacag cagcccttga     24720
     aggctagtac tccacacggt ttgcatacat aggcttcaaa catatccgaa gatatcatta     24780
     gtctttctat aatcagagaa gacgctccat atcctattaa acaatcgcgc tccatttctc     24840
     ccagcttaag acctccgtct ttgcttctac cctctgttgg ctgtctcgtg agtattgccc     24900
     ggggtccccg tgctctcatg tggatcttgt ctgctaccat gtgcttaagt ctctgataaa     24960
     atactggccc aaagaatatg tatgcagtta aaggagcacc agtcgtccca cttgtaaaac     25020
     aatcttttcc agagtaactg aatccgtgct tggccagaag ctcgcatgtt tgctcaactg     25080
     agttttcttt gaatgcagta ctatcaagta tttgccctga caacactcca gccttcccag     25140
     aaataagctc tattattttt ccaacagtca ttctagatgg aaatccatga ggattcataa     25200
     tgatatctgg agagataccc tgatcattga acggcatatc ttcttgccca acaatcaaac     25260
     ctacaacccc tttctgtcca tgcctactgc tgaacttatc tccgatctct ggaggccttg     25320
     tttggcgtag catagttttt atgagaatct gatcctgaga tttggtgatg agaaccttat     25380
     caatatacgc agggtctcct cgatgaactt tacctgtgaa tttatacact ccttccactg     25440
     gcgacatctt attcacatat acagtcccat ctcttatcat ctttccaggc tttcccaatc     25500
     catcatcatc taagacactt tcctttggat ttggcccgag gatatcagac aaaccattac     25560
     tgtgcttttt caacaaagtc gtaattgttt tatatacttc tactctgaaa agacctcttt     25620
     caatcgacgt cttgttcaag acaagagcat cttctatatc gtatccggag tagctcataa     25680
     cagcgaccat tgcattttgt cctgcaggta tttcattgta atttataaga tctagaatct     25740
     tggtagacac catgggccga tgagtgtatg tgagttgtag aatcacagga tcaaacctct     25800
     tcttaacatt cagggatatg tgtccaatgg cctgctttcc catggcacat tggtatgtgt     25860
     tcctgggact ttgattgtga tggggaaatg gcactagacc agctacatat cctagaatcg     25920
     caaactcaga aatctcaaga tgtgttgttt cttcgactat gtcttcaggc ctaagcgcca     25980
     caagacagtc gttctcttca ttaacatcaa ggtattcaac aaagccctcc tctaaaagat     26040
     cagaaaatga cttgtacttg agatagcaat caaaaaagga tctctcgctt cccatctcta     26100
     ttttctctga aatattcaag gcctcgagat acttgtcaac ttggtttgaa attatcatct     26160
     gatttatcct tcctttgtcg atcacaacta gtggacggca cactcggcca ttatcagaag     26220
     ctacgtggat aaccttttca gctggtaccc tgtaaatgga tacaaacttt ccaataagtc     26280
     cttttcttct gtttagcctg aattgctcta taagaaagcc cgctttgttg gtgatcccaa     26340
     cgatatcccc gtttagaaac acagaaaaca tatctttctg atgtatctct cttgtataga     26400
     cagagttaat atcaacaact ccaagtctga acattagatc cagcactggt cttgtatcgg     26460
     agttggttgt tatttccgcc agcaaagcaa gattcttcac aagaccacat gactctcctt     26520
     cgggtgtgtc aacagggcaa agcatccccc aagatgacgt atgaagagat cgaggaccac     26580
     tcaccttcct tgttttttca aaatgagagt ttatctttgt catcatcccc aatgcagata     26640
     tgtaggaatg ccttgacaaa acgtgcgtta ccccgcttct ttccatcctg aacctcttta     26700
     gattccagtt tcctgttgaa attgccctcg aaagagtgga tgtaatcata ttggcctgca     26760
     ggttcagaaa tgtcaatgca tcgaactctt gtgctctgga tcttttgctc aatatcttat     26820
     ctatcgattt ctttaactca aagttaaatc ttttgaatgt gtcttcaaaa aggatcgata     26880
     atagctgtcc agccagctca aacctcttgt tcccaacgaa atctttatca tcctccttga     26940
     gtatgttgag ttttgtttgt acaagccttc ggatcattag tgctatgtaa atcccttttt     27000
     tccttagatt acaaccttct gtctgaacat ttggcaatac tttttcagac agtatagtca     27060
     gaacctcttc tattctattg tcctctggtt ttaactttat atagttgctc atgtaaagga     27120
     gagcctggtc cttagtaaac acctcctttg atatacactc tccaaagcta gggactataa     27180
     tctcaaaata ctcttttcca atgcactccg ctatttcctt atcctgtgtc aacccaagag     27240
     ctttcattgc gattattgcc gggatctctt cgttgaacat cgaactcttc aagtagtagc     27300
     aatcatcctt gatggttacg gacgtcttgc tcttgtgttc atccgtggaa gatgtaacag     27360
     aagcaaatag cccttttggc ccggactcga taatgatcct gttctttgaa agttgttctt     27420
     gtattaatat cactctttca attcctctaa taataaaata gcctccaaca tccaacggac     27480
     attcctgaga ttctcggatc ttcctgtctc tggttttgtt actttctatt atgccctttg     27540
     cttcctttct tagatggcat ctgctacttc gcagcatcac aggcattttt ccaatgcaaa     27600
     tatccctttt aacaatgatt tgtctgtttc tgacatactc tatgtcaaca tagatattcg     27660
     cagaatatgt catgtctctt agcctgcact ctatcggaaa cacatcgtag ttaaccatgt     27720
     tttcctctat acttggcatt ccaacacgaa tgtccagata tttgagataa aacgtatgat     27780
     cgatgtctga atcgacaatc tggtttgctc ttacaagagc ctttatttca tggtctacaa     27840
     agtaatcgta cgactctata tgctgtctta caagtccctt ttccttaaaa aaaagcttta     27900
     tcagctcgag tctttgatct tccttcatct aggatgaacg ccaaaaattt tactggatat     27960
     agattgtgga gaacacgaat ttacatccga gtcattgcta agaccaagcc aaatgtcgga     28020
     tatttgtttt gtaaacacaa gcccagaaga tgcaaataaa agttaagaca atagctggaa     28080
     gagacttaga gcttactgtt gatcctgagg acactgttct agatctgaag caaaaaatag     28140
     agagcatcga gttgatccct gtagagcagc agaggcttgt aagcaatggg aggatattga     28200
     tgaaggaaaa agacacactt gccagcttga atataatttc tgggaatgtt gtccacatgg     28260
     tgttggccct taggggagga tagaggatac gcctgctcct ctatacggta ttaggaatgc     28320
     aaaataaact ttaaattgag tttaaaatgt ggaatctgat agcatatgca gtgggctgtt     28380
     tccggcaaaa ctctggtgca agagggattt gaacccccgc ctcaatgaga ctggagccta     28440
     attccagcgc cttagaccgc tcggccattg caccttctta gcaacgaaaa cattcccaat     28500
     agacaaagat aaaatcggca gatggaagtg taacatttgt tttctacaga tacctccata     28560
     aatgggagag aagatggctg aaggagcctg gatttctaga ctagattttg aggaggagtc     28620
     cacaagcaag ccgtattttt ccctggacat tatgagatgt aagatatgtc ttgaggtttt     28680
     ctatgtgaag caccatgaaa gtcatccatg tttttcaaag aacacggttg aacagcacca     28740
     ccaaaaggaa gaggacagag atctattgga agaatcttcc aaaagtgagg agaaaatagt     28800
     agacatgcct gaccatattt ttcaaaatca cgaggacaga catctggaag aggctctcaa     28860
     cataaaacct gtggttaaga aagtctggag gttatcgtat gtgatgttac tcgaaaggga     28920
     aaacctgttt tggatggacg gatagagatg aagaagaaaa aaatgttcat gtgctcatct     28980
     caaaaaaaca atgtagtata gcccattatg gataaggcat tgtctcagct atcggagacg     29040
     cttcggcatc caagtgatct acaaacaaag ctagagagta tcgaaaggtc caccagagaa     29100
     acatacgaac gccatgacca gaatcttaca ggaatgatct ccaggtgtta ttctagcata     29160
     ctgaacatat caaagaggat atatgcactg gaagagcacc ttaaagactt tgtagaaaac     29220
     aaagacagaa atgtacgggt tctagaggac tttttttctc ttgtgaaaga ctatagatct     29280
     gtaaagatga tatgcttagc acattcaaac ttatgccgag taattgagtt ttccgacaag     29340
     ctaaagggca tagaggatcc tgtggaatca gaggacattg ttgcatacca caccaaagta     29400
     tatgactccg aggattttgg atgccaatta gacatgtata acgccgggat atcgcacgac     29460
     gactatatcg aagtcaataa ggcactaaac acaatagaaa aaaactcatt agattttact     29520
     gcaaaagttc ttgaggtttg cgaagagttc attgaaaacc acgagattat gggtaagata     29580
     gttcagattg tcgagaagga agagtctcgg gacgaattaa cgagaaaagt tcaaaagggc     29640
     gaaaagagtg acgatccagt gctcaaggag ctctaccgaa tgtataaaat gtatgcaaca     29700
     agaaagccaa aaatgttaaa agataaggta gttaagtcta ttaaggtatc tgtgaagact     29760
     aagttcgata agctagaaaa cgaagagata tttgtgaaca agatggattt tgtattgaac     29820
     gacctgtcat ttatcaagga gaacataaag ctaagcttct atccatttga tgacattctt     29880
     atgctgtacc acaataacct gaaggacttc cttgacagga atacagaaag gctagacgcc     29940
     ggagaaatac tagctattgt agaatatgtt ggaaactact acgatactat tgaatctaaa     30000
     ttcaataaga tagccgatgc attggggaaa aggcttttgg gaaacgagac agaactcctt     30060
     gagaagtata caaggacggc acaggaaaag ctgagggaat ggattatgaa cataagcaag     30120
     attgaggttg agaagtttta tgccagaagt gaagagcttg ccagagacga agaagacaag     30180
     cttgtgagtc ctgggtttgt cagcctcctt caaataataa ggatgcagct tgagcctatt     30240
     gcattcaaca atagaatatt cgcacacata acaaggacaa ttacaaaata ttgtgaaatg     30300
     tttaaggaac atcttgttga agcaatggat aaggacttta agccatcttg tgaaatgaat     30360
     agtaaggttg gatacgaaga tttctgcatt atgtttggaa acagtggtct taagatagcc     30420
     cagtacatca cgtctttgcc atcataccat aacgatgaag ttaaggagct aggtgatata     30480
     ttcatcgata tcttaaaagc ttccaacaca tttctgtctg agtttattat atactcatgc     30540
     cagcctgcaa tcgataagat attcacagat gaatggtaca gggggaacat tacaaagatt     30600
     gtggttttaa ctttgcagga ttttctttcc gactaccaga acaccatgag cgagtactcc     30660
     tttgttacat ttattcacga gctttcaaca tctattgtat tagcttacat gaaacaattg     30720
     gggagaaagc gagccaccat agctgaggaa tgcaacaagg ttttgaagtc ggatcataca     30780
     aaattgtatg agctgcttag tgggtacgga gataaggaag atgtaaagac ctgtctttct     30840
     ccaattctca aggtcattcc gttgatggat acaagaaacg acgatctctt cattgtagaa     30900
     gtgaaatctt tgaagcttat atatccggac atcaaaagga gttttatcaa aacaattata     30960
     aagaaaaggc aagacctcac cgaggatcaa aagaagacac tcacagacag acttaaggaa     31020
     tgctttgtgg aagaggctag caaggaaaag acgattttct ctcgcttgct caatctgtag     31080
     ataaatgaat tttccaagac aaaatccgtt ttatttcttc tctttgtaaa gatacttctt     31140
     taaaaagctt ccaatcattg tgtttgaaga cgctttccct ctaacaaata agacctcatc     31200
     atttgcactt aagcttagga aaaaacaaaa tggagttgtc cagactagtg caaaatagag     31260
     gattatttct gctccgtaga tagagggatt agaaaaaatc aaccttatga caaggaaatg     31320
     gttgagaaga gaggcaattg ttccatatat gaagtatgga ttgtctaact tcacaagagg     31380
     atagatatcc aggagacaat aaaatgcata ttgtatcgac agactgaaaa gaatttgaaa     31440
     aatggagacg cctctcagta aaagaatgaa gtgaagcccc gctgatatct gtataattgt     31500
     ctctatgtgc ttctttgcag cgtatgcttt atcttcgatg taatctatgg cctttacaat     31560
     acctattcca agccctatga ggcctcctac cgacccaaga atcaggaaca aacttttcag     31620
     aaagaccaag agcatttgat ggggatgttt ttgtagaaat ataagagtta cgagctcttt     31680
     gtgatacaag acaaatccaa ttgaaagttc caaaacacca tacgatacaa tgcttcaaat     31740
     caaccggcca aacaacagtt tggatttact aaaaccttaa aggaggaaca tccgatcttg     31800
     cagaggagat atttgtttaa tcatgtaata ctaaaagtta gcaggcaaat tccttccaat     31860
     gaatgttaca tcttcaatga ctttcttatc ctcttgactc tggatttcca atctggggtc     31920
     atcgtaattt atagacgact ccattatctt catttgattt tcaagcacgc cttttagaaa     31980
     ttgatcaaat tctttcctgc catttccttc gatgagtctc ctcaggcgct cgactgctcc     32040
     gatacttaca cacatatcca cctccatggc cagtctgatg caaggatccg agagttctaa     32100
     agacgtcacg gtttcaatag tagtataaaa agtctttttg gagcctgtag acagataata     32160
     aaggagcata tatgccttta taagagcgct gttgtctgta gaagggctac aggaaagata     32220
     gggcccaaaa tacatctcta ccatttccgg atcccccttc tttatcccag ttagacagag     32280
     tgattctact tcattcaatt gtttattcat ccaaaagccc tccttatgaa ttttatttca     32340
     aataaagcta aataggattt taagaggctt cttttagatg attcgaagta gttcgggccc     32400
     acaaaaccct tggtattccg ctgtggtagt gacattggcg caataggtag cgcgctggtc     32460
     tcataatcca gaggttgcga gttcgagtct cgcatgtcgc attttaaact tgcaagcagc     32520
     tttatacttt attagcttgg tcttatgcag ttcggaatgt atttccttct ctacctataa     32580
     atctctttct caggagaaga tcaacaaata tgtttatctt ttctcttggg attgtagaaa     32640
     tctcattgta aatctcctcc aacgtgattg gggccctcga gataatctcg tacactagaa     32700
     aaagaccctc ttcgttcctg aacaatggag gaagcatgcc aggattaaac ggaaatatgt     32760
     tatcagatga ctctgtctct tcgtaggact caaaggcttt ttcttctact attttgacaa     32820
     agcttgatga ttcgttttca gcgttacttg tgtggaacct tgccgaaaga tctccgagaa     32880
     acgtcttgtt taacatctcc gacgaggtac tgtcaacaaa tggatttctt ggagatgaaa     32940
     gcttcatcga tattggactt ccttcggtaa cacatatgtt ttggaagctg ggctcttcca     33000
     ccaatcttgg ctcattttct gtggttagta actcgctttc ttcgctttcg gatgattcaa     33060
     ctgaaaaaaa ccttatccat ggacttaggc cttcgcttat ttttcggttg ttcttaccta     33120
     tgctttcaat agaccctcgt atgtttctca atgttctgtt gatggaagaa aacgtattgt     33180
     ctatctcttc tattgtgcgg attatttcct cttcaatctc aatcatcagg gtggaattgc     33240
     agaaaggaaa ttagaatcga atcaagcata acaaaggcct ggcccgatta acaaataatg     33300
     tcttgtgttt caaaaaaaag tgagttttta tagatggcaa gctccaaact gttttgctgc     33360
     tttccaatag ttccttttaa ttgaggataa taagtgctac aagcttcact cttctaggat     33420
     tttatacaca aatgcttttg ttagtaattc ctgtagatgg atacgcttca ctcgttcttt     33480
     gggaaaaaga tgtcgcgaga agccgacaga gtacttttag gagtgggaag aaaaagagac     33540
     gagaagctcg ggctgaagat gcacatggaa aactcggcaa gagatgtgaa ttcccttgca     33600
     atttctgcat tctgccatga atttggaata ggaacggctg tagatatgaa gaaagctgaa     33660
     atgagataca gcaaggcggc attgagcgac aatggtctcg cattgatcag actagcattt     33720
     ataaggtggt ttggaagacc tacagcgaca atagacaggg aagaggccaa aaagatcctt     33780
     gacaaactaa aacgcctagg tagaaagagt gtggaatggc tcttttatgc aaataagtat     33840
     ggaaatccct atgccaagta ttgtttgggt gtgtgctacc aagagggtta tggtgttcca     33900
     atagacccat tgttggctgt aaagtattac agcgaaggag cttatgaggc gaacatttgc     33960
     tcaataggaa tactcggata ttgttttcta aagggctttg gagtggaaag aaatgaggaa     34020
     atagccgttg agctgttcag atatgcatcc gaaaagaaag actcaacagc cctatataac     34080
     ataggattct gttatgaaga aggaaagggt gtggtgagaa atcttgttaa ggcctttgag     34140
     atgtatagac tgtcggcgaa gatggagaat tcatatgctc aaaatgcact aggaaattgt     34200
     tatgaggaag gtaaaggtgt taacaaagat cttcacaagg cttttgagtt ttataaaaaa     34260
     agtgccttac aaggataccc atctggccag tgcaacttag cattctgcta tcaaaaagga     34320
     attggaataa aaaaggattt gcagaaagcc ttcgagtggt ataagagagc tgcagctcaa     34380
     gggctcagta gagcgaaaca taacatcgga tattgttatc agaatgggct gggaactcct     34440
     ccatgtatgt ccaaggctgt ccactggtat aaagaatctg catctgaaaa taacaaatat     34500
     tcaatacatg cactaggagt ctgctaccaa catgggtatg gagtgcccaa ggacgagaga     34560
     ttggctgtga gatactttgg agaaggtgct aagatgggtt ttgatgaagc aattataagc     34620
     cttgcgctat gttacaggtc tggaactgga gtccgggtat ctccggagaa gtcctttggg     34680
     cttataaaga gggctgcgaa gatgaacaat tcttcagctc agaatacctt gggatattat     34740
     tatgaagagg gatacggaac acctaaaaat ataaaggaag ccatcaagtg gtatggaatg     34800
     agtgctaaac aagacaattc gtgggcattg ttcaacttaa gcaacttata ttttaatagg     34860
     agtcgctctt ctacagataa agaggttgga atgcggcttc tgattaagtc aagagacttg     34920
     ggaaatccca aggcaatgga caccttagga tattactttg aaaaaggtat tggggtcgaa     34980
     aagaatccaa tgctcgcttt cgagcattac aatcaagcac tacagggcgg atacttgaaa     35040
     gccggatata accttggaag atgctatgag agcggtattg gaacagaaat tgatttggac     35100
     aaggctttgt attatttcta caaggcatcg tccgccggag aagaaacctc cctacaaaag     35160
     ctcaaaaaga tattgtcttc cttggtcgag ccaaatcata tgctcattcc tccttacgcc     35220
     tgaccaaaga cagattcact tgaatttgtt tttatagtta tgccagaaat tgatcctatt     35280
     tttgagcctg tttgggatga acttaggatc tcctcctttt gcatagtcaa cgtatattag     35340
     atttcccccg atactgtggt acttcccagg gacatcatct atatttgcat tctcctcgac     35400
     tgacacaaaa gcataccttt taaatacctt tatatctctt attgggaatc tttcacaaaa     35460
     ggcctctttc agtgcttctt ttgccgtcgc cccagctata aacagctcat tcttctttcc     35520
     tcgggatttc agatgcttta tgaacttcga tattccctct actcttggca actgcttttt     35580
     cctcccctgg gagacaaaag gtactaaggg tgatagatgt ttgtcaaatg gtgcttgtct     35640
     aattagatcc ttcatcttgt gcagattcaa gggtttttta tttgtgggga gaaatcgtct     35700
     gagactctag aaggcaatgt tgtttgtaat cttttggtac tggtcataca tccaagttct     35760
     aaacttctga gatgattccg ctattaaaga ctggacaaat cttcttgcat ttttgtctga     35820
     taattcaagc ctgaatctta gagcaaaatt ctctactgcg tttttcttat agcaaggaag     35880
     cctgctattg gaaaacgaat ccaccatcat aacaaggtcc ttgctgtgcc ttctcaaagc     35940
     caaaaatccc ttgaccatta actcttgata gatttcaaag ccctttccag atattcctcc     36000
     aagaagctcc tcgatctcct ttgttagctt cagaggagct tctatgttga gatttcctgg     36060
     agacatctcc aatatatatc caaagtcaat gtggatcatt cggcctttgt cgtcaatcat     36120
     tatatttccg ttatgtctgt ctttgatgtt aaggaagtaa acaactaatg aatatccggc     36180
     caagctagaa gcaaagttgc aaatggctgt aagatacccc tcactttcct tgaagccgaa     36240
     tttgtattca aagtattctg atagattgtt gatgttctct tttcctatct gatcccttga     36300
     ttttgaattt ggaatcacct ctataattcc cgttcccgga gacgtagcta tgactctgta     36360
     tggatagaga aatatgtcta gatttgcctg cttgaatatc gactcaaaca tagagattat     36420
     ttgaagagct agcatgtcct gtctacaatc atctccggat ttgaatatta gttgtttgat     36480
     gtttatctgc ccgcctggat cttgaaccct aaaggatgcc atgaagggaa ccttggcatg     36540
     actctgaaga gctcttgcag accctcccat gatttcgaca atcttgagct caggataaaa     36600
     tggaatataa acccctggag acagctttat ctttgaaaga tgttcattta tgcgtcttct     36660
     cttttcatcc tttgacgatc tgagatgggg aataagttct gatgagattt tggtaaggct     36720
     actaataaat tcttcttcct taagcagaat gtctcgttct tcttctgtca tttcccccat     36780
     gatttcttcc atgcatcgtg taaatatgtc gtggcagtca tctctctctg ttctatctga     36840
     tccatataag tttgctttca agttccaaat cagctgatgg gcgacgtatt catccttggc     36900
     cagatccttc aatgtggcaa gtgccatctc agacactttt ttatgtctta tcatttgaac     36960
     aagctgagga acatagaaaa gcatctcacc tctaaagtcc ttaagcctct caaaggcttt     37020
     ggataccaga gacggatcat ctatccttct gattattgtg aggcagtcaa taattccaag     37080
     agattccatg ttaaagaagt atgatctgta ggatggagtg gaggatcttt caagtagctt     37140
     ttgaactatc ttttgcttaa atgtgttctg tatgtgtata agatctgcta tatcgaattt     37200
     ggagattagc tgggtcctct ctgggaacga aagatcgtca ttacaggaga agtttgagac     37260
     tgcaaaataa agtgccctga aaaagaatct gtaaaaccca tttgtctcca tagatagttt     37320
     atagcatata gcaggatcag tcttgaagtc cagtcctctg tgcagtgcat gcttcaggaa     37380
     ttcttcggag tcgttttccc taatcgatag gatgttgtag gccttcagaa gaatgtaaag     37440
     atcctcatat tcaaacatat ttctaagtct aagctttaga agatccagaa ctattcttat     37500
     tatcgagctc tggcttcttc ttgtgtatat cacatcaata agccatgaaa cagatttctc     37560
     tctctttcta atgccttcat ccagcatttc tatctgtcca ttccgggaga ccgagtgcat     37620
     gggtgatgag ctgtgtaacg aaatacttcc catcgaactc tccagactta caacactgtc     37680
     attggttccc gtatgaatta tattatacat atcgtgcgat ttttcttctt tagaatttag     37740
     tccctcttct tttcctctaa ttccatattt tctcctgttt tctttccatt gaatactgga     37800
     cataaatgat ttggaggacg tttcttcggt gttctctgcg ctattccatc catggtctac     37860
     catgaagatg tctggaaact cttctacaac tcccattctg gataatgtgt gattgtatag     37920
     gtcattgaaa gatttaaaat ggcctttggg aagctctccg tcaaaaaaag aaatatccgc     37980
     taagcaaaga acaacgtaat tgtagaagtt tggtgcacat ctaatcttct ccagcatttg     38040
     cctgtataat ctgcggtatg agtcggtaac ttcttcactc aaaaatctct tacttgtaag     38100
     aagaacgaaa agtttctgga acctttgatg gatttctttc atgaatatga tcttttcttc     38160
     tttctcgaaa atctttctca agataatctc aatcatcatt aacgttgttt caattgtttt     38220
     cggctctagc gcgatgttca aaagagcatt tacatacgaa aatgtgaatt catgggattt     38280
     gtttatgtat ccattgtgga taagctctat cacactgatc aagccatctc gggccattcg     38340
     aattccgtct tcatcttgta tatactctag tattcctgta tagttcgagt tgtatagctt     38400
     tctggactca cagtagtaca caatccctag aaacacaagc atccgtggct caacatttct     38460
     aaggttcagg cctgctgcta attggtgtaa gtattttaca ttgtagtaga tgcttgagga     38520
     tattccaact agagccggag tcttgagaag aaacaggtct acttgctcaa ttgcttcgtt     38580
     ttcaaaaaga aaggagtata tctcatacaa aacataaagc acttcccgct ttgatggaat     38640
     gtacggaaca agaggaagaa caccaatcag ttctctgttc tttgtgctca ggaaaaactt     38700
     aaggaactcc gaaacaagct tatctacatg ggccttgcta tacctcttct cttgggcctt     38760
     cttgaacagg atagagtaaa attccttcat aaacccaaag ttagatatct cgtgcagact     38820
     gtgtagagga aagtcaactt cgttgataag gatgaagttt gaatacagtt caatggtttc     38880
     tggatacttc acaatgaact ttaaaaagat actgttgaag tcccccatat ccttatttat     38940
     cctgagctta gataggaagc tcaagaagtt ccatatcatt aagtctgtgt tctttgactc     39000
     ggagtctcga agactatgga aaatctttcg gaatgtatcg gctatacttt tggtcttttc     39060
     aatttttccg tcttgctcaa ccgcttcaat taaagttcca ataaacttat ttttataact     39120
     tgcatccagg tatgtaaaac aattggatgt aaacaccaaa tatagcaagt cgtaaagtgc     39180
     accatcctcg tacagacata tatttgccat ctggatatgt attctaaaca tgttttttcc     39240
     tgaaataggg aggtcttcaa taatcggaaa cacctcattc actctttttg ccacctgccc     39300
     agttaccaag gcatcaatag ccagtgaagc cttgaataca aaagtcatat catcctccag     39360
     gtcctttatc tctccaagaa aaacaaaagt cttgtaaaag tattccttag cgaaagcaaa     39420
     tatgtttttt ttctctatct ttcttttttt ctcgatctta tcttccatca ccattacaat     39480
     aagccttagc gataaaagta agaaatccaa ctttatattt actatgtctt ctttcagact     39540
     ccacgaagca atctcataaa gaagaccact ggtcattttc ccacataatt tttcaataaa     39600
     catctcatat ttgcttgccg gctgttctcc ttgctcaatc ttccatattg aggcttcaat     39660
     aaaagcattt ataaccccag tcgaagaaag agtctcaggc tctacgatac ttatgtctgc     39720
     catgatttct ttacttacat actcattatc caacattctg agaaacatca ctatatacat     39780
     ttcatagagc ttactgctgt attccaagca tgtactagag ttctttaaaa ttgcatatgc     39840
     attcaatcca aatccctctt catatgcttc catctcagat aacttcttga tatcctcaag     39900
     agtcgtttct ctaacaagag gtatgtaaat atcttccgag ctccctttta ttatcacctc     39960
     tatcttcatg ccaggaatgt ttgttggggt gtaaggtatt tatgctatat gatcttaagc     40020
     ctaagtctaa tcccgtcatc cttctataag accgatccta tggttaatgt agagcttata     40080
     aggtaataac aatcaaagaa tgtgatttat ttcctttcaa gtcctgaagt tcgaccttta     40140
     atgctcgtat ttaacatctt caaacctatt gatcagatct tctatcttgt gtcttcgggt     40200
     ttttgacatt gtcataagat tttcctttgt gataatgctg tctatagagg caaaaggaga     40260
     aacatgttta ggtaactctt ttcctacaca atagtcctca gcagaaagtc ttcttctctg     40320
     gttcagacaa tcaaacagat actggggctg cacatatatt gtattctcca taacttcatc     40380
     cactccttca gagatgtgga tgtctgcctt gcacgggctt tccaccacat ctcctccaca     40440
     acttaaagca atgagtctta aactcccttc aatggttttg cttcctatat agaattttac     40500
     gtcttggaat attccctttc tgttgttatg ggactcatac accttctcta gtttgaaaag     40560
     aaccaactta cagtgcacca taagaagagg gaccgaatga gacaaaagag aaatgtctat     40620
     ctttccagga tcgttgtaaa taatttccat ctcttcagac tctgaatctt cttcctcaga     40680
     agacgataca aaatctagga aattgggttc gctccactca aatttacggg gcaaatcttt     40740
     cttctcctcc actatgtcct tcaactcggc acctgggtac ggaacaaacc aaaccactct     40800
     tatctttcct agagttgtct ggttataaac ccctgccttg gacatatagg agcactcaag     40860
     aagagacttt cttgcaatga aattctcaaa cattccaaga gtttctgata tccgatcgtc     40920
     aagacccagc atcctcgcta aatacaaatt accaagcgta tgatttagtt catcaactgc     40980
     ttctcccaat cctttacatc tgcttctaat caaatctaca tagccgtact cctcgtgacg     41040
     gatattttcg attttgtatt ccagtccagt tccaagatac tttttctttc tgtcctcaag     41100
     ctttctattc ttgatcagta tcttatagac gtcggagtgg acaagtttat tagcatctga     41160
     tatcctgtag tagaatccat ctccctgatc aactttccta ttgttcttcg ggatgtaggg     41220
     atgaacttgg cacaatgcaa ccagcttatc aaactccttt tcctgtagat ctagattctt     41280
     catgaccaat tcttttgaaa tgtatttctt ttgtggcttt atgtaattgc ttcccattga     41340
     gggaggtagt ttttactcca tcagaagaac agtggaataa tatttcttag gccgtttcta     41400
     atggaagttc catggccaat aaaatagcag gatcaagccc tagggatgaa ggacctgaga     41460
     acatatctat cggaaagcaa ggtggaacat ctatatcaat tatttgagag gcttggaata     41520
     gatgagtctc agctgttagc aaaacttaaa tattccgatt tggaaaaaat aggaatcgag     41580
     aatctcatag aaagaagaaa agttttcgat ataatcaatg agatcaacca agacatatac     41640
     aaagaggata tagagatgaa cgaaaatgac tcttacagag atgaacttct ttcttttcct     41700
     tttgggcata aggaagaaag taagtgtgag caccagcctc ttgctggaaa tattgcagaa     41760
     aggagcagcc ttttgtttgg aagtggagaa actataagcc agagattatc tttatgctct     41820
     atgccaaaaa gaagtagtct tgaaagatct ttaattgggc tggacgagct cgatccagat     41880
     agtagcagga caattttgga atcacgcaac acaaatgcat ctgtcttgga ggatattgtg     41940
     gagtctggga caggactaga aaagatatct gtgtgtgtta gaaaaagacc taccactagt     42000
     ccaagtctgg atattgttga tgttgaagga agaggtgttg tagtcaatga ggaaaagctt     42060
     cgagtggatt taaggccgta tattgaacgt catcgatttg aatttgatta ctcgtttgat     42120
     cttgacaaga aaaatatcga tgtatatagg gagtgtgtca aaggtgttgt gaatcatgtg     42180
     atttccgggg ggtttggaac cattatagcg tatggacaga ctggaactgg aaagacgtac     42240
     acgatgctgg aaaaggacat agggatggtc tatttagcaa ttaaggacct tatggctttc     42300
     aagaattgtg gagccataac gttctgcgag atatacatgg ggcaggtcca tgacctattg     42360
     gatgaaggga aaatcataca gctgagagaa gtcaatgggg ttgtgcatct ttctaactca     42420
     aaagaagagc agttctgtgg atataaagaa gtacttgaaa ttattgccaa aggaatgtca     42480
     ctaaggaaga ctggtgtgac aggggcaaac tctaagtctt caagatccca cgcagtgatt     42540
     ctggtgaact tttctgaaag gaaaatagag aagaatgatc aaagagttca ttcagggtcg     42600
     attgtatttg ttgatcttgc ggggagtgag cgtggaacag acagaaagga gatgggatca     42660
     gacgtcaaga acgagggtgc agaaattaac aaaagtcttc tggctttgaa agagtgcatc     42720
     agaggaatgg agaaggacag gaaacatctt ccgttccgcc aaagtaagct aacacaaata     42780
     cttaagaatt catttgttgg gaaatccaga acctgtttga tagctacaat atctccaaca     42840
     cctgagaacg ttgaacatac tctgaataca ttgagatatg cagcccgaat aaaggaaagc     42900
     attttacctc gagagaagag aagtagaggg cccttctgtg gtaggacgtc tatagggcaa     42960
     accaagtcat ctgatacaga aactagaaaa gaaatcgaaa agagccatcc tgattctccc     43020
     agaacggaat tgtttagtag taaagaaaac cttgtgtgcg agataagaga aatattgcag     43080
     agagccgaat ccaggattcc attactaaag acctcaaaag aacttgaaag gatgttagat     43140
     ctctgtaaaa aaatggagta tgagatggaa tctaatataa tgaaatatta aactttatat     43200
     cgaaattccg aaaactttta tacatttaca ttactaaacc taatttaatt caatttccgg     43260
     caggatgcag atattaaacc agttattagt ggatgcggct ggttaggcct tgcagtgaac     43320
     tcaggatgga attgtactcc gacaaaaaac ggatgcgatg taagctcaaa gatctttgct     43380
     gctcttctct cgtcgctgaa tcctacaaac ctcaggccat acgaacatag tgaggaaacc     43440
     tcggatcgaa caacctcgaa ccgatgtcgg tgcctctctc ggatcttctc cgctccagag     43500
     tacaacctct tcacaagtcc gtcctcaagc tccacctcgt atcccccaac tcgcagtttc     43560
     ttatcaacca ctccgttctt gtcgctgata aacctgacaa caaggttctt cccagacggg     43620
     ttaaactcct cggaagatgc atccttcatc ccaagaacgt tcctgcacat ctcgataatc     43680
     gatagttggt atccaagaca gatcccaaga agaggaatcc tgttttcccg tgcataccgg     43740
     atcgccgaga tcttcccctc gatcccccgt gctccaaatc ctcccggaat gataattcca     43800
     ttgcacttct caagatcctc tgtggtgtac gagtctgcat tgatccattc aatctcaaca     43860
     ttcaccccca cagacgcccc agagaacctc aatgcatgca caagagacgt gtagctgtca     43920
     aactccggcg agtacttccc cactatcccg atccttactg tgtcctcgtg cttctgcaca     43980
     agtcgttcaa acgtctcaag tatctcccga tccccctcct tcgacgaaat cccaagcacc     44040
     ttgttcagcg actcaaccat tccgtgctct tcaaggaact tcggcacaag atacaccgac     44100
     tccagattcg gaagcccaaa cacattccca ggctccaccc agcagttctt cgatatcttc     44160
     tcccgcgtct ccttgctggg gtcccgcact cccctgcaca caatgatgtc gtagctgagc     44220
     ccgaatctcc tgaagttcct gcaccccatc tggatactct ttgttttctg ctccccactc     44280
     tctagctcta caagatggtc tacagacaca aatgcacagt tgctccttcc aacaattctc     44340
     tggaactttg caaaggcgtc tgtgtatata gacgactcgc tctctccaac agttccccca     44400
     agctcgataa tcaccacgtc tgggatgacc ctacgtccgc tcttgaagtc ttccacagga     44460
     gtctccgcca ccatcttaat tcttctgata acatcgtcta ttgcatgtgg attaatctgt     44520
     aatgtctttc caagaaaatg accctccttc tcacgcttaa ttaaatcttc aaataatctt     44580
     ccactagata gactgttttt tctagaaaga tcagacatat taaacctttc atagtttcca     44640
     aaatccatat cgcatgtatg tccatcgtca agtacataga cctcaccatg ttcccgtgga     44700
     tggatctccc cagcattgta gttcaaataa ggatctatct taaaatgagt agtgttgtgc     44760
     cctcttgact ttagtaaaac gccaatgcta ctacttacta taccttttcc aataccagag     44820
     ataacacttc cacaaaccat aatatatttc atttttaggg atgcctgaga attaacttct     44880
     ttgaaggaat ctagatattc ggataattta attttaatta caaactttac ttattttcaa     44940
     tttcactcaa taaaagtttt ttgtcttcag attcttgaaa aaccaacgag cagagagaaa     45000
     taaactcttc tgaggagata aaaagcttac catttctata tccttcaatc acttccgccc     45060
     tatttgaaga tagcacttgt ttgtaagatt tcaacttccc ttggcttcct atagctcctg     45120
     caggaaggtg gaaggagaga tcaaggatgt aatcaatcaa tattggaagg ttttcaatag     45180
     tacttctctt tgccattttc aattcctgga ttttcttcat caagttttca ccaagcatct     45240
     caaaaaattg gatttcaaac agactcatat taatttcagg tacaaacaac tccatgtttt     45300
     caacaaactc cacatgcttt tctttaaaat agagtttgag agttactaag ggctcgtcaa     45360
     gggctacatt gatccttgat gattccttga tgacgtcaaa gaatagttcc tcttttcttt     45420
     tggacaactc gtcggcaagg caatgcccag gataaaccct caagaaatgc gttatgtcag     45480
     caaactcaat aaaatagctg taaatggagg gctcatatct cttcggatca aatagcttct     45540
     ttatcgctct attaataact cttactccct tctcatgtct ctttgacttc aactttctga     45600
     atacttcaaa gcatttttga aatcttttat agcttgcaga gatggatttt ggcattcgat     45660
     tggaaagttc aaaggttttg acggcctcca tgtcccttgg tccctttgtc atctcgataa     45720
     tttccttcat gacaacatca agcttccact cgacaacatt gtgaatgtaa aattctgtat     45780
     ctcggaagaa ggcattgctt gcttctatcg attcgtcgga gaggtcttct tccacaactg     45840
     cattcttcat attgtccctt aaaaccccaa atatcacgtg agacatcatt tcatacttcg     45900
     aaatctcctc taaacccatt atagcttttc ctaccaactc acagtgggaa agatctccgg     45960
     attggccttt aaatacaaaa aacagcgaca agtcatcttg aaagaccttt atgccaatag     46020
     gcacaatgtt tagcatattc ttgtgtacta ttgaccttaa tgaaaagtag catttttctt     46080
     gtatttccat gtatctggct gaaagctgga aaagggtttc cacatccttt cctatcttga     46140
     aaaccatcgg cccgtcgcca tgcccgctct ctaggtcctc cacctccccg gagccacaag     46200
     agttaatata tttgagagca atcgagtgat taagaaattc cagcgatttc tttagtacca     46260
     catctccatc agcaatctta gaaaaaattg cctctagatc gcttatactt ctgcattcct     46320
     tagaacccaa ggagagcttt tctatatctt caaggatgtt ttggtattca tcaccaatct     46380
     tctttatttc cttctccagg cttatagaat cagttctctt gatctccttc tctattcgat     46440
     ctaattcctt ctctcgccca accttctcat ctcggagtga aagatacctt ccataacact     46500
     cgtcaacatc cctgattttg ttgaagagtt tgtctatctt ttccatcgga gggataaaac     46560
     cactattgca tattcatcag atatccttga agagaaaatg gatttggatg aagatgtttt     46620
     atttcttgga aacattcccg agagcttcaa caacgagctt ctaatagaga tgctgagtgt     46680
     ttttggagag attaaggagt tcaagcgtgg taaggatcta gaagggacag actcaaagtg     46740
     ggtgattgta agttactatg agaaatcatc gatcagcaat ctctattgca gcctgctgaa     46800
     cagagacctg ggacagggaa tggtggttgt tttcccgcaa aaaaaggaat tacaagcttg     46860
     ggaggtctcg gacgagatac tcggaagagt tgacgacatt gcaaaaagat ataaagagag     46920
     actcaagaaa gaggattgct tagagaagtt tgtttccagc tatgatttgt tgtatggtag     46980
     tacaggagat gggcaagtgt tttctgaagc actgtcaaag tggctggatg aagaatcgga     47040
     aatacgcaga agatgcagaa aggccgagaa tgactttgaa agaactgcag aaaggaaacg     47100
     acaggaagaa tattattatc tatcaactta tgacgatgac agatctaatg atttatttta     47160
     tactgataga gtttcttggg cacttaaaag aaataaagat gatgttaaat aaattcggaa     47220
     gagtctgttg gtaaggaatt tatttgtctc caaaattttg tgaatggagg gtaatcttga     47280
     gacaaggata tctagggcct tggagaatga gttcaaacct gcagccttag aggttaggaa     47340
     cactactgcc aatcatgtgg cccataggaa gcccgaagat ggaaaagttc ttgaaacaca     47400
     tttttacgtc agggtgaagt cttcggcatt caacggaatg gtaagttaat gatcgccgta     47460
     taatttaaga gatttgcaga caggcatagg cttgtatata aggcacttga atttgctttt     47520
     gaaaaaggcc ttcatgcaat tgagatggat tgcgattctg acgtccaaga gtgactagga     47580
     ttatctttct ttaatttaaa tttaatttga tttgatttaa tggtgccttt gtcttagaaa     47640
     cttcaattta tacctttttg gtaaaaagaa tttattcttt tttttgtttt actttaaata     47700
     atgaacaagg tttttggcca tgcttcacct attatatctt gcatttgcct tgtgccatga     47760
     agttcctgat gtatgcacta gttctgggat gatagcaatc aactttgtag atggaccagt     47820
     caggggagtg accgataagg ttctaaacac tctggaagag cttggcgtga aagctacttt     47880
     ttcgtttacg gtgaaccaga aagccgtcgg aaatgtaggg cagttgtata ggagagcagt     47940
     caacgaagga catactgtag gattgagagt cgatccaagg atggatgagg gataccaaga     48000
     tatgtctcaa gaggccttgg aagataatat tgaccgggag atagatacaa tcgacggact     48060
     cagtggaact gaggtgagat atgcgtctgt gcccatatcc aatggagagg ttagctctga     48120
     gctatatacc atccttaccc agagaggtgt tcttccccta ggatatacct tctgcccata     48180
     tgactacgac gaccctatag ccgaattcga agccatgata gaaggatcag atcccaaaca     48240
     ccattccttc atcatcttaa tgcatgacgg acaggaggga gatacttcac gcttggagaa     48300
     gatggtggag ataggagaga aaaagggata tacttttact aacatggatg aatgtcttcg     48360
     aggctataaa ggctctcctg gagatccgga gctcaatctc agaggaaagg gtgctgcaag     48420
     cctcgctacg ttcctccctt tcttcatgct attggggcga cttctctaaa gtataaataa     48480
     atatacaaat cttatgatca tgtaattatt taatgggctc atgaatgcct tcggcataga     48540
     aatccatgta ctgtgtgatc tctctatcgt tagtcccata tttctcgata tgggaatgtg     48600
     tttatagaga caggacttaa gcgttaagca cgacaatagg ctttatattc tatattttta     48660
     ggatatttct tcctcctttt catcagaggt ctcctgacag cgggaatcaa gcaaacacag     48720
     gctgggagga agcagaaggt tacattcgga gcagaaccgg atggtgtctt tgcttacgtc     48780
     gtagtacccg ggatatggct ggtaagaaag atgaaattta ccatatcggt tctccacaaa     48840
     cccatatccc tcgtgtacag actgcttaat gtcaaacccg ttcacgtggt tgaagtctgg     48900
     actaaagaaa tatctattca tcaaaaactc cacatcagag acccacccgc tgtatgggcc     48960
     aggcgacttc cgggcgtagt actttgctcc ttcaattcct aaccaatgaa atgcatctct     49020
     tatccattcc aaagcaaaat tgaaatcttc gtctccatcg gagatctcag tactcttgag     49080
     acagtagttt gcaataagga caaatttgtc tagttcacta aaaaactcct caagaagatg     49140
     ctttaacttg atttccttct tcaagctctt ggtcttttgc ttgaagtaaa ggtcttcaag     49200
     aaccacagta tagttatttc ttccttctgc attgcatagg aacttcggat ttggatggtt     49260
     ccttctattt ttctcgatag ccatatcaga gatacttgga gtcttgatat ttttatatag     49320
     attctctgcc tccttgagag aatatatact caaaagcccc tcacattcgt ctgaatcttt     49380
     gcaatcagaa ctgctactgc catcattgct tgataaatct tctttatttt cctcatggag     49440
     atctttagag gtaataaatg gccctacttt ggaatccgag tatccaagat taagactttc     49500
     ttcttcgcaa ttttcaacag aagtgccgtt cttgaacaac tgttgtatct tcattttctc     49560
     taaagaggac tttttcaatc ttgttggatc attgcttatg tctaactcca cgtcattcaa     49620
     ggagctctta attccttcct ttcttccaga aacttccatc aagggttgag aagggtggcg     49680
     cctgtaaaga ctcagttcaa ttttagccca aaagaaagaa catacatgaa tgttagagag     49740
     tcattcatca gtacaagaaa gacaaatgtg tctagagaag attccgagaa agattgctat     49800
     gaggaggaat actataaatg gaggatacgt gatttgaaga gaaagataag agacattagg     49860
     aaagaaatca ttcgggcaaa gaacattgga acttccggaa atgatcctaa aatttattga     49920
     tgtccataaa tactttcaag tcttcatcgg taatcttctt tcgggattct tgatacctta     49980
     aaacaaattc ttgaacaata gaaatacatt tctccttcat ttccctgctg gtaatctctc     50040
     ccttaatgta tcccaaccga tatctttcaa gctcctgatc atcatccaag aaatatctca     50100
     gatattcaaa tgggacatcc acatcgatat ttcctccctt ttcccgatgt tcttccaatg     50160
     tttccctacc cccagaataa gcatgcactg taatcttctt tcgtattgtt tccggtgtat     50220
     cgtccaaata tatggagcta tttggatcgc tagcagacat ctttctattc acacctttga     50280
     gatctggaag aagggatacg tatgcagacg aaggctttct ctccccaagc gtatttgctt     50340
     tgtctcttgc caacctgaag aacgggtcct gatcaactgc tgcaaaaaca agacacattg     50400
     catcctcttc aataaattta aaagagcttg gaaagcaggg tgctatttct tttgatggaa     50460
     atcccacctg ccctatgttg ctggatgtgt tgaatccaaa gatcttagat acctcattga     50520
     agttgattgt cttcgatatc ttcaggacat ttttttcgaa gtgatgagaa gattcaacat     50580
     tagaaaatat atacgtcagt tttggatcaa aacctagtgc tataatatcc ttcatgtttt     50640
     ctttcccata cgatatagca tcctcgagtt tcatattttt ccacaggaac ttctcgtcgt     50700
     cagttatttg aattacaaga tgtactttga aagtgtcctg aatgtactta caaagaagga     50760
     aggggatgat gtggccaata tgcattgcct tcgagctggg gcctcttcct gtgtacagat     50820
     agaatgactt gttcttggat acttcatcaa gcaaaaggtt aaaatccctg tgcccaaaaa     50880
     ctatgcctct cctaaagaag tagtgtgctg gcttgtttgt aagttgttct aaacgcttca     50940
     ctagatcctg attaaagcgc tcgcagccaa actgattaac taccttgtcg tagtcgatgg     51000
     ccacaggcgt ctcgcttgta gatacaactt ccacgtccca aggtgtaatc ttttgttctt     51060
     ccatttaggg gaggcatgtt cacatttaat atagttgaaa gaccaaaaat taaaaaatta     51120
     gcttcctttg gaaatggcgg aaatgagctc tctaagcaaa aagctttctt caagcataat     51180
     aggaatagac ctgggaacaa ccaactcctg tgtgtctgta gttaagaatg gggagccttt     51240
     aataatagaa aaccaagagg gagagcgcac cacaccttcg gttgtgtcga tacttggaga     51300
     cgaagttatt gtaggcaacc aagccaagag taggatgtta atgaatccca aaaacacagt     51360
     gtttgcatcc aaaagactga taggccggaa acttgaggat ccagaggtga agaagtatgt     51420
     aaagggcctt cctttcgata caatgtctca ctgtaacgga gatgtttgga taaagattga     51480
     tggaaagaag tattctccag cacaaatagg tgcgtttgta ctttctaagc tcaaaaagag     51540
     tgcagaatca ttcttaaatc atccggttgc aaagtcggtc ataacagttc ctgcatattt     51600
     taatgatagc caacgtcagg caacaaaaga tgcaggaaga atagctgggc tggaagttgt     51660
     aagggtgatc aatgaaccga cagctgcagc acttgcatat ggccttgaca agctggcaaa     51720
     gggaaatatt gcagtctatg atctcggagg gggaaccttt gacatttcta ttcttgagct     51780
     gagcaatgga gtgtttcatg taaaagctac taacggagac acatttcttg gaggagaaga     51840
     tcttgacaat gagcttgtga agtttattat tgaagacttt aggttgaagg agggagttaa     51900
     cttgggtgaa gatataaatg cactaacgag aatcaaggag tgtgcagaaa agataaagaa     51960
     ggatttatct tcgtctcttt cctcaagaat caacatacca tacatatgta gtattgaagg     52020
     aaagccaaag catctaacca gagaaatcac ccgggacgag ttggagagag tggttaagaa     52080
     gattgtggat cgtactattg agccatgcaa gaaagcactt agggatgcag ggatggaggg     52140
     ttcggatatc aaacacgtga tactggtggg gggaatgacc cggatgccat atgtccgaag     52200
     ggtagtcaag gaggtgtttg gaattgaacc ttctaccggt atcaatcccg atgaagccgt     52260
     tgcaaaggga gcagcattgc agggaggagt tcttacggga gaggttgata atgtgcttct     52320
     cctggatgtt gcacctctaa gcctaggaat tgaactcctt ggaggagtgt ttaacaagat     52380
     aataagaagg aatacaacaa ttccatttaa agaaacacag acgttttcta cgtcagaaga     52440
     taatcaaaca gaggtggaca tcaaggtata ccagggggag agatccatgg cattggataa     52500
     caagtatcta ggacagatca agctcaagga tattcctcct cttcctcgag gagtgcctag     52560
     gattgaagtg acgtttgagt ccgatgctaa cgggatgtac aaagtaactg cacaggatag     52620
     tgtcacaaag aagccgcagt ctctagagat aattccatct agtggattaa cagaggagga     52680
     gataaacaaa atggtggagg aaggagaaaa gcatagacac ttagatgaga taaaaaggag     52740
     gaaagctgag cttattgttt cttcggccga gtttcttcga agaccatcct caagcttggc     52800
     aaaaatctcc aaggactgct tagacacgat taaaagagct gtgtctggag aggagtttga     52860
     tttggaagaa acaaagcaag cactggaaaa tgcaaagaaa gccatctctt gataaagtat     52920
     ccgtttgcaa caaaaatatc tattgctatt taatttccaa gggatataat ctgaaacaaa     52980
     gcaagattag atgtaatgaa acatgttgat aaactaagag cccccgaaaa caaagactca     53040
     tgactacaaa tttcaacaaa gaagttaaaa tgctccgtga aactgaggag aacaaaagat     53100
     gtgcagactg ctctgcacca aatcccccat gggcgtctgt gacttacggg atattcatat     53160
     gctttgattg tgctagtatt catagatccc ttggagtcaa aacgagcttt gtaaagagcg     53220
     tgaatctgga catttgggat gaaaaggaat atttgtttat gaagcatgga tcaaatgaga     53280
     agtttaagaa gtttctggag cattgcaagc ttgttgggcg ggaaatgaac gagatttaca     53340
     acaacaacca catcaggaag tatggtgaaa gcgttaagag ccttgttgtg aaggagatag     53400
     gagaagaggc attcaacagg ccaaggacta gtacggttcc taaagagcca agagactcgg     53460
     aagactggag aaagaggtct tctacggatt gtgtaaatag aagcaagagg tcccatggta     53520
     cgccggggct tgaatccatt agtacgggct cgcttcagag ctctatttcg tctactttgt     53580
     ctattgttgg aagcgcgatt ttctcgggag caaaggtaat taccggaaag actgtggaat     53640
     atggaagcat tgttgttagc tctacaaaga gcattatcaa agacaactct tcttcattat     53700
     catctatctt caagaaaaag gatttaattc caaaggatca cataaaagtc cctgaaagac     53760
     aggaggtcta tccaaggcca gataagtggg actagaatac tagatatcta attaaaactt     53820
     tcgaatacct ccgaagcttt taaactgtcc aaaagatctt acattttatt tacaacgagt     53880
     gctgtgaaat acttgtatac aagaaataca tacagagaga tcttacagaa catttcaatc     53940
     tttatccgtt tcttttgttt gaagaaatcc agagcactga tggaatcttt ggatcctttc     54000
     ttctggatct cgtaaacaaa tagtaggaca acaagaaacg atgtgtagca taaggagaga     54060
     acctgggcag ccataatcaa agtaagtaac ttgaactcta tggctgcaag ccgaagtatc     54120
     ctatcgcatg cattgtaaga cgatgctctt ctaccctctg catccagcac cgcctctatt     54180
     ttatagagct caacaataca gagtatgaca ctcaacataa gggaaataaa gagtcctata     54240
     ggattcattg gtaagggtag aatattcgga ccttgaaaac ttgatttatt catctctaag     54300
     cctcatgggt ctattggttg aagatgtatc tgtgcatgga gtacagaagg ttgtagatgg     54360
     cattttccat gatattttca tcgcacttct caagaagacg tcttcgataa tcaaccttcc     54420
     ccactttagc catttcaaga tccttaccct tcagattctt ttcttcttcc catgcttttc     54480
     cgtagctttc gatgagcttt agaacctcct ctctcttagt cctgacatcc ctgagcttaa     54540
     ggttatctgc ccatgttttc ctgtgaagat taaggagcat cttctgctcg agatcgtttt     54600
     tccggcatgt tatgttaaac gaataatagt gcttgttaag cccgtggatt atggatatga     54660
     gagtgggtgt cttaagatat cctatgtttg atgtcacttg tcttggctct cctccaagca     54720
     ctcctagctg attgtcgatg agtctgaatg catcaatcac aacctttccc ttgacactct     54780
     gaatgggatc gacaaccact gcaacagctc ttttacataa tttttcgaag ctctgctggg     54840
     tacttatgtc cactgtactg agccagcatc cgaaacccgg gtggctgtga taccatccaa     54900
     ccactgtctc gtgtctcccc gtagccttta gtatgctcat catctccatc tggaaaatag     54960
     gatccacaga ctccacagtg acatttgtcc cactctgagg catggcaaat acatcgacaa     55020
     ctttcactgt gtattcatca acaaattccc caagcatcag tcccatgacc tccaaaggaa     55080
     ttcccgctct tccatgtttg agcattttca atagtgcaag cgaagaaatc tggactgtct     55140
     cagaggcgtc tgatgtaggt tctccatcat ctaccccaac aaatccatta aacatttcag     55200
     ggtttggatt tctttctttt aagctcttgg aactagccta aagatcactt atcttcgaga     55260
     aaatcaaatc caggatcctc caactgaacc actagctcct caagaatcgc ttccagactt     55320
     tcgatgctct ccgatatcga tgccccgtct agccttatcc cgctgtctaa gccccttatc     55380
     agtctgttat aagctttctc aatattctct ttcatttatt ccaacaaagt aacagggctc     55440
     gccactacaa gaaagaaaga gcttcactag ggtatctttc tttattacac attcttaata     55500
     ggcagagaaa acataatgcc agagagggtc gttaatgaaa taatcatcac ccatgcatct     55560
     ggtatcaagc cgtagtactt tgtttcaaag tctactcgaa acaccatctt ctcggtttct     55620
     ccaaagtatt gagtgacatc aaccaattcg aatcttcggg gctcgtactc tacaacatcg     55680
     tatctgtagt atccgggaaa ggagattttt agggagttcc aggtagaggc cccatgggaa     55740
     gctgatgata tatatgtatt tccaacctta agtgtgtcga acgaacttct tgatatctcg     55800
     atgttgtctg caaatacaaa aactagaaac aaaagaaaca ttttgactac agggcgggat     55860
     attagccaaa aatatatttg ctgtaaaaca tttaggaaac tcctatggca gattcccttg     55920
     ggccttattc cttggataaa ctcccggccc atgaacatcg aggacacgtc tttggatgcg     55980
     aagaaaagat tcaaagctct tcttgcaaaa agaaagaaac tgagaaaaca gattcgaacc     56040
     attgaaaggg aaatgtttag gcacgagact gtgtatttgg aaatgaccca gggatctccc     56100
     cttacaaaga atgtggaata ttatgtttca aacagggcag agaagaagaa gtataatgta     56160
     gacgacaaaa tgagaatctt taataaaaac ttccccagga ccgatcggta gagaaggctg     56220
     tgtttgcaga gctccctagt ttggtcgagt aaaaaatttt caagacccct tccatatgaa     56280
     aggagaggat cgtataagga tcttgaatac ccagacaata caagtggaga aggaagatca     56340
     caccattatg aatccgttaa ggtggtgtat aagtaaaaat ttctatggag agaatgtgga     56400
     gctcgtgggg tacaccatcc cacacccctc cgacgatgct tccaacttaa ccattcagtt     56460
     ctccaatgag tcgtctcaaa cacctccaaa tctctttaag aagatgatgg agggcttgga     56520
     gtgtatggaa gccatcggaa gaaaaatgga aagtgagata gagaagttcg aaggcaaatt     56580
     taataaatag aggacttagg tgtcatttgc ttttaggccc aaggcatgtg ccctaagaaa     56640
     agcctattca ttgcatgtgt agaacaacat taatggatat ccacaaacat ctttcatctc     56700
     caaaattttt tctacgcctc ctgctccata tccatgccag ccttccccgt ccttgacata     56760
     gcagtagctc atggtatttt cttctgttat aaaagaacaa agagagaaag tgtggcttcc     56820
     aaggcttata ttcgaaccgt tcagtatatc gatgcctccc tgttctttta cgacaagtac     56880
     aagaactggc ggcttcttgg ttatctttct atttttaacc tttagactcg aatcaaaggc     56940
     ctcttggata ttggagaatc cttttaaaga caccctactc ttttcaaaag agatctcctg     57000
     agattggctt ccagaaacag cttttccctg aaatatctct acaattggag aatattcctt     57060
     gtaaagtagc ttaggcttgg ctccttgggt tttacccatg gtactccatg tatcctcctc     57120
     aaagttgtag tattcgcaga gctcgtcgtg gatcgcctga agaagttctg aatatatatc     57180
     ttcgtatact ttcgaatctg actccattaa aagatcgctt gcattggttt tcttctcctc     57240
     catcagcaag cgaagaaatt ccgaaattct gaacattatc tggcattttt ctatatcttc     57300
     acctttctct ctgaagttca ggataaagtt gtagaaggga ggaagcctga caagacatat     57360
     cagtaagttg aatatctttt cgtcagactc cacgtattca agatccacaa ctccaatatg     57420
     cctttccaca aatagcttat ttcctgagag taggattttg ttcccattca gtctccccac     57480
     aggcctcttt ggaagcctag gcggctgtct agtgacaata ttatattctt cctcggccgt     57540
     catttcgttc aaaaaaaaga cacaggactc tggttttgtt ctcattagtc cgattctcag     57600
     gatgtaaatt tttaagttca tttgaagagc taatgaaatt ctcccgtagt acacttcgat     57660
     ttaagaaggt aagagtttta attagtgtta ggactgattc aaagatgcaa tgatgtctag     57720
     tatttctctt ctgctcatca caacagaaga tgaaatcgac tcctggatgc tcaggtcgaa     57780
     gtaactaaac aagttcagga tgtgcagaac tattggactt ttcaatgaca agctgtggag     57840
     gtgaatatca gagttcagat agtcccttgg attcaatcca aacacagcct taaaacaccc     57900
     cataatcgac gtctgtattc caagaagctt aagatagcta gaattgtcga ctccatttac     57960
     atggaccagt tggttggacc ttgaatacag cataatacta ttcttcctaa accctactct     58020
     ggaagatgag agtcttccca gattggtttt catctccact ctcttgacaa gtttagctcc     58080
     atccatgctt attatgttat ttggagagta ggtgtatgca tgaattgttc ccttgatgtc     58140
     gcaacacacc atcgaaagct cattgccagt aataagaagt tctgtagagg ttgcattctt     58200
     aagaggctcg ctagagctta tcaggtggag tctaattggc ttggactgga agaaaaagaa     58260
     cgacaagcct ctataaatgt cggatgcaag aatgtagttt ttaaccacag atatagagga     58320
     tgtaaatgtg tgcaagtcat ggaaacctat gggtattatc ccgctgcccc tgtcaatttt     58380
     gtaaatcatt atcttggttc ccaaacatag tacaatctta ccacgaactt cagagcattg     58440
     gacaatcgat cccttagtct tttcaattcc caaaaccttg agtttacagt ctttgaaagg     58500
     gctctccaac gacggaacaa cagaaattat ttctagtaca tgaagccggc ctttcgcagg     58560
     cctatcttct ccttcaatga aggttgtgca aacaagtaga aaaggggact ttccataatt     58620
     tccctgcata tcatccaaaa cgagatactg gatatcaaag acatactcgt tctcttctaa     58680
     ttcataagta cttatatgct cgtatttctc cgaatacagg tcgacataga accgataggt     58740
     gtttacagga actccacagt cttttccatt ctttggggaa aactcaactt cttcgcatga     58800
     ggctactacc atgtaccgat ctgcatactc gatgtgcttt ggtgttctaa gaactggaat     58860
     ctttttccca ataaatccgc ttccaaaaac atatccgttt tcaatgctgg ggactctgca     58920
     gaccattaga tagcctttgg agagttgtat cacatcgtct ccatccatag ctattgaatt     58980
     tagagtgtac tgacttctgt acaaaaaatg tcccttgtct gttggaacca taaatacgtt     59040
     ggttgttgct tttatgaata ccattgtacc cacattgtaa aatgccttgg tctccggaga     59100
     tagattgaag gcaatgtgtc ttggaagatg tattttgaaa aagattactt cagaaggaag     59160
     ggtttccctg agaagtgcct ccagcccgaa ggattcatat gcaaccatgt aacctccttt     59220
     caatctgaag agcataagaa tcttggtgcc cgttgcaagc atggccatct ctataacggc     59280
     ttcatcatcg ttcttctccg atagatctat aggtacagat gtctccgatg aaaatcttat     59340
     cgcgtatgga acgcctctta ttgaacaagg aggaaattgc cccatccgtt tgtctatgtc     59400
     gaagatgctc aaaagatcat cagaaagaat aaaaacctta ttcccgatat ctgcaaaaca     59460
     tgtaacgtta gggatgcagg taaccacggt catctcccta tcataaaaaa caagtctttt     59520
     ttcggaatcc cttactgcaa gaaataatcc actacaaatt atttttgcct ctgccgcttt     59580
     gctagtaaag tctcctctac caccttaagg ttatgatcca ttcccaacca gaaggtaggt     59640
     gtaatctgaa ttattccagt gccgaactcc gcaaaaagta acgtgtccat atctttagca     59700
     tattttccat ccacttccaa aagactcttt tcaggccatt taaagacctt tgtatcccct     59760
     gctctaccca gaatgtagaa gtctaagacc cttgaacaat acaaatatct tcttgtcttc     59820
     tgagacttca agattttcaa tggcataata ttgcttacaa cgcgtactcc gggctctagt     59880
     ccttcaacaa caaagactgc ttcattttct cttttcatcg ccacttcatt caaaaatccg     59940
     atgtttgaaa tctcgtcaac ttgatggaga gtaaaagttt ctccagctct tgactcagaa     60000
     ccttcattga aaagcttggc atactcttca tcttgtttct gggtttcttg gtctttgttt     60060
     ccaaacagtt tagaatactc ttccagtaca cttctttcag ccgggatgac attttcttct     60120
     gtccttcgcc ggaggctctt tatttcaaac aactccgagc tgtcgcctat agatccaaca     60180
     aataagaggt tctccacctc tcctatgcaa ctggctatag atcctcttct ctcaaactcc     60240
     agagatgccc ctatgattct ttttatgtcc atcgatatct cgagtctata tcgatctcca     60300
     tttccattga atatcaggca ggtgtttcct ctcgaaaaga aatttacatc aaaaagaact     60360
     acgtcgttaa gtgctttgcc cgcttcacat gcttcggaca tcctattcaa aggaaccgag     60420
     tacgagctgc ttgtagatct tattaatata gagttgtgtg atataaacag taggatggaa     60480
     ccggcacata ccaccttaaa tgtttttggg ggaactagaa actcgtcgat agtatggaat     60540
     tttcctgcac ttagatcaat cgaaaacact atggcattgt aattccttac aactgtgtac     60600
     ttcttaggaa gcgaatcgta caccagacac acagtgggaa tggaatagtt ttccagaaaa     60660
     gtaaagtcga ttggattctt gatctttcca tcgatatcta taaacttaaa gacctttgcg     60720
     ttgaacatcc caggaaacaa aggaaagaca ctaaaataac gcttgttcat ctgaaacatc     60780
     cctagatcag tgcctattcg gacattcctt atatcttcgt ctttgatgtc gaactcatcc     60840
     ttttcgaaaa actttaaaga cgttgtcttg aattcgtttt cctgaggatc aaacctcaca     60900
     agagaaatct ttgccttatg aaacagaaaa actagaccgt cttggtctgg agatatccta     60960
     tacttttcca cctggcaaac tctctcaaat agaatatgct gcttcaccaa aaccagcccc     61020
     gagccgtact tccagagtct tacgatgttc ccgttatatg ttagaaacga atgtgtcccg     61080
     ggtataaaga accctgcaga acatccctcg acgctgttcc atggactctc ttgtgaatat     61140
     aggtagttca ttggggttgc aatttcccgg tgccaaaccc ggttttccca ccgaagacca     61200
     tattgcaagc aaatctcgca ctggaaaaag atgaacatag gggtataagt ttaatacagg     61260
     ccggtctatc ttccagcctc aggcttattt ctttttgtga ttgttagaaa gctgattccc     61320
     aaggcttctt tgaatgtgat gatcactttt gaagccacca agatgtagta aacagaggaa     61380
     aagacaaaag agacagctat aaaggcttct cggaacttct taggattttg tagttgtaag     61440
     acaacggaaa tcatcagata catcaaatac acggggatga acaggaacaa gtcctttccg     61500
     atgatgtatg aaaatacctc gttgacatac tttatcgaaa atatctgccc aaacattaaa     61560
     atgtttagat attgtatcca caaactttct gtactgagag tgttgtgaag aacaacgaac     61620
     gatgctatga gggacatcat ccttagaaaa gttgagtata aagaaagtct ccttggagga     61680
     cgcattttgg attctatcga tatcaaggtc aatatagtat tgccaaccag gcatgtagta     61740
     atgattgccg agattgcact aaagttgttt gttctcaaga tcaaggagta agtctttttg     61800
     atgggccaga ggaactcgtc ggaaaagaca tattggaaaa agccttttcc acatagagag     61860
     gtaataagat gcgatatcaa agcaaatgct atgccctctg aagctccact gatttttccc     61920
     aaaacaaagt gcccggtgaa tttttcctcg attccagcaa gatagaactc gatcatgatg     61980
     gccaatgtga atatcaagaa tttctgagat agcccaaatc cgaatgcaga ggaaagagct     62040
     atgcttgtgg caagtgcaca gcatgaatcc accccatggt caaaaagttg tcctaaagga     62100
     gacccggacc ctgttttcct ggcctgggca ccgtctagat tgtcgcatgt aaagtacaca     62160
     aacatcagaa aaaagtttac caacgaaaga agtctgggcg ggttgcataa gtagggatca     62220
     aatatcagag ttaggcccaa gctgattgcc attgcaataa atccacagag agttagtgta     62280
     tttggggcta ctgttgcagg tattttttct agtgaccatt tgacatagtg atggattaca     62340
     tacttcgaga ggatggagtt gtctgttcca ataaatctat gtttccttaa gcttgaaagc     62400
     tcatcagctc ccagctctat tttgaagaaa cttcctttta gcatcggggg aggagtgtgg     62460
     ctgaatatat aaggatgcag tttaattctt tttgataaat tactatataa ttccaaatga     62520
     ggaactcgaa agtaacagag aagaattgag gatttgcaac ctgtatttga aggaatggaa     62580
     accccccaga aagttatgat agatgccaat aatgaaaaga aaagccagtc caagcagctt     62640
     tgtccgataa agattccgtt ggccgggcct cttaaagaca tgataggaag agaggtggga     62700
     gacaaagctt ctacggtaat tgatattctc gagggggtgg tacctacagt gtctccagaa     62760
     gacatgtaca gcgagttggt agaggcgttg agtcctgtag tagaccagaa ggcgaaagga     62820
     ctagtaggaa aggttatggc gtacaaaagg aagacttgcc gagatggaga cgaatgtaag     62880
     gcaaagaatt gcattttttt gcatagctgg gatagaaaga gtggggaagg ctctgtccag     62940
     acagggtcca agggaagaga agaaggaata gatagcgggg aggtgactgg aaagagaagg     63000
     agaacaaatg aatcaaatga aaataatgag gtggtgttca acaaagtaaa cgagtcaagg     63060
     cataatccag aaaatctcaa ggcttatgca gcgagatttg ggaaagttgt gaacttcaag     63120
     aggctcaatc ccgaaaagta tcttgttgtc ttcgaagacc ctgagtcggc cagtgaattg     63180
     gtgaaatcat cggagccggt tctcgaggac tttggaatta agaagttcta caatgttata     63240
     gacaatcttg ttaaggtaga actcaaaaag ctgtttgaag agcaagaaac cgtgatagac     63300
     aagatgtcta cggagttttc tgctgcactt ctgggacatc tacgaaacat aaatatccga     63360
     ataaggaatt tagttctgaa agagaaatta aaggacggaa cagggacaga caacaagaga     63420
     ggatttgatc aggaaaacag tctatattac aactgtttct gaggggcaaa cccctgtttt     63480
     ttatgttgtt cgctcttacc ttggaggaag agcggtggta tttattgaag ttaatcttgt     63540
     tgtcttaaac cctgatgaat aaggacaaga ttaaaaagac tcaactactc agtgacttgg     63600
     ggagatttaa aggaaaaaaa ataacagtaa ctttcattga tggaaaatcg gtgactggaa     63660
     agctcacatc gtttgatgac gttggtaact gcgttctgaa aaagtgtgga gaatgggact     63720
     atgggaatac cgtagtgtgc ttgggaagaa gcatagtact tgtgtgttta aacgcaccat     63780
     acatcctgtg atgggccgaa gctgccggca gttcttgatg ctgttaattg aatgactgat     63840
     taaataaaac atactttgga tatttatttc ttttttcatg gccaagtttc tcctttcttt     63900
     ctctcgatgg ctatcactca aagaacctgt aaaatagata aagaacgtta caaagaatgt     63960
     agatatggac aaaaagtaca atggcacctc gatcctctga acactcgacg gtttctttgg     64020
     ttatcttctc ctcttcttcg tacaatattc ctattctgga tgtccagcat ggcttaggcg     64080
     agacagactt gagataatgc ttgaagtcat ttagagatct tctccagtcg aacttgtaga     64140
     tctctataag gaacttgtgt gtattatcgg gaacagtggt ttcagagagg gttacttcaa     64200
     tctcggcatg ctgcataggt actatcaggc ccatgtttgg tcttactatg tagtctctgg     64260
     gcttggttgt tttgatcttg tatcctacgc tttccatgga gttgttatgt acaataaaag     64320
     tcgaggactt cttgtttctt ttaactctaa tcgttgtttg cggtgtgact ttgatgtcca     64380
     gcatttcaag gggaatgtct attccctttt agtaactatt cgtcattgtt tattgtaaaa     64440
     cttggcaagt tcagcgtatg aggagctgaa tatggaagat tgtgacctct caacggaaaa     64500
     gcagtcatcg ataaaatgtc ttttagatag gcatattgga catgctttat atattgtata     64560
     cttcgacgtg tttccattta gtctgtatct tttccatgtt ctacagcagt ctgctatgct     64620
     atgacttcct gtgggacagg ctttgcatat cttcgatccg tttagatcct caggaaaaga     64680
     acagttcttt gaggaatgtc cgaaccttct acactttggg cagtgtctgt agggacaata     64740
     ggttctttcg tgtccttccc gactgcatag atcacataca tcccttttaa gagccctggt     64800
     acattcccta aactcatgcc ctgcctcccc acattggaag cattttgtgg tatcgcagaa     64860
     atatctctgt cttttgtctg ttgaggagct tgttgttacc accttttctt ccatctttac     64920
     atcttcaaaa tggtaagcca ggcttagaat gttgtatagg gcgtttgtat ctatttttct     64980
     taaagaaata tgtggatcaa gtaagtgaat atctaggtcc tctagctcaa cagtcttagt     65040
     tccattgacc tctttggcat agtccagtag agaatgtgct ctcttcattc ctcccccact     65100
     gcagtaaaca tttatttgtc acaaaaaccc aagaaaagaa aatttattgt gagtatttcg     65160
     gcctctttac ttcttacgag gtatccccat ttgtttcttc ttatattctg aattgttaat     65220
     gaaatcggtt ggcttgagga cctggaacga gcatacaagg tccttatcta catccattat     65280
     tgctccagag ttctcaaact ctccacagta gtttggagcg gaaaacactg tgaccaaaga     65340
     tcggtttgca aaaaactcgt atccatcctc tactacttga tgtgccctgc atataaggtc     65400
     caggttatgt gtctcaagaa acttctccac agtgtcgggt ccaaatgtca ccgaaacccc     65460
     tctatcgttt tctccccatc ctcttacacc agggtccgga tcgctccaaa gaagatcaca     65520
     gagaagccct tcatcgggaa catcggtggg tcttgcaatc gccttgatct gatccatgtt     65580
     cttcaagtct ggcgaaatcc ctccgtgcat acagagaatt cttccgtcaa caagggcaga     65640
     tatagggatc caattgaagc attccgtgaa cactttccat attgttgtgt tatatcttct     65700
     cttgcattca tcgtagaacc catatatcct attgatactg gcacattcgt gatttccacg     65760
     aagaaggaaa aagttgtttg gaaactttat cttgtatgcc aatagcagac agatcgtctc     65820
     caaagactgc tttcctctat cgacataatc tcccagaaac aggtagttgc tggagggtgg     65880
     aaacccccca tgttcaaaca acttcaaaag atcataatat tgcccgtgaa catctccaca     65940
     gatcttgact ggggccttta cttcaaccag agtaggctgc tgcttgaaca cctccgtcga     66000
     cttttcgcac aagtatctta tttcttcctc cacaagatgg acaagccttc ctagcttact     66060
     gtttcgaaca gaaagaagct tctctattat cctgtccaag tcaacctttt cgttactcat     66120
     ccccgtaacc cctctgaaaa ttttaaaaaa atcaatagaa tccgcggtgc cttcaactct     66180
     ggactaattc taatggaatt ataaagttta tttaaagtcg aaggctagtc gaggctcttc     66240
     agctccccct tcaacttata ctcctttagg attaagttta attcctttat agataattct     66300
     tctccatcct tcatcctgtt cttcaaactc tcgatctcct tgagagtgtt caacagatct     66360
     tccttgctgc ttttcttcgg tttctcatta actgtctcct ccttcttctt gggcattctg     66420
     ctcttggaag ttgtttttgt catgaaggtg tggatggagg ggggaacgta cttcttctgc     66480
     atctcaataa ttagcttttc gggtttttct atctcgacaa actcttcctt ttccccatag     66540
     gagcaggccg aaaacaaaga ctcaaacttc ctttcgtcta tctttcttcc gtagtagtcg     66600
     tagagagtta ttttgttatc ttcttggaag tagcttgttg tcgagacaca gaaatatgat     66660
     ccattttcct tccagtcgat caaagatgct ccaagcacat tgaactttgc tataggcttc     66720
     cttgaaggca catggaaaac ctctatgtct ccagagagat tatcgaagcc tgcaaacact     66780
     gcaatgtttt catgctggtt gaagaacatt ctgtttctga taccttctgg gaagttgtat     66840
     ccaggcttgc catcaagcct gtgaacagaa acactgctag gctgaggccc atggcacact     66900
     gcaaatccat tagagagaaa gacataggaa tggactggcg aatatccaag acttttgaag     66960
     gtgcatgcgg cagtatcatg gaaatacagg tcagactcgg ggaagtagct gttgttcaca     67020
     taggatgtca ttagaagaag cagtatgtat ctgtttgatg catgggcctt caaagagaag     67080
     ccttgcagct cctttaagct atgaagaacc tctaccgaat cttttcccat ccgaaggagc     67140
     ttgtgcattc catccttctc aagctttttt gtggcaagaa aaacaaactc tccggaaata     67200
     aggaactcta gaatcgaaat cctggaagta tggaaaggag actcctctat cccatcttct     67260
     ccgatccgat gaatgaaaaa tgatgccccc gatatatatg caagcaggga attagaaatc     67320
     ctgaacttgg atacattctc cactctcagc atgatgccat tctttccaag cacaaccatc     67380
     tctccttttc cattaagtat tcctacgtta tttccgtttt cagacgcctc tatttcccta     67440
     ggcctattta tctccatctc cagaatcatc ttcttattct tgagatcata gtaccttact     67500
     tgattgttct tagcccatgc caccttgttt gacttcagag agtagtaatc gcactcgacc     67560
     caggatgctc cttcagcaaa cacatcaaaa gttagtccat tttcactatg agctacaata     67620
     ggcattaggg gcttaaggat ggagactgaa tcattcaaag ccgtgggtaa ttacaattcc     67680
     ttgaaagaaa ggagagcttt tcaagaggaa ataacatgaa gaaaagctgt ttaattcatt     67740
     atatcttttg acattccaat atataactcc ttggaagggg gagtttcgga atccaggact     67800
     tccagatatc ttttgatcgg cacctcgggc cagtttctaa ctctgcccag taattttttg     67860
     gaaggaaaac gcccattctt acacaaggta agaattcgaa gaagtatcat ctttggagaa     67920
     aacagaggaa tttcttcggc cttgatccca aagtcgctgt tatagacctt ttcgatccat     67980
     aagcattcgt ttcccttcat catttcttct ggtgtaccgg atcccgggaa gttcttctgg     68040
     aaatgtagtg gattcgaaaa tcttgatatg gcaccggtat taaattcgac tgtttccctc     68100
     tggtttctca gaagcacatt agcattcgca tcttctccct taacattctt cagctgctcc     68160
     tctacaattg ttcccaccat ctctcgcctt tccaattgat ttgaaagaaa gtttacaaat     68220
     gtctcttcct tcgaaaggtt ttcaaaggac aggttaaata tgaagtctac ccggctttca     68280
     ttctgactaa agtgatatct tgttaagtcc tcaaactcca caaggtcgtc cttttttctg     68340
     agctggaatt tgtttccaaa cgtatattgg ttcttgtcgg ccaatattgc caagcttttc     68400
     atagcttgaa ggttgatcac aatctcatca tccttcttaa tttcagaaag cactttgtaa     68460
     gccgtgttgt aatatcccag atagtataga cattgagaag caagaacctt gctcccttcg     68520
     gtatccaagt acctcaaaat cctcaatgct tttttgtatt tcttcaactt gtacaatgca     68580
     taagctctct caaaagatct cttctccgca tacttcaaag cctctccaaa cttccccatg     68640
     tttatgtatg caactgccct gaatcggttg aactccgggt gatccaaacg agatatctct     68700
     tcatgcgagt tacttctcac caggtcgtac aaattcatta gggtggctcg cccatggaat     68760
     tttacctttc aagggggttt ctcggcttgt tgagacacag ggcattattc ttcatatctt     68820
     ggcaaacggt attttatagt ctcagatgcc aaggacaatt tatttaatct tctttatcga     68880
     ttgtttacaa aacaagggag atggttcatg ccaaggaaca gattaaagct gtgattcttg     68940
     tgggtggata tggaaccaga ttgagacctc tgacgtacac acttccaaaa ccccttgtac     69000
     cctttgccaa caagccgatt ctaaggcatc aggtggaagc tttagtcaaa gcaggcatca     69060
     aggagataat cttggctctc aattattact ccgaagttat aataagggaa gtccgggact     69120
     attcaaacga atttggtatc aacattatct attccaaaga acaggaacct cttggaacag     69180
     ctggtccctt ggcccttgca aggaagtatc ttgaaggcca tacctttttc gttctcaact     69240
     cagatataac atgcaagttt cctctatcag agatgctttc atttcatcgc tctcatggaa     69300
     aagaaggaac tattctctcg acaagagtgg acgatccgag tagatatgga ctcgtcatca     69360
     ccgaggaggg tacaagcgtt gtggagacct ttcttgaaaa gcccaaggat gccgtttcaa     69420
     acaggatcaa tgcaggaata tacatactaa actcctctgt actagataga gtggagctga     69480
     gggaatgttc tatcgaaagg gagatctttc cagaaatggc caaggaacgg caacttcaag     69540
     tatttgatct tgagggattc tggatggaca taggccagcc tgcagattat attagaggac     69600
     aaggaatgta cttgaaacat tatagggaag caaatgtaga tgagcattct gaagacggaa     69660
     gaacgttctg tgtcgagaac aatgttgtta tagggaggaa tgtgaagata ggaaagaatg     69720
     tcaccatctc aaacagtgca atcttcgaca atgtggaaat aggagacaat gtgacaataa     69780
     gagatagtat tgtgggatgg aatacaaaga tagaagataa tgcaactgta aacacatgct     69840
     gtgttttggg atatgcaacg actgttgaaa ggtttgccat cttaagttct gttaagacat     69900
     ttccaaatga atctccattc aagttactcg aggatatcta gaattgtttt taggccagat     69960
     gtgtgaataa atcaaaattg gattctttta ttctttgtag aaagaacttt ttgctccttt     70020
     ccagatggat tcttctctct agattggaac tcctccaaga aacttgggct tgtacccgac     70080
     agaacggtgt aagcagcgag tatcttcgat tgtatatatg gagaaccacc tctttcctta     70140
     gagttggcct catgcatcct tagaaatgaa tccttcattt tgttcttgtt tgcacatgcc     70200
     gtgacatcca gaatcatctc tgcttccgtc ttagacatcc gatctcgaag cataatatct     70260
     gaaattgtat ttgtgatggc cttgaagagc accttactac cctcctcaaa aagaaccacc     70320
     aaagcctttc ctgccttcat aggggtgttt cctctgtacc tttccttata tttcaatgca     70380
     gtctgccatc tccttatatg ttactccgct gaagagatac tcaaagcaga tattctctgt     70440
     ttcctcctct ttaggaattt cctggcaccg gggttctttg gaaatccatc tatgcccagg     70500
     aattgctaag gattcctcta agtttatgta ttttccaact atggcttcca ttccatttct     70560
     attgttggtg gcaatgagtt gctgaagctt cttcttttca gacatgaagt ctatgaaatg     70620
     aattaggaag ttgaaagaac tttcaacctt taaacgtgga tttagagcaa tccaagcatc     70680
     ttcatccctt atccatatgc taaatgtggc ctctttatgt agaaggactg gctggccttt     70740
     cacatcaaag gatttgtttt cctttttacg gataagctct tctatgaata atttaaacac     70800
     ctcaaaagca agaaacgaca agcttctgtc cctgcttcca aagaaggtta tgaagtactc     70860
     tagattatga aacattgctg tacggaccat aagaaccatc tgctttctag caaggcttct     70920
     tttttttagc ccaaggaact ccacaaccca gtttcttctg gatttcatca aatcaaaaaa     70980
     gctcttgcat tcgtaatgag gcttgtacag caacttctgc aaggccaaat caaataaatg     71040
     taaatccaac ttggagatca gtgggaacat gtactcccgc agatataaac ttttaaagtg     71100
     tcttctaagc aatgattcag gtatctttgg tggtatgtca agacagtaaa ggagacgata     71160
     agttatggaa agaagctggg tgtttttgaa catggccaga gcttttacaa gcaccttaga     71220
     cacttcgcaa tgactggagg gctcattctt caagtagttt ctaaagcaag taaagaactt     71280
     ctcatagtct gacggatcag tatgatcctc cttaatttca aggaagttcc tcgcccagtg     71340
     gtccatagaa gtataactat tgttaagggc tttcccaggg ctgaattagt agggcttccc     71400
     taagacatct tgatgtgtct tgccccgtgg agagtctgca gaaaaaattt tcagggaagg     71460
     gtccccttga aatggatgtt gagatgaaaa aacaagacat agatgtaaca gtctccatgg     71520
     agactatgaa ggtctgcata gatatggcaa gcctcgagga aaagagaatc aacaaggtgt     71580
     gcagagagtt ctacgagtat gggaagacat tcattgacaa tctggagcgc gagacagttt     71640
     tgcctaaaaa gattgaaagc atcacgacct taagaaaccc gtccggacaa ggtacaaaga     71700
     aatggagccg atataaaatg attgtccacc ttaggaactt ctatctcgag gccacacatc     71760
     agcagctgga aaaggtggtc cagttcctca ggaactttcc gcatgttgaa attaacctaa     71820
     gcattcagaa ttaaagttcg ttgagttacg ctattaagat tttattggtc gcaaggccat     71880
     gtatctaaag gccccccttc cagatcatct tcattcctca ttcccatcat aatggtcatc     71940
     ttcaaaggat ttctcaaact ggagctttgc attttgaaag agcttgattt gctggttgtg     72000
     gagctcttcc atggacagcc cagagtcctt gaatttatcg attttcgacg gtttctgctt     72060
     gatataattc tcatagttcc catgctcctt catgcagcta tcgacgtagt cttcaaaccc     72120
     aaggtttttc agagccttgt agatatgttc ataactgatt gtcttcttct tttcttcctc     72180
     acaagctttg tttgcttcca gtgttaacat attcaagaaa tagatgcacg cattctggaa     72240
     aatctccttg gattcctttg ggacaatgga gttcttggga agcatagatg acaccatctt     72300
     gtccactgta gcttttggta gtgtgttttc atcatcgttc ctttccatat ttatacctcg     72360
     attcccttgc ttaggatgat atttatggtt ttggaataag tttgttttgt aggaaataaa     72420
     tgcggttctg gaaagaggaa tgcttttgaa tatttccaat ctgtttatgc ataatatgga     72480
     caccgaattc ataagcggag ttgttgtctc ctacaccaag cttctaagag agataagcaa     72540
     tatgaagaag gaaatcaaag aggttttggg aactgcccag gctgttttat cacttataag     72600
     cgcatgccat tccacagaag catcttgcag atcttccggt tgtagatgtt cacacagcct     72660
     agcagaagct ggagagaaaa taggcttagg atcctacaaa agaacactta agagccccaa     72720
     gaagcctcta acagggaaga aagaacccag tcgtcgcaaa gggacaggta agaatagttc     72780
     attaataaca gacagccatc ctagtttctt tgaggaggtt ggaggtgagg tatgcagccc     72840
     acagaaagaa ggggattcat cttgttgaac cggaagtttg gctcaaaagt gattatatca     72900
     ttctaaattc cttgtattat cttgccccat gaccgagatc caaaccagat cggttcctat     72960
     ccatcccaag aagatgagag ggatgaagga agaatggatg aaaatctata caccaatagt     73020
     cgaaatatgc aagatccaaa tccgcatgaa catcaaagga agatgtgtgg aaatgagaac     73080
     ttgcgatcat accgaggatt cctcctactt agagaggtct gcgcaataca ttaatgcggt     73140
     gaacatcgga tttcctattg aagatgcaat tgcaatattg aagtttgccg acgtgtttct     73200
     agatcatttt gagatctcag aggtaaagac gctgaggggg ctacatattg aaagagccat     73260
     tggaagaatc ataggaagag aagggaagac aaaaagcgcc atagaagagt tcagtagatc     73320
     gaaaattatt gtccaagacc aaacaataca ttttcttggg acgatcgaaa acataagaat     73380
     agcaaaggat gcagtgtgca ggctaataat ggggtctcaa ccgggaagta tcttcaacag     73440
     actccggatt attaactcga gacttaagga gaagtatgga gggatccaga cggtatatag     73500
     tgagtttgag aagagatagg gcgatatacg aaaataaacg tttggacact tttattattt     73560
     ttgcaggaga ttaaacccta gatggggatt tcagggcttt tacctattgt ggcttccaag     73620
     ctggtgaaga tgcatatatc aagctatcgc cacaagaggt taggaataga cggccatgca     73680
     tggctatatc aaattctctc ttgcgtggca gaagagatgt ttttcaggat tcctaccaaa     73740
     agatatgtaa gcatgtttga ggagaaggtg aagctactag aaaactatgg aatcacacca     73800
     attattgttt tggatgggga tttgctgtcc agtaaggaag agacaaacag aaaaagacag     73860
     atcagaaaag aaaagagtag aaaagaggct gagtattggc taatgaagaa tgatcctgaa     73920
     aaggccaaag catttatgcg gcagtgcata agtgtcacaa gaggagtggt gtctgacatt     73980
     acgaagatgt tggaaagaat agatgttgag tatattattt cgccctacga gtccgatgcc     74040
     caactctgct atttggagag aatagggtac atagactaca ttctcacaga ggatagcgat     74100
     ttaattcctt atgggtcgaa taggatactt tataagtttg acaacacctt tgtacgggaa     74160
     tttagtagga gctgccttgc cgaggtaaga ggtaaagatt ttgaagagaa tattctcgac     74220
     atctccatac tgagtggatg cgactacctg tcttccatac aaggtgttgg cattgtaact     74280
     gcccacaagc ttctctccag ggaaagaaca attgaaaggg tggttgaata tctgaaacac     74340
     cgaaagcctg tcccaaagaa ctatttagat gactttttca aagcaagaaa gacatttctg     74400
     taccagattg tatatgatcc catagaacga aagagaaggt atctccagga cgtaacggag     74460
     gaaatggaat ttttgggctc cttgaaggag gaggagtata aggttgagga aggacctctg     74520
     ggattgtttt tcaagtcttg catgcagaca aaaacagtca agaggcattt tgtcccttct     74580
     ccaaagaagg tgatacccga ggtgatgaaa ataaaaagaa gagaggagtt catcaaggta     74640
     gatgcccaca tacactctcc atattttaag taataaaatt gaagaatcag aagaaagtct     74700
     tcatcactat tcagccaggg ataactttga cttcatcact ttcttggggt gattcttttc     74760
     acgtttctta ttgttcttac aagccgggaa atgttgttat gatacaaaag actgctttat     74820
     taccttgtgt ttctgccaaa cgaattttgg tttggacttc tgtaaggaag ggtgaacttc     74880
     gcgcccaaga agatgtggtc cgaaggaaaa tgcatgttgg gaaggcctgc tatgttttct     74940
     gcatattcat cctcgaccgg agccagtaca gacgttaacg ttactttact gtcataaaat     75000
     atgtagtcaa taacatcctt gaagagaggt gtaaagtttg tgaatccaag gtcttggttc     75060
     cgatacgagt cgttgagctt tagaccctcg ccaaactcct ggctggaaag atggtgcata     75120
     gttcctcgaa agtctgctaa atctattgtt tgggttgtta ttgacttgta gacagatgag     75180
     gatttgaggg agttgaagtc tccctgcagt agcagacatg catttggatg ccgagaactg     75240
     atctttctta cttcttcaat caggaggatc acttgaagca gctttacatc ggaataatcg     75300
     ggatcccaaa atatatgagt gttcaccacc agaacctgct gtccattggg tctctcaaga     75360
     agagctccaa tggctatatt gtctttcttt ccatacctat cgaggagctc ctgattgatg     75420
     ttgaaccttg tgtcctgagt tatcttctgg cagaaatcaa ttggaaattg cgcaatcaat     75480
     ctgaacttgc tcctcctcca aaagattgca catccatcca cattcttctt gtctgcaacg     75540
     tttttaatcc ttcctcgagg atagatgatt gagtcgtagt tgcatctcat ctcaagttgc     75600
     tccttgtaga agtcgaagaa actatacagt tctatctctt ggagacacaa tatgtccacg     75660
     ttgtacagaa ctatttcctg gagaatccct tctcttcgga actctggatt gatcacccac     75720
     gatggcgcat aggtcgacct tgcagcccag acattcgaca gaatattgaa ggttccgacg     75780
     cttattgtgt cgccatacaa aacgtcctta tttaaacact cgatccatgg cctatcgttt     75840
     ggtggaggat atcctgtgtt gtgctctctg cagaactgaa gaagcttctt ttctctcaga     75900
     agagtgttga atggcactat caacgggttg ttggatattt caaggacttc caggttatac     75960
     aaggtcccta tttccatggg aatatttgaa atcaagttat catttaggtt aagctccttc     76020
     aagctaacaa ttttcccgat atctggtgga atgcttctaa tcttattttt actaagattc     76080
     aagacttcaa gatgtctcag cttgcatatc tcctttggaa tcacctctat ctcgttattt     76140
     gtaaagttca ggactctgat gaacctcatg tcaaatagag acctggatat atttcttatt     76200
     ccttgggagc agaggtccaa ggcagtccaa ggatcctctt gggcctctgt agttttttca     76260
     aaaaactttc ttcttaatgc taagcattcc tctgccatgc ccaagggcat tcccgggaaa     76320
     aactttcaca atcggtacaa aaatttgtaa tctcaaggcc attctcgaaa tcgtcggcaa     76380
     gtctaagatt cctaagcgtc tttaattctt ggtgtgatgg ttaacatcaa caatataatt     76440
     ctttccgagt agcttgttga ggccagcccc tatggtatcc atctcggctc tactgaagga     76500
     tgtccttctc tccagaagaa catttacaac catatcatca actccccgga catctgtcct     76560
     tgttcctgtg agtagaaacg ggaaacaggc attggccagc cattccttct caatctcctt     76620
     tggcttacaa tgggctcctt ccgggacatc gctctcaatc tcgaagtttc taatgaaaat     76680
     tatatagtaa tcgtggaact gctgcttggc tgccttgatg atattgctgt agttcatctg     76740
     caccccatga agaatactct ttggaacctt aacaaccata accttctctc ctccgtcgca     76800
     tattattatc tggatggcta tcttcccaaa aagctcgggt cgaacagaaa tatcctttgt     76860
     atacttcttg atgatctcgg aaatattcgc ttcagcctcg gtttgtgtgc tcatagacaa     76920
     agggtgaaaa tttttcatct ttttgaggag agcttaacgg ccgtcctgat cggaaatcaa     76980
     aacctatgaa caaaacagtc tcctttattc gctattgaaa acaacaaccc tacgcaacgc     77040
     ctcctcaaac ttctcatagt tgatgttctc tgtaattata gagcctcctc cgctgggatt     77100
     aacatagtgg tggagaatcc tttgctgcga cttgttctgc tcggtaatgc agaactgggg     77160
     tgttggcagt ctttcgttgc ataaggttcg ggctctttcc tcgctgctct tcaatatatt     77220
     cttgaggaac tcgtattccg cctgttcatg gtatccttct ttgacccact gtgcaacata     77280
     ctctcctctc catacaacta cgttgtggaa tgtatccagg acaagaacca catctggcat     77340
     caaagactta ctgtctactt ccaccgcttc aaccccgcct tgatagtggt atgaaacaag     77400
     cgtaggcttg atgagcttca gtgcatccga cactttttgg ttgtacagaa gtgatgagta     77460
     gtatgctgtt tcatcaggag agttgtttcc tgtttggacc aggagactcc ttcggaaaaa     77520
     gaacatatag tttggatagt atgccatgga atcgggaaga gacaacgaag aaggctcccc     77580
     cttatcgtat ctggcaaacg tcttagtgaa tctgataagg ttcttatcga tcattctttc     77640
     acagtccttt atctcctcat atttctttag aaggaggaat ctagcttgaa agactgcaac     77700
     tgcttcctgg tcgaatccac atactacatc ctcccttgaa tctgtaaata gtcgagcaaa     77760
     agttgttacc ctcaccagaa gtttcttatc acttctttga tattgcgtaa ccagctgtac     77820
     atatccaaac tccccatgct ttgcatctgg ctttttatca agaagaatcg aaatgtttgt     77880
     gcatggaaat atagatccta ttctccagca tcctcctaag gatcttccct gcccaataat     77940
     ccccttgtat tcgagattct tacttgtctt aacttgtatc tttgcattaa atccttgtgc     78000
     caggtatcct tccttgcttc tattcagtac tttattacat gatgagatat aaatatctct     78060
     gtcaaagtcc tgtgccatta taagcatccc tccagtcatt gtggtcaacc gctccatgtg     78120
     gcatattcca acatcaacaa ttgtggctgc aagaatgtca agactgtgcc ctacactatt     78180
     catcctttcc gcaagccctg tatagaactt tcttgcaggc cctgcataca tcggatcatt     78240
     ttcctcaaga tgttcgtttc ttcccttctc cttaaatttt ataggtgttg tcgtcccagg     78300
     cccgaatgtg cagggtcctt gtgtaaacag aaggtacttt acagccgtat caggaaagct     78360
     tgtttctaac agcgaaagag ccaacgacac ggcagagccc gtacatctta caggcttgta     78420
     tgcaggaaga acaggaaatg gatccttctc aagaccttcc actatgttct gtagaaagtc     78480
     acggcattcc tcttttctcc tcagaaacct tcccacaact tgcgattcag acttcgaggc     78540
     tgcattcaag gacttgagga cttctgctgt atattccttc ttgccagaaa acagatgtgt     78600
     tttccgtggc gatgccgtac ttagctccag aagttcgatg tttgttccat acttgataag     78660
     cccaattaga gcatcttcgg gaatcccctc caccaccgtc ttaagtgcat ccttaagaag     78720
     tatgtgtctc tgctcatcaa acgtgcatat gtcaacaata agaaagaata ccgtaggaaa     78780
     cacgctttcc ctattcaaaa catattcaat tgtcgaattc tgtggtaata gctcaggcag     78840
     aagattgtct ggtgttattc ctcgtgcatg gcttggtagc gctgtattgt tgttgcatat     78900
     tatacagttc caggtttgtc tcccaaagtc gatgttacaa tgaggattta ggacactttt     78960
     acaactcatg cagtatatgg gctcacattc aagaaccccc gtctcctgat gaatgttgta     79020
     caaacatgct aatggaacct ttgttgtagc atctcccttg gaaggccata cattccaggt     79080
     aagccttatt ccatcatttt cctctatgtt tctaatctcc tcctccataa gggttaacaa     79140
     aaatttctgt aaacatctta agccaaggac ttccataaga tcgcccttaa ttccttctgg     79200
     tccaagacat cccagtgctt ttcaagaaac atgttctcca ttcaaattct atccagcatc     79260
     atcgagttat cttgtacatt cctgcacctt tctttatgat aagcccgttg tggttgagtg     79320
     cttctataaa atcattggca ggctttccgg aatcaaaaga tattattagt ctacgtagct     79380
     cctcaacact aactacccat tctcccttct tccttccata ttccttaagc acctgagaaa     79440
     aatccccatt tcttctacta ttagacatct tttctctagg aacaaacgtc ctcctatgta     79500
     gttcgataca aaaaactgca tctgctcttg tagctatact cctcaattct gctttcgctc     79560
     gagcttctgt tagtctaatc aacgactcca gatcccttgc agaaacccct ccctgcttcc     79620
     ggatctcaac ataatattct cttatggctt cttttgccga tttgctcaga acaggaaaca     79680
     catttgcacg tgcataggaa atatacttcc tcattatctc cattggataa acatctcctc     79740
     tacttcggac ttcctcaata aagtcatctc ttctaatcgt ctccataata tcgtcaaatt     79800
     cacttcctat tcctggagac aatgtctgcc ttttcttcag aatttgccca gatatcatgt     79860
     agctctcctt ttcagacagg tcgtctagaa ggagaaagac aagatcaaac cttgacaaaa     79920
     ggcctgggtc aaatcttatg ttttccatca ttgatttggt tctatcgaag tgtccatgcc     79980
     ttggattagt tgctgctatc acagtagacc ttgttggaac actacagatc actcctccct     80040
     ttgctatgct tactttctga tcttccatgg cttcaaataa agctgcatgg tcgtctatct     80100
     tgtcaaactc atccaaacag catattccat tgtcggccac caccagtgct cctgcatccg     80160
     ccatatattc cccagaaaca ggatcgtgtg tcaaggaaac cgttaatcca gctgttgtgg     80220
     tgaagctccc actcacgtaa ctgctcttcg gaagaatact acatgtcccc aacagcagcc     80280
     tgctttttcc aagcccggga tctccgatta taaggacatg tgtttcagac ctaatcagat     80340
     gctgtcctgc catcttcctg gttcccccaa ataaagaaag cactagtccg atctttatca     80400
     gttcatttcc atacacggac gaataaagcg agcgcacaag agaggccagc gtgttttttc     80460
     cctttgctat tcttctaaat tccgcaaagt ctctactttg atattccagg ctctctataa     80520
     aaaaattctt gttcttgaca atttgaagat tgtttatatg gaccatcaat ctgtagaggc     80580
     cgtcgttttc taattcaact ccaagcactc ctacaatctg cacaatgtct cctggcacta     80640
     gaatccccac aaattcatcg taaagaatgc agtccacagc ctttgggatt ccctttccat     80700
     cttctcctat tcccccatag agctcctgta ttttgatttc ctgcatgtct ctgcattcca     80760
     tctctggatg atttcgcata agaacaaaac tccttgagtt acacgaacct ttgcatcctg     80820
     ccggaggtct gtaaacgttg ttctttacat tcacgtatat tacgtctcca cacttggaac     80880
     actcaaaaaa catcttactg ataattactc ttctgaaccc cactcggcat actgttcctg     80940
     ccataaagac cagcttccca agattggctc tgtcaacatc tccaaaattt ccttccttgt     81000
     tcactgtctc gaccctagta cagatcttta ccgacaaata ccctttgtca tagagtagct     81060
     cggaaacagc acaggaaaca cacagaagta agtttcctgc gtttgtatca agaagattct     81120
     tttcaacaag actctcgaga tactgctccg atatatagta gactcttgct tctagaatcc     81180
     tctccagttt atcctctgat aaaacgtctt tcaatttctt ctttactgca agtattatct     81240
     ggacaagctc gttgaaagca gtgaactctt cctcggggaa atacatgttc catgtttcta     81300
     tgtgcatccc cttggatcta gtactcattt aaatatttcc gaggcttcag gaaaccatga     81360
     tgtaaccggc ttggatggaa acagaatctt tgaatggaaa acaccagcct ttttaccaag     81420
     aacaaaacca tctatttttt ttcccctgga aaatgcctca aaacgacttt gtggaaagac     81480
     atataaaaaa gtatggaagg cgtctggacc acgagctaag gcagtataag aaggacagaa     81540
     gagaagagaa aatggtttca agaaaggccg agaagctgtt tgggctgaag gctaagctgt     81600
     ttgccaagaa gcagcgtgct tcaaagatcc agctaaagaa ggatcagaag atgaaggaat     81660
     tcaaggagaa aaagatggag gttagtattg agagcaatcc acttcctcac ttcctccttg     81720
     acagggaaat ggaagaaagg gccagggaca tcaacaacaa gatcaagcag cagaggcagg     81780
     aaaagggatc gaagtattct gttccattac ctaagattca tcctctccca gaaaaggaag     81840
     tatttggggt agtttcaagc ggaaagcgac gatcaaagca ctggaagaga atggttacta     81900
     agccttgctt tgtgggaagt gacttcacaa gaaaacctcc gaagtatgag agattcataa     81960
     ggccgatggc aatgagattt agaactgcac atgtaagcca tcctgaactg agctctacat     82020
     tcaatctcaa gataataggg ctaaagaaaa atccccattc cgaggtttat acagggcttg     82080
     gaatattgag caaggggacc attatagagg tggatgtcag tccccttggg cttgtcaatg     82140
     gagcagggaa aatcatatgg ggtaagtatg ctcagataac caacaacccc gagaatgacg     82200
     gatgtgtgaa tgctgttctt ctggtataga aaagtagatt tgcctaaata gattatgttt     82260
     acaggcttcc ttcaacagct aaagagagag aagtggagtg ttatcgactt gactaaacat     82320
     atttagtttt tggaattatt tggatttttt actcatcagg gtcgttgata ccctgctcgg     82380
     tgatggcaaa gactgcctcg gactcgggga gacagggcga atcatatatc ttgcatatcc     82440
     ttgtttctcc tctcccctta cgcagataca atcttgttgt gcttgcatgt gccataatgt     82500
     tcccccctat aggcttcttg atgtctccag caaacatccc tacagctcca tccacattgg     82560
     acactacctg attggtgatt atgacagcaa cccggaatgt ctctgcaaga ttaacaagac     82620
     ttcggagata ctttgccaag tgcagctgcc tagccccaag ctcccctctc ccactgaagt     82680
     ctgttctgta tagagcagtt gcagaatcaa ttataagaac cgaatacttt gactccgaca     82740
     tcattgccga tgctttgatt agaagttgag attgatggtc ggaattatat gctcttgcat     82800
     atgatatgtt gtccatgacc tcatctggat ctaatccaaa tctctctgct attggaatga     82860
     gcctctccga tcggaatgtt ccctcggtgt ctatgtacat agcctttccc cctccgcctc     82920
     cctgttctgg aggaagctgg catgtgacag caacagtatg gcagagctgc gtctttcctg     82980
     tccgaaactc cccaaagatc tctgttatgc tcccagactc aaatccacca ttcagtaact     83040
     tgtcgacctc cgaggatcct gtggtgaggt aaacaagctc ggaccttctc tggtgatatg     83100
     ccgatgccgt tgtaaacccc attggaacca gttttgcagc ctccttgatt agcttatcca     83160
     ccttaacatc cgaaaatccc tttatcgaaa gaagctgtct cttcggagca aatgccagcg     83220
     actcgactgt tgtaaaccct gcttctatca gctttgctat gtccacagct aatatccccc     83280
     cgttcttcag ttctgatata gagatgctct cggaatgata ctctgcgtcc tgatattggt     83340
     actcctcgct catgggcaaa ttttttctct ccactttatg cgcttgccat tgactccttg     83400
     gccccatcat tccatcatga aaggattgta aaaacaccca ctgaagcagc cccatgaagg     83460
     aggaagagtt caatgagctc aagcagaatc tagacaacta tacccccctg cttcccgaat     83520
     cagtgatcga ctactttatg gaaaaggccg gaatggttac ctcagaccag agtatgaaaa     83580
     agcttgtttc cctactggcc cacaagtttg tcaccgacat cgccatctct tcctttcagt     83640
     atcacagaat aaaccagaag gctgcacaga aggataagag gtttgcaaaa gagaagaaac     83700
     ccacattcca actcatagat cttgaaaagg cccttgagga ggtgggaata agcatctcaa     83760
     gaccccacta ctacatgtag acaggttgca cagaaacata aacatttaaa atttttacta     83820
     gtctctttat tctttggtaa ttagtatttc cgcatccctt ctcttgggct ttggctctag     83880
     gaaatagaac ttcttcaagg atttcgccac actaacatcg cttccatctg ttcctttctt     83940
     cttcgggtct ccatcctcta aagcccttac taggtcattc caactaattc tatcaacatt     84000
     tccatcattt gcaaacgata tcttcttcaa aacatccaca atcctagact gtgccattcc     84060
     attcgtcatt ctaatcaaat cgttgaatct gtttgttatt tccttcttac aatctccaag     84120
     atactcctca agaatctcca atctttcttc gtcgtttgga agctggaact cgtaaactcc     84180
     cgaaaatcga cgcttgaaag catcgtcaag tgagtcgtat agattggtgg ctccaaagag     84240
     aaacacattg ctgttcacct tatcgcatgc tcccccaatc gtgttcaaaa actcggtttg     84300
     tgcctttaac gtgtaatcct gtgatctatc cgatctctta gaaaagaaca catccacttc     84360
     gtcgataaac acaaagctcg cccagtagtt cccatcattt gcactctgga acaacgcacg     84420
     gatgttcttt tctgtttctc caacatattt gttgttcagc gaagatggtg tcacaaatgt     84480
     tattctggtg agcgattcca tttgccttgc ccttaccagc ttctcattgt gatccattcg     84540
     gtcaaactcc tcttccccta tctcgcttct catctttaag aacttgatat ttagatcaac     84600
     aagatatatt aacttcttca tgaaaagggt ctttcctgtt ccaggaggcc catgaaaaag     84660
     gaagtttctt tgtgttgttt ctatggtctt gtggagttcc ttctcgggaa cagtccttag     84720
     aaggctaaca atctttgtca cttgtgaaat cacttgtatc atcaaatcct ccttcccaaa     84780
     ataaggaaca ttctcaaatg ttgatccatc acggaacgaa ggcttgtctt gatcttccat     84840
     cttctcatcc ttctccttag acgtctttcc aatgctccct cctccttctg agacaattat     84900
     tctgtatatt acatatgcaa acacaaggat aattattata agataaagga ctccctttgt     84960
     gcctccactt gtatcttttg tcttctctgt tttgggcttt ttctttattc catagtcctt     85020
     taagatcttt ctatatatca atgctccaag aatatcgtta ttgatgtctc ttttcttttc     85080
     ctctggttta ttatcctttg ttctgttttt cactttctca tactcttctt catcctctgc     85140
     cgttttgttt tctactttgt agttcttgga cgcttctaaa tctctcataa acctccgatt     85200
     ctatgggtat tccaaaaaga tttcaagaat caatgtccaa aaccaactcc tggactactc     85260
     cttacattat ttttgcgagg ctctaatagg actcgactcc cctcggccta tgggagctcc     85320
     agactgttca taagccctag actccttttg agctcctttt ccagatcttt ttaacaaccg     85380
     accaaggaat gccaaaatgg atatctccga agaaaagttc gatgtactgg attctgtgca     85440
     tgtctctgga ttccgaatat tgaaagacag tggggagttc taccaaagaa ttaagtttct     85500
     tatgcagaac tcgacatcag tatgtatagc atccctattc tttggaaaga acggagaaat     85560
     ggaggacatc atcgacattc tcgaagaaag aaagaggaag aatctcatga caatcatctt     85620
     catcgataaa aacagaggga cagtcttcga aagtctggag tctataaaaa gaaggggtct     85680
     tggctcattt tttcatcttg tagatctctc tacgtctttc ctgcttccaa ggagactaaa     85740
     tgaacttctc agaaccttcc atactaaggc cttggttttc gatggcctaa ccatattatc     85800
     tggtgcaaac atggatgcat cgtacatgac aaacagagta gataggtaag tgaagcattt     85860
     taattttaag atatctcgag attgacagta gggagctggc ggatatgatc agatctagag     85920
     tctttggaat aaggccccct ttggaggctg gaaaaactat atgccagggc cttccagtgt     85980
     atgtaggtat gtttaaagag aaagaggagc ctgccatagt ccagtcgttt ctggaagact     86040
     tcgacgagat acacatttcc acaggatatc tgaactttcc ggctcgctat ttcaaaatgc     86100
     tccaaggaaa gaaggtgtct ctctatgctt catgcccaga taagaacacc ttcgactcgt     86160
     ttggaccctt ggagcgattc ataggcccag cttattcata tagcttctac agaactctca     86220
     gatcaatttc aagcctttcc attcacgagc tgaagaggga cggccattca ttccatctga     86280
     aaggtaagtg gaattgttaa tttctaggct tctggggatt caagggcaga acagctgcaa     86340
     ccatcatagg ctcatcaaac ttcaacagga gaagcgtaga aagagatgac gaaacaaatt     86400
     atctaataat cacatccgac ccagaccacg ttcagaagct gaggactgag gtggaatatc     86460
     tcaagagtaa ctcagaggca aggaccttga agcagcttag aggaaggaca taccagttgg     86520
     ccgtaattct attgtttctg attttcaaca gattcttcta atctagtatg gcaccaaata     86580
     aatcagcatc tatccaaatc cttctcaacc ttgctgaaca tgtggttagc ccccttgagc     86640
     agatcttcca gagtcacctc cacacagcat cttacaaact ctctccctgt cctgcatagg     86700
     ctgtggtata aaatgtactt tgcacgtttt ctcgacatgc agcttgtgtt atggacaaag     86760
     aactgtgtat cgttgaatat agagacatac gaggatccct cgacaagctt tgcaacgttc     86820
     atgaaatatc ctgcacagaa cgacagaaca atcttacttt catcagactt gcatggccca     86880
     ttgaacatgg aacatagttg cttctttatc ttcactgtct gaagcattgc tctaacattt     86940
     agaaatgatc tcttgagatg tgatatcttg aatccagttc tttcccacat cctatatatc     87000
     ttaagaaacg agaaatggtc tcctcttcta tcaaaataca atgactttgc atccaaaaac     87060
     gccttgtgag attggctgta ctttggaatg tccagccata tgtttcccac acttagcatg     87120
     gctgcaatga ttgaaacatc ctcaaggcac cccagatccg aagatacaat cagggaaatc     87180
     gctagctccg gctctagagg gattttcgag gctctggctc caatcggtgt tatctttcca     87240
     tctcctccta tggccttgag gtagtacagc aactctaggg ccttcctcac attcgaggta     87300
     tcgggcttat ctataaggtc gaagttcact atgtcattca ctccaatcga cttcagttca     87360
     agcactgcct tggcaagatt gcagcagaaa atctctggta ttgtattctc gctcatctct     87420
     tggaattcct ctttggagta taaccgaaac acctttcctt cctgggttct ccctgctctc     87480
     cctgccctct gcttggcctg tgccttcgat atccatgcca cctccaagat gtccattcca     87540
     aaggccccag agtatctcat ctgcttggct cgcccgcagt ccacaacata ttttataccc     87600
     tcaatggtta tcgatgtctc cgcaatgttt gttgcaagga caatctttct tttcttcgtc     87660
     ttcttgaaca caagctcctg ctcctcgggt gaaagcatgc tgtatatgca atacacctcg     87720
     gcgtcgttcc ctaagatctc tacaaggatg tttctcccgt tgttgatctc ctcctttccc     87780
     gttagaaaca ccaatatgtc tccttcttcc tctgtcctat gtatctgtac cactgtcttc     87840
     acagcttcgt ccagataatc caaagcccca gccttcttca agaaaaatat ctccaatgga     87900
     aacattctgt ggcgaatctc aaccgtttgg catctaaaaa acgaaataaa cttctcagag     87960
     cttagcgttg cactcattat aatcacccga agatccttcc tcttgctcag aatcgatttc     88020
     agatatccca gaagaatgtc tatgttgaca cttctttcat gtgcctcgtc gataatcaca     88080
     acatcatatc tattgaggca tttatcactg actatctccc gaagcaaaat cccgtctgta     88140
     gcatatttaa gcctcgtttt cttactcgat acatcgttaa atcttacaga gtatccaacc     88200
     tccatcccta tcttcacatt catatcctgg gcaaccttct tggcaacact tacagctgca     88260
     atccttctgg gctgcgtgca cactatgctc ttgtatctct caagaagata tctcgggact     88320
     ttcgttgtct tcccacatcc tgtgtctcct tcaatcaaca gaacttggct cttttcaagc     88380
     ttcgagaaaa tctcccccat cttatcttta acactctctt ctccagatct ctcctccttc     88440
     ttctccgtac ttattagcaa gtccattatt tcctcctctg ctatggagtc cttcttgtct     88500
     ttggctaggg gaaacagttc tggaggaatc tctcgattga tgcgtatttc tgtttccatc     88560
     cctttgaaca ccgttctttc ttccattccc aattctccag gggtccgcac ttatcttccc     88620
     tatccccaga aacatatatt ttttttgaaa agaccccttg cttgcctagc cgataagaac     88680
     gagtcttttg ccttttactg aagactccca tggctagaca ccgtgccaca cagcaatttt     88740
     tggaatgctg atcaactcag ccttgttgtc gtaacatctt catctagctt ctaagataca     88800
     tcatcaaaaa agaatacttt aattcttcat ccttttcttc tgtctgtttg cataatcctg     88860
     gtagttcgag attatcctgt taactatgtg ctccgcagag agatagctga acctattttc     88920
     ggcatagctg tgctccacaa cctctttaat gctatcgtat ctcgatagat cctttgtgtc     88980
     gaaagaggtc cctacaatgt cgattccatg cttctcaata aactcctttc caatcagata     89040
     gggcgaaata attacctcgt caacatattt acatgacacc aatgtaagca ttctctcctt     89100
     ggtcgtcatc acgggatagt ttctagtgta ttcccttgtg gtctcgtcgt catgtatccc     89160
     aacaacaaga tagtctccca tttctcttgc tattttcaag gatacaacat gtccggcatg     89220
     gaacaaatca aaattcccat ctataaacac cacttttcct ttcctttccc ttttcatcga     89280
     gctcacaaat agctcaagca actgatcatg gtatctagag tttttgttgc tttctttgtg     89340
     ttctccatcc aagcaggttc ccctattctt cagcatcatc cgcccgacag tctcagtcgt     89400
     cgagattcca accgtcctct ccacctctct gaatatacct gtccttctca cttggaagta     89460
     cgagtcctgt cccttcgaat cgagtattat gtcgtttcca tgtgctacta tacttgcccc     89520
     gtattcccta accatgctca tctctgtgac aaatggtgca tccttgacaa tctcatctac     89580
     gtatctgcat ctctggacga cctcatacct ctcgtcatcc tccatcacag gtaatccctt     89640
     ttctcggttt atgctgagag atgaatgaac tccggctatc agataatccc ccaatgcttt     89700
     ggactgcctt agcgcatttg catggccgta gtggaacata tcaaagcacc cgtcagccca     89760
     gaccttttgg atctccttgg atgccatttg tttgggaaag gttctactta attataaaga     89820
     aattaaaatg ttttagatta aaactagatg gatgcccaag agtaagcctc attcagttgg     89880
     gtagaaccat acctaacagc attattctat tgcaatgatg aaagaaatca cttaagatgg     89940
     ccctttcggc atcgtccgag gactttccat agagctcata tgtgctccaa cgctgttctt     90000
     cggacatcca tgggcatttc tggaaactcc taaaaatata aaatttttgc ttccagcttc     90060
     caaccagagt ccaactaaaa aagaagcagt accaacatta tttaagatta atttaattca     90120
     atttccggca ggatgcagat attaaaccag ttattagtgg atgcggctgg ttaggccttg     90180
     cagtgaactc aggatggaat tgtactccga caaaaaacgg atgcgatgta agctcaaaga     90240
     tctttgctgc tcttctctcg tcgctgaatc ctacaaacct caggccatac gaacatagtg     90300
     aggaaacctc ggatcgaaca acctcgaacc gatgtcggtg cctctctcgg atcttctccg     90360
     ctccagagta caacctcttc acaagtccgt cctcaagctc cacctcgtat cccccaactc     90420
     gcagtttctt atcaaccact ccgttcttgt cgctgataaa cctgacaaca aggttcttcc     90480
     cagacgggtt aaactcctcg gaagatgcat ccttcatccc aagaacgttc ctgcacatct     90540
     cgataatcga tagttggtat ccaagacaga tcccaagaag aggaatcctg ttttcccgtg     90600
     cataccggat cgccgagatc ttcccctcga tcccccgtgc tccaaatcct cccggaatga     90660
     taattccatt gcacttctca agatcctctg tggtgtacga gtctgcattg atccattcaa     90720
     tctcaacatt cacccccaca gacgccccag agaacctcaa tgcatgcaca agagacgtgt     90780
     agctgtcaaa ctccggcgag tacttcccca ctatcccgat ccttactgtg tcctcgtgct     90840
     tctgcacaag tcgttcaaac gtctcaagta tctcccgatc cccctccttc gacgaaatcc     90900
     caagcacctt gttcagcgac tcaaccattc cgtgctcttc aaggaacttc ggcacaagat     90960
     acaccgactc cagattcgga agcccaaaca cattcccagg ctccacccag cagttcttcg     91020
     atatcttctc ccgcgtctcc ttgctggggt cccgcactcc cctgcacaca atgatgtcgt     91080
     agctgagccc gaatctcctg aagttcctgc accccatctg gatactcttt gttttctgct     91140
     ccccactctc tagctctaca agatggtcta cagacacaaa tgcacagttg ctccttccaa     91200
     caattctctg gaactttgca aaggcgtctg tgtatataga cgactcgctc tctccaacag     91260
     ttcccccaag ctcgataatc accacgtctg ggatgaccct acgtccgctc ttgaagtctt     91320
     ccacaggagt ctccgccacc atcttaattc ttctgataac atcgtctatt gcatgtggat     91380
     taatctgtaa tgtctttcca agaaaatgac cctccttctc acgcttgatc atttcaaaaa     91440
     aaatctttcc agacgttatt gcatttgaag cctcaaggtt gatgctactg aatctttcgt     91500
     agtttccaag atcaagatcg cactcagacc catcttcaag gacatagacc tcgccatgct     91560
     cagaaggtgc aagcatccct gcattataat tgaagtatgg atcaatcttt atatgtgtta     91620
     cgacgtgtcc tcttgacttt agtaaagcac ccacgctact acttactacg ccttttccgg     91680
     ctccagagat aactcctccg gaaacaaaaa tgtacttcat tttaggggag tgcttttgat     91740
     tctttaaata cttataaatt gcttaacgct tatattaata atgtcaaaga taaatattta     91800
     acagttctgg attaccgttg gaatgtaaac gggcttaggt agccaagaac gaatacgctt     91860
     ctagcgaaat ttatggaagc ccttcgagaa tgaagaaatt tataacgagt gctttacctt     91920
     atgtaaacaa tcagccgcat cttggaaacg tcataggaag cgttcttagc ggggatgtgt     91980
     acagcaaata ctgcaaaaag aagggagaga cttgcctgta tatctgtgga acagacgaat     92040
     atgggacagc cattgagatg gaggctgttt ctcaaggacg acctcctttg gagatttgtg     92100
     aggagaacag gaggcttcac aaacaggtct atgactggtt caacatcgac ttcgattact     92160
     ttggatttac ttcgacaccc gaacacacag agatggtgca gagtctcttc atgaagatgt     92220
     acaacaacgg acatttcaag gagctggaga ttgagcagtt ctattgtggg aactgtggga     92280
     tatttcttgc agacaggtat gttgtgggag aatgcaagtt ctgtggagat ctgggagcca     92340
     aaggagacca atgtgatgca tgtgggcaga catacaattt tctcgagctc ctgtctccaa     92400
     agtgttctat atgcagtact gtgcctatta ttagatctac ttgccatctg ttctttgatc     92460
     tagagatgtt ccggcctcat cttttggaga cctacaagga aaatggtcat ctgtggagcc     92520
     agaatgctca gaatatattc aaccagtgga tttcgatgga attccaccca agatgtatga     92580
     caagagattt gaagttcagg tggggggttc ctgttccttt ggaaaagttt aaggaaaagg     92640
     ttttctatgt gtggtttgat gcgccgatag gatatctgac gtttttaaag gagcttgttg     92700
     gagaggactt ttctgaatgg tgcaaggact cggagcttgt acagtttatg gggaaggaca     92760
     atgtggcgtt ccacaccatt atatttcccg ccatgatcta tgcaactgga gagaagtatc     92820
     cgataatcaa aagactgtct gcaaccgagt acctacagtt tgagaaccaa aagttctcga     92880
     agagcagaag acatgggatc tttgggctgg atcttgttaa ggggaacctc gggaagccct     92940
     gcatctggag atactatctg atgaagatac ggccggagtc aacaaaggat tctaacttca     93000
     ccttttacga cttccagcag tctgtgacgg cagacttgat caacaacctt gggaattttg     93060
     tgaaccgtgt gttgaaatat atagaatcca ggtgcaactc gagagtatcg cttctcgagc     93120
     ttgatgaaaa ggataaggag tttgttgagg acattaatgg gctttatcgt agatatataa     93180
     caaagatgga cgagataaag ctgagagagg gactacaggt ggtcatggag atctcaagac     93240
     gcgggaacga gtatattcag gagggagtcc ggaacaaagc caggaagtct cattttttct     93300
     gccttggatt tagtgtggtt gggtttttgg cgactctctt gtatcccttt atgcctgttg     93360
     cttctgtaga aattttaagg atgtgtaatc tcgaggagac agggcttcca gagtcgattc     93420
     agataattga tggacatatg ataggaggca ggatatgccc attgtttgaa aacttcactc     93480
     ccgagcagct tgaagaaatg aagaagtatg gcagctcgta acatatggaa tttccaaata     93540
     aacttttctt aatatttgtc attggagtct tgagtccttg tgatgagcaa tgaggatcat     93600
     tcaagggagt cggctcggaa aaggatgtct gaatgggacg aagaagtaga ccctgggagg     93660
     gagaatgtaa gcaaatggga gattacacca cgcacagcaa cacagtcgaa gaggttgaaa     93720
     tgggatcaga cgcccttggg atacataagg gtagaagacg acttgtggag gagatccgga     93780
     atgggctctg gagcgatttg ggacagagaa acccaagaca cgggagggat ggccgagtac     93840
     tccgagatgt ctttaagaga gataaacatg tgtctaccgt cgaaaggtta caggagatac     93900
     gattttgtcc agacctttgg aaatgaagat ccaagcatag cagatttgcc tgatattcca     93960
     gccgaggaaa gagatttctt catgccttta ctcgaggctg gggatgggga tgaggttgat     94020
     atatacaagg gcatactact agtgaagaat ggaagtaaga agatgagcat ccgtggtctt     94080
     aggattctta aaagcaagga agtgaaccat gtgctggaga aagtgcttct tatggcaatg     94140
     agcctggaac ttgacgacaa agataaagga aagataggag gtttacttta ttctcttttg     94200
     gatggagtgg acatggatgg agtaaagtat gtacgggaaa tattatttgt ggtggggtca     94260
     tactcctact ttctttctct ccgaaggatg tgtatacctg tactcgctct tgtctataag     94320
     cgaggatttg atttttcagt aaagagcatt gaaggagctt ttggaagtaa ggagggatat     94380
     gttcgggaga tggcaggaca tgtagtgggc acttttgtgg atcattttgg gatggaaaga     94440
     acccacactc tcctggaatc tttagcagga aggaaggaca ctgagtctag aagagcctgt     94500
     gcaaaatgta tcacagcaat ctgtgagttc ataggaagga gagttgttcc ctacctgggg     94560
     ccagtgctag gaacactttg taaactgatt acagacagaa atagatttgt aagaatggat     94620
     gcagccaaca caatgtccta catatccaag gttgtgagcc cggtcaggac tgcacagatg     94680
     gacagtgttt ttgaacttct taagaaggag atatcgaggt ctggagaaat cgagttcaac     94740
     tctctcttga atgcgatgtc gcatctatgt tccaataata aggagcattc caaggtagtt     94800
     tttggcttcc tgaaagcttc taggaagaaa gagattccaa atattaaggc cttcgagagg     94860
     atctgcaatg aaattgaagc cgaagactct tgggagtact ttgaccaaat ttccgggatt     94920
     cttttttcct ctaagggaag agacaatgca aatctggtta taagcatctg tattaagatt     94980
     ggaagtgagc ctagagtatt caaaagaatt ctggaccact atagcaatcc tttgaatgca     95040
     ggaatgatct caaggatatt tagcaaagtc caaaagctga agtttgaggg agaggaggtg     95100
     gagatatact tgagggccat atgtaatgcc atccgcagtg atgaaactac agctagtctt     95160
     gtacttccgc ttgcctctaa gatgtttcta caaaagagac atgtgtcggt actggcatcc     95220
     gagtcattca agcttctaaa gaatccctca caggacgtcc gaatcagaag tctcaaagcc     95280
     atcgatggcc ttgcgaagat cttagaaaga aaagaactga tgcactatgg aaacattctg     95340
     atggagaatg tggatggaag cgaccaggac acactatcct ttgttattaa ggcaatatgc     95400
     agtatataca actcttatcg gttccggccg gcctcggaga ttgtaccaac catccttccg     95460
     attctaaagt ccagagagca aaggacggtt gcatcttgtg tggctctcct tcgcactata     95520
     tgcatgaatg cacctgagga atgtgaaaag ataagcatga gagaatggat gaggatatct     95580
     tatgagttga ttgctacact gtcttcctgg agcaaagaga ttcgaaggaa caccacagtg     95640
     tcactaggat gcatctccag gatagttggc ccccaagaga tactggacat ccttatggac     95700
     agtcttgaat ccgaggacaa gaaccaaagg gccgggtcct cactcgggat ttctgtggta     95760
     ggggagtaca atgggatatt ttctattctc ccaactctct tggcagacta cggagcacca     95820
     agtgcctttg tacaacaagg aatacttaag gccatgtgcc acttcttcca acagacatat     95880
     cgggttcctc tcagatatgt atactcgata ctccctatga tcgaagatgc aatgatggat     95940
     gaggacccgt catatcgaag tcttggaatg gaccttatta gacacatagt gttgaaccat     96000
     tccccatcga ctatggacat agaacttgcc atacatctgc tcaatctggt ctgggcaaac     96060
     attcttgacc ccagcttggc ggtacaacaa tcctttgacg gatgtatgga atcttttgtt     96120
     acaatcctat cctcgcaggc tgtatatgga tatgtgcttc agggtctttt ccacccctcg     96180
     agtgctgtaa gaaggagata ccatactgtc ttggaagcga tggagcattt cgacagcacc     96240
     tcgctcgcac agtgtttcct tgtggaggaa gacctccttg gtcttgaaaa gtaaatcatt     96300
     aattttttat tgtcctcatt caaggttgta gtggaacggt tcgattactt ctccgtttct     96360
     atatcctgtt tttgttcgga caagctttct aaaaattcga agtgtatttc tctctctgga     96420
     tatggaagca tcgatctttt cgttgtactc gccctcggta tatccaaagg gtagctctgc     96480
     taggaatttc ttgtctacag aagatatgtt ttcattgatt ataacgtgtg atctattgaa     96540
     gtcttttctg ttggaatact ttattccttc cacgacattt cttatggtat tactctttgt     96600
     tttgacaatc tccaaccctg gacctgccca ttctccccat ccaggaagga cagtctcctc     96660
     tattcttggc gcttccttct ccacagtctc tgccttttcc tttataaagg ctttttcgtt     96720
     ctcctccata tcatccttaa atgcaagcct tacaagtttc tcctggccgt cttcctcttc     96780
     ctcatctccc ccaaagctga gtatgggtgt cttctcatcc tcaggttctt ctatctcctt     96840
     gaggagtatg tctggaatgc gtttttgtct ttcgtcctca tgaacatcct ccccttcttt     96900
     ttcttctcct gcctccttgc tcttaagttt gctctgtctt cggatacgcc tatatgtctt     96960
     gctttttatt cttttgatcc ttctcatctt cttatcaaac tcatacttga ggttcttttc     97020
     aaagactatt gcccttgatt ccttctttct ttctccatga agaatcctgt ccatagactt     97080
     ctccaaattc gtcgacggaa taatctcata gaaatcctcg tctttcttct tcgccatctt     97140
     ccttcggcct tgctcaattg catcaaaggc ttcttctctt accgctgcat acacagattc     97200
     cttgttctcc tcaagctctc caatatcaat cctatctccc tcctcaaact taacaagatc     97260
     tgcaactgaa attttattaa ccaccatggg ctctggagat ggcccataga tcaatttttc     97320
     caaggatcca atcccagaca gcccatggaa tactacgacc ccgacgatat ccttctgaac     97380
     gaaacaagaa tacaggttgt attcaagcac aaggtgcaga acttcggatt tcttggacag     97440
     agatccagga tccttccaga aaacaagaag gtggaggtcc catacttcct tgtagccttt     97500
     cttctgaaaa acgaccattg taagctggcc gagggcttcc cagataagtc cctgctggag     97560
     gatataagcg ccaagcctgg agtaattgac ctgaggtcgg tgtgtcctta cttcttctac     97620
     ttgcactcca ttcttctcaa agaggaagtg tctctgccgg agttcttcta tgaaagaata     97680
     ggagaccatt cttctctagt tctcaagaag gcgttttccg aagatgatgt atggaggttg     97740
     gacgtgattg aaagaggtct tattgtacgc agcaggagaa ctttccagag atttcataac     97800
     ttccttatct tgggtcataa ctagaggctg gcccaagcag tacgccggtg ccacccaatg     97860
     ataaaatatt tcgaaaatta tttggccatg ataaaatacg aatgtaggct ccactccagg     97920
     aagtatcccc gagagggaga aatagtcatg ggaagggttg tgtccatagg gggagaaggc     97980
     ttgaccttga atctcctaga gtatggagat ctagaaggac tagttcttct gggagagttg     98040
     tcgaaaagaa gggtgaagag catacagcat gtgaccaaga ttgggaacat cgagatatgc     98100
     aatgtcctga aggtggatga gcaaaaggga tacatagacc tgagcatgtc gaaggtcaca     98160
     gaaagcgaga agtccgaatg caaggagacg agtgcaaaga ataagcttgc ataccatatc     98220
     atgctcaagg ctgcaaagaa gttagggatg gaagtatcag agctgtatga aaagatggga     98280
     tatgacaaag aggaagagtt tgggtcattg tactacttct ttgcaagggt taaggataac     98340
     ggagacatca tagaagatga tgaggtaggg ctaacaatta agagcttgat tcgagagcag     98400
     ttccaggctt ctacatataa agtgcgtgcg gatatagatg ttgtgtgttc gtctcgagga     98460
     gggataatct cgataaagaa ggtcttcgat gatgctttga agctggatcc aaggcttgag     98520
     ttttgtctga tcaagacacc tacatattca gtgacacgtg tatccagcaa taaggacaag     98580
     gcctatgaag tggtgagaga ggcatgcgac attctaattt caaacatcaa gaaggagggg     98640
     ggaactgcct ctgtggtaag ccaaccaaag ctgtatggag agaagtcaag atacaacctg     98700
     ttgaactttg aggaaaatga gatttcttct tccgagtaaa atcttgtctt tttgcaacca     98760
     gactacaaag aatctcttta ttgcccttct atgaacaaga agtttatgtc cagtggggta     98820
     ttccagtttc tggacgaggt ttacgagcag gatgggcctt tggtaagata tggtgtcctt     98880
     gtggggaagg gagagctgat ctttgatgag acattgatta caaacaggac aaccttatac     98940
     aatgtcctca agaagacgga aaagggaaga tattcctcgg atgggctgat ggattggtaa     99000
     ggagtgattt attagaaata tgatctattc cagcaatcaa gcaagtgtct cgagcacttt     99060
     ggcgagcatg tcgcttccat ccatctcgag aaagacacag gtgaatccgt ttggaaggga     99120
     aaccttccgc cttacaaaga catacttaat gcctctgtct tcacagactg caggaaggtg     99180
     tgtgatgagg tccatgggtg ttgtgtctgc cgttaggacc agcaagcctc ttgacccctc     99240
     taaaatgcgt ttttggcact tcttgattcc tgtggacaga actcctcttt ctgcctggtc     99300
     tcttacaagg ctggctatca tctctgtggt ggactctgat gctattgggc ttgctattgg     99360
     aatcatctct gggcaaattt ttgcggcaaa atatgaatgc aggacatgat atatgtaagg     99420
     agaaggagcc cctgaatggg gggaaagaac ttcatgacgt ccaaagaaaa ggactacgtt     99480
     gccgagtgcc tcaaaagaaa tatgagatac tttcgatccg acatcgacta tgcagtgctt     99540
     tttcgagagg gggaagagaa gattgaggtg aagtgtgatg atggagagcc aaagagaagt     99600
     gttaacctga tatttggaaa ggagaataag aagtcttcaa ggaggccaag gccgttctgt     99660
     ggggtggaag tggagaacat cagggagccg atgcgggata tgtttctgct tgaggagctg     99720
     attgatttgt acacagccag gagatattgc aaactctccc cagaggatct ccgggagaat     99780
     atcgaaatgt tccgggagaa acttctttgt aagtttgacg tgtttatctc tatcgcaaag     99840
     tttgttagtt ttctcgggga gtattttcct tttgcagagg aagaggagaa gaaggaggtt     99900
     gtagttttgc ttctaagaac attccatcta gtcaaggatg ttccttcgtt ctataattct     99960
     attgggtctt tagccgggtg tatgccccag gtttccgagg ctgagttgga ggagggattt    100020
     gtttctacat tccttttctt tccaagcggg ttgatcctgg ccactctact gcttatccaa    100080
     aacgaggcct tgtgtggtgt attttatgag gctattatca aggagtctgg ttggtccttt    100140
     acaaagagca agcatggatg gcagtttctt tctgttatga tttcgattgc agatgaagaa    100200
     aaacaaaagt ctattgtgag aaaagcaaga ccttacctat cggaggtatc caaggaaccc    100260
     gagagtgatg aggcaaaggg tgcaagattg tttttagaag cgataggcat cgacatggaa    100320
     gaccttagat gttggggcga atgatgggat gggtttggaa catgatgttt agagataaat    100380
     tcctacaggt gacttattta atcgtcgttt ttccttttac agaggctaga ttcgtcttct    100440
     ttgggattga agttgcgaag cggtgcattc gaggcatcct tgcaggatct gtctttaaga    100500
     tattcatcct taacaatttg gtctatagtt attctgtttg aagggtcaag acagagcatc    100560
     ctactgatta tctgaactgc cgactcgtcg tggctttcaa tgattttttc aatccttcgg    100620
     ggagattggg gaagcctgaa gttgcggaag ccgggaagat tctgcacgcc tggatagcta    100680
     ttctcgttaa tggatccaca ggcatgtatg atcatctcca gctgtgaaat ctctgtattt    100740
     ccctggaata tcatgtatcc cagatacatt tccgtcaata tacagcccaa tgaccagata    100800
     tccacagcat aggtgtagtt ataagatcct agaaggatct ctggaggtct ataccataag    100860
     gtcactgttc ccggggtatg catgcctgcc tttgccacat atcttgccat tccaaagtct    100920
     gcaatggcgg cattcagctt atggtctaaa agaatattcg cactctttag gtctctgtgc    100980
     ataatcccct tgttgtgaat gtaccacaca cctttggcaa tctgatggaa tatatgcttg    101040
     acctcttcgg gtgctagtct gttgtttctt atgaatctat ttaaatcata tggaaagtac    101100
     ggaaacacca tgtagacatc tcctccaggc tcaaccacca tctccatgag tcttattatg    101160
     cttggatggc tcattgctcg aaggacttga atttcccgga ttgttgtcac tggtattcct    101220
     tctttctctt tggttacctt cttcagtgca tatctagccc ttcccttcct tgcaagaatg    101280
     acttggccaa aggtcccctc tcctatgacc cttatcttct catagctcat ttctgttaca    101340
     gtgaacctct tgtgtgctaa gatttccccc tcttctggta actccatcgc ttgggtggag    101400
     gagcaataag ttttattgtt agaagcgccc caaatgctag gggagaaaga gggcaaaatc    101460
     ttaatgaggg aggttaggaa gacagatcaa tctctcaggg accttttata tgtgtctaac    101520
     tttgtctctg tgtactacta tactgatggg aattgggata aggcaggaat tgaagggacg    101580
     tttgtgatgt atagcaggga atgctaccct ctggttggaa tacatgtttt taataggaaa    101640
     gatctgaaag acttttccct ttacttatca aaggagctat ccttcgggat aaaaggaaat    101700
     cttatgacaa taaccgaaca agaggaaaac agaatccatg gcctttggtt ccacaacgat    101760
     gtccatccca aggcgattct ggagtgtcta gaaagttctc tgtaattact gtccatgccg    101820
     gcttttaccc catgagcccc tacccaataa ttaaagctga ataccatagc cctgaatggc    101880
     aattctttat acgcagataa taaagcttcc agactatagg attctttcag gagagtattc    101940
     gcctcagagc aactccctta gaccgggaaa cgacatagtc aaagagttga gaaacaccat    102000
     taagtcgatc ccaggtagtg ggacttcgtc tttttacaca ttcaactctt tggacacaag    102060
     atttgtcttc tacttcaagg tccatactgg gattgttttt gcagtgataa gcgacaggta    102120
     cacctcttca aaactggcat ccgagtatat ggatctggtt gtggaaggct ttgcgaagat    102180
     atatgtggat aacccaaaga caacatacta cacttttgac cccacaatca aagccatgtc    102240
     tgacaggttc aacagagact caaactatgc ccagggaatg gcagttgttg aggaaactaa    102300
     gggacttctg gcggaatctc tcaacatgat aattaagaga gacgagaaca taaacaactt    102360
     gaaaggtctt gcaagcagga tgactgtcga ggcacagatg atgcagaaga acattcagag    102420
     gatgcatcta aagagtatgt tgaacgacta ctggatctat gtagtgtttg cagttctgat    102480
     tattctcttt gtgtactata tagcccatta aattagtctt gtctaagcta tggtttctga    102540
     tttcaatgag aaatcttgtc tgatctttcc cttgaacaat ggagatcgga agtccgagga    102600
     aggaggaaca agctacggcc ggagagaatt tgaatggaga atctggggca agggaaagag    102660
     agggccagtc aatgcgaaag gccaggggtt cggatgttcc ccaggtgctg gagtctcagt    102720
     cgtgtgcagc aagagaatgt gcaagagatg agataagaaa gtttgttagg gttcctgtag    102780
     aggtggacac ggtcggagga aagccattga tgtttacaat gtgggcatcg gaagagaagc    102840
     ctatccacaa aaagaagcat gccacagagg cgtaccggga tgtttttgga tgcgagtctt    102900
     gtgaaggggt gtttgactcc ttcaagaagc tggagcttca cagggctctt cacaagggtt    102960
     cctctgatgt gcccaatccc cttttctgtc ctgtttgcaa gaaaacattt gacgaaaagc    103020
     gtaagctgat gctccactcc aggtatcaca agataaacaa ggacggagaa taaactgtga    103080
     aatgtcttga atgcttatat tggcttatgg tggggtttat gccacgctat gggaaacgac    103140
     tttgaggaag gagttgagga cattgttaga gagctcttct tcatagaaga gcgtatggat    103200
     ccagaactcc cactcatatt tcaagaaaag accaaggagc tggaagaaga accggaagaa    103260
     atatgctgca tatgtctcga gtacattaaa gggtcgcaag cattgcttgt atgtagacat    103320
     tcctttcacc tgacgtgcat ttattcatgg ttggacacaa agagagtatg tccaagctgt    103380
     agaatggcaa taaaatggga agagtaaggt ctctcttccc ctaaacaagc cctttaaatg    103440
     ccaaagaata aatataacat cttggcagaa aagcctcagg atccaaagga ttctccagcg    103500
     aatgaggaga acttgagtct tgcatttgag tcgtccttga ttctttctgg aacaaaatat    103560
     cccgaaccta gaacgagaat tgcattcaac ttcatatcta catgcgagca tggtgtggtc    103620
     aagcttttct ttgtcacagt aacccacgcc aagtcagatc aggagtacta tggattggat    103680
     gcatcggata actgtgtgat tgtctcgtcg gacaaattag agaccggaaa gagatatgaa    103740
     atttatggga ggcttgaggg cggaacacct aaaaccctcc actgtgtaga gatcagggag    103800
     atatgttata gaagactgtg ctacgaaata ttctgagtca cttaatttac tttcttcaat    103860
     aaatatatat gcagaggatg actatttaga gacagggctt tttttaaccg tccttcttgc    103920
     tgtcggcggc gtcctacctc ccttttgggt ttttttgatt atatttcttc cggccacttc    103980
     ccagttgggg cctgttcccc atttcgcctc tcccccgttg gtgtccaaaa tccccttaaa    104040
     cttggatttt atcattctaa ggagattttt cgaggaatca aacttggtgt gcatccatcc    104100
     ataccttaca ctctttttag gctttgagtc cttcttctct tcttggctat ttgacgattc    104160
     ttcatttttg ttactctcac ccttgcttgc acattcctcc ttgatctttg gagtggatag    104220
     gccctcgatt tctatcacca tcttccttcg ggtaccctcg tcttcagact gtttgctctt    104280
     ttcgtcgtca aagctttctt cctcatggcc ctttgcggag cacttccccg aatccttttt    104340
     gtgttccttc ccaaccacac ttgagtaggc gtcctcgttc tcctccgaca tcccaagacc    104400
     tcgttcctca agcctgtggg gatccgtagt cgtggatagc attatttcct tctcaatctt    104460
     ctttgccatc gagagctttc tcttgtacga ttctgagttc ttgtcaagga cctccatgta    104520
     ctccgactcg tcaaacttat tgtctatgtt gaagagcttt gagtttgctt caaattggtt    104580
     ccagtccttg cttccttcct ctgaaaatct ttcaagagtt gcagattcgt ttgggggagt    104640
     tggaggagga gcagttacct cgaccgctct ggatatctga gaatctgttt tgaacgaatc    104700
     ccaagatgaa gtctcctttc ctttgctggc cttctccgtc gtctccaagg gaatgctctt    104760
     gtcttcactc ttctctctta caccctcatt tgtcttcttc accgtgatta tgtcactttc    104820
     ggaaatagag attgtaggaa acacaatccc agggttcatc tcgaaaaatg cattctccag    104880
     cttcaccatt ccatcttcgt tcgaaagaaa tgtacctatc attctgcttg ggttgttctt    104940
     gaagcatata gcaatcgtgt aattatccat ctgctcctaa gggcttttgc actagagttt    105000
     atttcttttc atgaagagac cgataataaa catcttctcc ccatactcca tggatgcaag    105060
     cttctatagt ctacaaaagg cccttggaaa aaaagggatt ccagagtttc catctcttct    105120
     accacaccag ctcagagatc tcgaaacaac ttgctgctta ggggattttt acgaaaaggt    105180
     catctgtgag gtttctcgag ataacaattt gattccaatc ctttcgtttg tgactggact    105240
     ccctattgag atcgatataa aggaagtcga aaagctcttg gcagaataca agcctgtaaa    105300
     gggcgagttt ttccgggccg gccagcacct ccaccctctc cttccggaaa aggacggata    105360
     tccggacttt gtaacaggaa gtggtaagaa gattgccaag aaagagcaga gagataagaa    105420
     cgaagtggat ggagagtgta acgtagaaag ctacatagtg gataggattc ggaacgaaat    105480
     tctcgaaaag gtgatggaca ttggatggga tgatatcatc ggactaaagg atgttaagaa    105540
     aaccatcaac gagattgttc tttggcccat gcagcgtcca gatctgttta ctggccttcg    105600
     gggcccccca aaggggcttc ttcttttcgg acctcctgga acaggaaaga ctatgatagg    105660
     aaaatgcatt gcaagccagt gcaaggcaac tttcttttcg ataagtgctt catctttgac    105720
     ctcgaagtgg gttggagagg gagaaaagat ggtccgggcg ctgttctatc tagcaaggtc    105780
     aatgcagcca tcggttgttt ttatcgacga gattgactca ctcctttctc agagaagcga    105840
     caacgagaac gaaggaagca ggagaatcaa gacagagttt ctggtccagt ttgatggagc    105900
     atcaacttcc aattccgacc gaatactagt gatcggcgca acaaacaggc cccacgagat    105960
     agacgaagct gcaagacgca ggttggtgaa gagaatttat gttcctctgc ccgagcatct    106020
     gggcaggagg caaatgatag agcatctgat cagagattac agaaacatcc tcgggcccca    106080
     agaattcgat gaagttgcag gaatgacaga gggatactct ggatctgata tctttaatct    106140
     atgcagagag gcttccctag aacctttgag ggaaatcgat gacatcaaag acttcaagaa    106200
     tgaagacaca aggcctattt ccctcgaaga ctttaagaag gctacaaggc agataaagaa    106260
     aagtgtttcc gaaagagatc ttgagatcta ttccgactgg aattctaagt tcgggtctgt    106320
     ttcatagacc aactggtgag tcgaacaagt cgagatcgag ctttacagtc tgatagcttt    106380
     ggccctctat cgtgtggtct ttttgtgcac ctgaaaacaa gaagatagac ttcctgttgg    106440
     ctatgcaagc ctgccttagg aattcgtgct caaagtcatt aaattcaaaa tccagcaata    106500
     taaacatgtt gaagtttccc agatggtcaa caatcacctg aaatggctct tctgtcacaa    106560
     cgatttttac tcggcctctg cacatcctca acagcttaaa tggaggcaca gtcccaggct    106620
     ttctatgcac aaccagtgta gaatcaaaat atggaaggaa agagtatatt ctgtcaaaac    106680
     tcttttcaat cggagtatat tggaatctta cgtatccgtg ggaaatctgt tttagaaaat    106740
     cctccatctg gcctatataa gctcgaggcc tcaacctaaa gatgatatag aaaacaaaac    106800
     ttgtttcaag acagagataa aatactttat gaacaccaca acaatgaata gaacaaccct    106860
     gttcctcata atatgcaatg aattctgcga gcggttctgc ttctacggtc tgaagtccct    106920
     tctcttttct tttgcaaaaa cagagtacaa cttctccata aaggcctcga ccatgatcct    106980
     ccatttcttc atttccatga gctatctgtt cactcttctt ggagcacttc ttgcagacag    107040
     gttcttggga cgatacaaca ctatcctggt gcttagtcct ctatacctta caggaacttc    107100
     catcctcact tactgctccg ttgtctcggg gtccccttgg gtcctgatgg caagcctggc    107160
     catggtggct gttggcacag gggggatcaa accctgtatt gctacatttg gtggagacca    107220
     gtttggtccc aacgaagcgg aaggcctgag aaagttcttt gacatctttt actttgttat    107280
     aaacattggc agcatggtct ccatgatgct cgtccctgcc atgtcaaacg tcgcttgcct    107340
     tgggaagctg tcttgctatc ctctggcatt tggaatgtcg agtgcattgc ttggagcctc    107400
     catattttta tttgttgctg gagaaaagct ttacgtcatc aagccagcaa gaaaagaaca    107460
     attttcaaat gagtttcgtt tcttggtgga gaacttgaag agcttattcc aaaaaaggcc    107520
     tgaaagctgc gaggagcaaa ctcaggaaag tgggaagaca gctgcagagg ccgtctccgc    107580
     atcacattcg caagatacaa aaaaaaggat ttggaagata ctcaagatct tggggccggc    107640
     aatgttcttc tggacactta gcgatcagca gtcctcctca tgggtggaac agggccagaa    107700
     gatgggtata cgccaaagca tatttggcta tggagtagat atccttccct cccagatgca    107760
     ggccctcaat cctatattta ttcttttctt catacctata ttttcaggat ttgtctatcc    107820
     gctgcttgga tggcttggag tcttctcctc tcgagaagac aagatggggc ttgggattgt    107880
     atttggatct cttgccttct tctattctgg atatctggag catcggatag ttcagcttgt    107940
     atcttcggaa gagaagctgt cgatcctatg gcaagtacct caatatgcca taatgacggt    108000
     tggagaaata atgttgaatg tgactggaat ggagtacatg tatgtcgagg ctccagagac    108060
     aatgaagtct ctagccctat ccatgtggct cttggctgtg gctgtaggaa acctcctaat    108120
     tatggcactg acatttctag acccaatctc tctgctttcc tctcatcgcc atgacatgtg    108180
     gagctttgca atgtacggag ccctaggact tgtagcgtcc agttatatgt tcaagacttc    108240
     aagatcaaac cgcaactcca aaggatagtt ccaaatagac tcaagagtct ggctggtgca    108300
     agatagacta ttgccatccg aaaaaggtta ttggctttta ggagaagaaa gggcctgggc    108360
     cctaaggaga tctaaaaatt aagccaaccc ataaaatgat gagaacaaca ttcaagactc    108420
     tatgccttct tctcaccaac atcttgttgc tactatccag ctgtgttctc ggagcactaa    108480
     tatcctcaat cccaaactcc aaaagcatat acaagaatgc aaatatacag atcacttaca    108540
     tgctccttct tgcaaatgca ggcctttctc tttttacttt tgtgatagtt cagaacctca    108600
     acgatgtatt tcttcacagg gcaaggtctc caagaggtgt tgagacgaag atgaagatcc    108660
     aatggataat tctctcgata gtgacgtttt ttttcggggt cttccacttg ccactaatta    108720
     catccaacac agagaagttt ctcaaaatgg acatcatggc cttaatgact gccacgatct    108780
     tagctctaca agtaagtgaa aaagttaatt ttagattgtt atgctcttca ttgtatactc    108840
     catgcatcca gacttgtttg gaatcaagta taaccgagag attcggaact atgtggaaag    108900
     acttgaagca gagtctagta gggaaaacag gatgtgacag caggctttta caaacaatat    108960
     cctttaagaa taaacttcgt tttactccta tttacaggaa cttttagaaa gagaagatcc    109020
     gaggctttat tggataaaca catactttag gtactatgct tctcatccat tttcctcttt    109080
     atctttgata ggaagtcacg acacttgaga agatcgctca ccggtaacct gaaggagttc    109140
     cggtccatct ctctcatcac agtacgtatc ttctttccaa tgttcattct gtacttttcc    109200
     tctcttactc caaagtcctc cccacaggtc cctatcaatg ccatttggga attcagtgtc    109260
     atgaagttgt tgtggctcat catgttaaac tgcaaataaa actttttatt tatattttcg    109320
     tcgcagagat tactgccgtt tccaacaaat gaagaatatt tgttttagac caaattaaat    109380
     attgtttttg gccttaaaaa atttccaaat taaatctaca atctcccgcc atcgcaaacg    109440
     tgctatacct gttaattaaa cgaactccca cattcccctc tctaagcaat tggttctcta    109500
     tttttacgca ttagagaaaa tataattctc tccatcaaaa caaaagatgt ttgctatttc    109560
     tttgatattt gtggctcttg ccattgctta ctttgctgta agactcggca ccacacatga    109620
     aataaagaat aaaaaaattc tagtaatcgg aggtagcagc ggacttggcc tggcctttgc    109680
     tcgtgtgttg aaaaaggaag gaaacaacgt cacaataaca tcaagatcaa tggaaagact    109740
     cgtgccactt ggaaagaaat ggggctttga aaccaaggta ctggatataa atgttgtagg    109800
     cgggcaggaa tccacagact tcgactacat attctgctgt ccaggtgtct catatcctgc    109860
     atactttgtc gaccaaccgc ttgaaacttt tcaggatacg atgagtacaa actacctagg    109920
     gactgttgcc atgctgaagc actacgcaga agttaacaaa aagcctttta agtttgtcat    109980
     gataggatcg acacttgttc tacttacatt tcctgggttt tcttcatact ccccaacaaa    110040
     gactgctctc ctttcgctct tctgtactgt tcgtgatgaa atggagaggc aaggagtgga    110100
     gctctatctt tacaatacgg catccatcct gactccgggc tttgagagag aaaacaagac    110160
     aaagccttca tacacaaagg ccattgaaga gatggtccct ccatcctcgg ctgaggagag    110220
     ggctgtagca tttctgattg ggatgaaaaa gagaagaatg gtggcatcgg atgtcttcac    110280
     atacttgtgc caaataagat ttgaatgtga atgtcttatc gactacatcc tattccctgt    110340
     ttctgttgcc gttgtattta ttgtgcgggc ttatgtgaaa tggaggttca tggccgagaa    110400
     aatgtagact gtgaaaaatg tttgccgaaa agtaaatggt agcttcaatt gaatttaatc    110460
     gatccgtcag acataacaca tagttttttg tttccaagag caatctcctc aaatagcttg    110520
     ttgactgttc cccagttcac aacattccac cacttttcta catattcggc ccttgcactc    110580
     ttatacttca ggtagtatgc atgctcccat acatccaagc caagtatcgg aattgtgttt    110640
     gaggttttca tacatatcga gtcctggtta tgtgtctttc tgataacaag aataccctcg    110700
     ctctgtctgt agcatatcca cacccatccc gagccaaata aagacactgc agcactattg    110760
     aattcctcaa ccatcttctc ataggatcca aaggacttat taatatactc ctggagagtc    110820
     ggacttatgg gatcgctagt tccaggagga cacatcatct tccagaacag gctatggttg    110880
     tagtgtcctc cagagaagtt tgatatgtct cttcttacac tacttcgaac tcccacaatt    110940
     ccccggctct ttgtaacaca gtagttgagg cttctcccct taatgttgtt actctggagt    111000
     gtcttttcga gattgttgat gtatccctgg tggtgctttg tatggtgaat cttcattgtt    111060
     tctgcatcga taaagggctc aagtgcatca tatggatagt cgagttccgg aagtttaaat    111120
     tccatgggta tctcatctgg aacaatttag aagtcctcct ctctaaatat tgcatgccag    111180
     aggccttcac cataaaagga atatgagaag gaactccatg tatatacaaa tacccaggga    111240
     cccgagaaca gacagaacct cgtttatagt atcgatgcct gagcagatga aagggaagat    111300
     cgaaagccag aagtgggagg agatagtatc tgggctgaac aatatattct acgaacttga    111360
     gtctccatcc ttgatgtctt ttatcaaaac cgtgtttatt attccatttc tggtagggag    111420
     tccaaaaaat gtcttcgtaa gggttgagga atatctatcg gatgcaaaca agcttttggg    111480
     gaagcacgga ctccgcatag tccatccggg gaatcaccag tatgttgagc ttgaggtgga    111540
     gatctatcaa gattgatggc tggactctgg atgggctgga gatggaatat ctttaatgtg    111600
     ccttgatcta taattataat tttttctgat cctcaggaat gtacaagaag aatgccaact    111660
     ttgttgagtg cgaagaagag gtacttgaat attggaaaag tagaaggtgc tttgaaaggg    111720
     catgtgagat gagtaagggc aggaagaagt tcaccttcta cgatggtcct ccgtttgcaa    111780
     caggactgcc acactacggc cacatcctta gcgggacaat caaggatact gttacaagat    111840
     tcttctacca acaggggtat gatgtggaca ggaggtttgg atgggattgc cacggtcttc    111900
     ctgttgagta tgagattgac aagaagttgg gtataagtag tagagatgag gttttgaaga    111960
     tgggaatcga caagtacaac aaggagtgca gaggaattgt gatgaagtat agcagtgaat    112020
     gggagaaggt tgtggagagg ctgggacgat ggataagttt tgagaatggg tataagacta    112080
     tggacaagac gtttatggaa agtgtgtgga acatcttcaa ggagcttttt aacagggggc    112140
     tagtgtacag agggttccga gtgatgcctt tttctacggc atgctcgacg cctctgagta    112200
     acttcgagtc caaccaaaac tacaaggacg tcagcgaccc atctgttctt attgcctttc    112260
     ctcttctcaa gccttttgag ggttacaagc tatctctggt tgcatggaca accactccct    112320
     ggacactgcc gtcgaactgt gcacttgtgg tgaaccccga gttttcgtac ggaatcttcg    112380
     aagagaagca gaagttctac ctgatgcatg ttaatagagt tgaagaatat ttcaaggatg    112440
     ccaagattct gaagaggatt tcaggaagcg agcttgaagg tcttgagtat gaacaaccgt    112500
     ttccttattt tgaggagtat aggaagaagg ggtttttccg agtctatgga tctggatttg    112560
     tcacggatac agatggaaca gggattgttc actctgcacc tggatttggg gagagcgact    112620
     acaacgtgtt tgtcgagaaa ggactaatac gtgagaacga ccttgttccc tgtcctgttg    112680
     atgagaacgg gagatacaca agtgaggtaa aggactatgc agggaagtat gtcaaagact    112740
     gcgataaggc cattcttttg gacatcaagg acaaggtcct cttgaaccaa aggatagtgc    112800
     acaagtatcc gttctgctgg agatctgaca cacctctttt atacaagctt gttccaaact    112860
     ggtttgtcag ggttaaggac cacgtggatt ctcttttgag aaacaacgag gaaataaatt    112920
     gggtacctcc ggacataaaa tacaagagat tccacaactg gctggagaat gcaagagact    112980
     ggtcggtctc aagaaacagg ttttggggaa cacctattcc cttgtggacc actctcgact    113040
     acaaggatgt aatatgtgtg gggtctgtgg aagagcttga aagactgagt ggaaggaaga    113100
     ttgatgacat ccacagggag tttattgatg acattgtcat acacaaggat gggaaggagt    113160
     acagaagagt tgaggaggtt cttgactgct ggtttgaaag cggaagcatg ccttatgcac    113220
     aagaccactg gccattcaag gagaggctag aagcaggcct taagaacctc tctgtggaag    113280
     aaggaaagga aggaaaactt gtgaaggaga actttccggc cgactttatt ggagaaggag    113340
     tcgaccaaac aagaggatgg ttctatactc ttcatgtggt gtcttcgctt ctatttgggc    113400
     aaccggcatt cctcaatgtg attgtcaacg gaatagtgct tgcagaggat gggcgaaaga    113460
     tgagcaaaag gctgaagaac tacccagatc cttctgttat attcaacacc tatggtgcag    113520
     actctctcag aatgtatctg atatcaagtc ctgttgttga ggcggaaaat ctaaagttca    113580
     atgagaacgg ggtcaaggag gttttgaaga cattgattat tccatggtac aattctttag    113640
     gattctacct tgaaaacagg catttggagc cccggggaga acgtctactt atggacgact    113700
     ggataagaac aacatttgac aatttcactg tgtctttgac cgacaaaatg aagagatatg    113760
     agctttcttc ggtgctttct ttggcactaa gatttgtcga tgacctatcc aactggtaca    113820
     tcaggatgca cagaaaagaa ataagggcag gccatcatac tgttcttgga gatacactcc    113880
     ggaagttctc catagtgatg gccccattta ctcctttttt cagtgagtac tcctatcaat    113940
     cgattaatcc tggagagagt gtccatttcc agcagtatcc ggtatgcaaa agtggaatcc    114000
     atccctttga gacggccaag agcattataa ctgcagtgag acgtcttagg gaaatgaact    114060
     cgatatctct gaagactccg ctcaaaagcg ccacgttgat aagtagtacc gaattatatc    114120
     agaaaatcag ggattatatg gatttaatca agtcggagtg caatgtcctg gagctgctcc    114180
     ataaggaaga aggaaagtct atgttcgaca ttacggtgaa gcccaacttc cagaatctga    114240
     aaaagaacaa agataccatg aagagaaaaa tggagcttat ccgaaagtta acaagtgatg    114300
     aggcatatgt ccttttaagc tcgtctctga atatggaagg ccttgagatc cttcaagacg    114360
     acgtattgat tgtgaagaaa atcaaacatg cagagggtat ctcccaggag tttggagact    114420
     tcagtatagc cattgataac actctgaacg aggacatagt tgaaatgaag gttgcaaggg    114480
     aattccacag ctatgttcaa aagctaagaa agagcatggg cctaagcatc agtgacgatg    114540
     tggtggtgga tgttgagtgc tctgatctaa agagtattgt gggaaagcac ttcgatatct    114600
     cctttggaaa tctgggagtc ctgtgcggaa agggagaata tgagtttgat ggcactttgt    114660
     actctgtctc cctctacaaa aaggcctaac cacaaacacc attaaacacc caacttactc    114720
     gagtctgttt atttgcttac cctgttcata agagatatga aatcagacat tcttctttca    114780
     tagtcagtga tttcgtcctc cagtcttctt tttttatccg aatcgggctc ggcatcggct    114840
     cttctcttga tttcgtcaat cttcgattgt agctcgttga ccggaagcac atagccatct    114900
     ccaaccctgc tctgaagaat atcaatgatc ttcttctgcc tatctatggt aatgcttttc    114960
     ctcttgctag actcaagagt tctctttagt gtctctctca gagtatcgta atctcttctg    115020
     atcttggaat ttttgctact gagctttgcc actgcttcag aaaagttgga gttttcagct    115080
     ttgatcccat ccatcccctt cttcagctcc aaatagtctc tgaggacttt ctcgtgttct    115140
     ttttccttct gttgcacttc cagtccagaa gactccatgt tcttgattct ccgtctcatc    115200
     tccttgaaca cgcttcttaa ggctttttgc acaccatgca ggtcatcatc tcttatatcc    115260
     acatcaaccc caaaatcctc tgctgcttca gtaatatcct tactaaccag accatttatt    115320
     ttcctcatgc cctccatttc tcttgagcac ttgtctagtt gcttcacaaa ctcccctgtg    115380
     gctttagcat atcctagctc tgcttcaaag ctcctacttc tcatctcaaa gaaaattcga    115440
     tgaagcttat ggcttatctc ctcgatctct tttaggtctt ccatcagctc atgggtcctt    115500
     cttgatagct ctcctacaga gttccatcct ccactctcaa ccaaatatgt atctggagaa    115560
     aaaaaaggat ccctttcttg cagctcttgg catatgatgc ttcttgcccc ttccaagttt    115620
     cctcggcaca cctctcggag aatacacttt acaaattcct tgctaaagta ctcccccttt    115680
     ataagtctgt cgatcttctc gctgaccttt acataggtct tatatatact tggaagatat    115740
     acacagtctt cgttgctttc ccctgaaagg cttccaaacc cagacagggt atctgggctc    115800
     tcactggaaa cactatccaa cgaggttttc ttttcatcca caacaacctt gatatccgac    115860
     aaggaaagca tctccaatcc gttcacaatg tactttccca gttgctgaga tgtgtctgga    115920
     gatcccagag agacatcccg ggtattttcg cacggcggaa aaggtttctt tccattatcc    115980
     tctgcaaaga gcctcatagg tctagggatc cgagcaaaaa ttcaggccat cagaagatgt    116040
     attcgagagg atagaacccc caccatggaa agcagagaca ctacaataac tagtatagtg    116100
     gcgcatatag accatggaaa gacctcacta atggacagcc ttgttgcatc ccaaggacgc    116160
     atatcaaagg cgcttgccgg gtccataaga ttcctcgaca caagggagga cgagcaagcc    116220
     agaggaataa ctctaaagtt aagcgctatc tccctggact acggaggaca cagatatgtg    116280
     ttcattgaca caccaggaca cgtcgacttt gagtccttga tccaatctag ttccatactc    116340
     tccgataatt ttcttattct tgtagatgtt aatgagggaa taacaccgag aacttattca    116400
     cttgtgaagt atgccaaagg aaagagatgt gttcttgcca taaacaaaat tgacaagata    116460
     tcttctcccc aggagctact tcaaaagaca caatctgtgg tgacttcgat caacgggctt    116520
     tctggtagag aagtttttgg atgggatgct aataacatca tattgtgctg tgcaacactg    116580
     tgctatggaa tcaacaaaaa gatgttccag aaagttgttg gaagggatgg aagtttgaag    116640
     aacgccatcg accttctgtt ccatgtttac aacagaatag accagaaaga tgtggccagg    116700
     atatgcgaga gattcaaggt ggcggtccga agcaggaaga atattctttt ggcaatgctc    116760
     cctctatctg agtgtgtgtt caattcaata ggagtagaca ccgaggactg tatgaaacag    116820
     ttttatggat ctgatctaat aaagctgaat ccaataccat cggataagaa gccttcgcta    116880
     atgggagtta ctgtctatgg agtcctcaaa acgcctcgag agtacagtaa gtcctctgta    116940
     ctttttgtca caagactgtt ctatgggact ctaagggtgg gagacacagt atattctgcc    117000
     gatggagaaa atatctcgga atgtgcagta gaaagcctgt accggttcgg aataaatgag    117060
     ttgattgaac gggatgaggt gtctgggccg gaccttatct gtattggagg cagctttcga    117120
     aagaactcag tgataaccga tgttcctgca tataggatgg atattcagag taagataaca    117180
     cccttctaca agttcaagat tgtcctaaac aacatagaca ggctcgatga actaaaggag    117240
     gtttttcggg tgatgtcttg tactgagcag tttctaaagg tgaagcttaa taaatacaag    117300
     gagatagagg tttcatgcac agggaaggta cagtctgaaa agataattac agatcttgga    117360
     gactctggat ttgaattctc ggttggagat cttgaagaaa agttttgtga gtattccacg    117420
     aagtcctcga gtggagtctt tacccttgaa gatctcagcc tgagggtatg gatttcccag    117480
     gtatgtggag tagaagaaag cgctgttcac ttcaggagat gggaggataa gaatggaaat    117540
     cggtttggtc ttgtatctac cctgtgctta gagatggcaa ccaatgttct ggagatgttt    117600
     gtttctagtg gggcgttgat aagagagaat atatacagca caagatttgt tttagatata    117660
     caggggaatg cagatgccat tgaaccagac ctactatatt cattcttgaa gaattcgctt    117720
     gtttcggtat atctttctag ttctccatct attgcaccaa ccttctatga gtgtacaata    117780
     tcgatccagg agatgtttat tggagagaca tacaaaagcc taccgaagga tagctatgtt    117840
     gttatccaag aatcctacga agacaagacc ggcttctacg tccttacagt gctcattccg    117900
     cagtttctgt attcaaactt ccttgaggaa atcagaataa ggaccaaggg aacagcatat    117960
     ctcctggtga aagatgtagg atacaagttt ggactggact tcagcaagca gatagaggga    118020
     ataagaaaga aaaaaggttt gtttgtcgaa gagaagattg tcgagagacc ttcccagcaa    118080
     aggacatata aaaaatagta tcatatttaa taataataaa aagtttggcg gatttcaaca    118140
     atcaggtcca tacgacctaa gagttatgga aataaggagg cacataagcg taaatagccc    118200
     tatagctgtc ctgtaagaga acacatttgt ctcttcttcc tgcaaaaggc agtttccaaa    118260
     tcttgtaccg ttgatcttta ctccaggtgt tattactttc acaagttttc tattattggc    118320
     cggccttgga ggaggtcctc tgctctcctt cttcgagtcc acagctaaca cagatataac    118380
     ttcttcaatc cccattctac ttctgcatga aggacagaat ttgcatcctc tgatcgactg    118440
     agaccatatg tataaacatc cccaacagaa cagatgtcca catggcgtca gcacagggcc    118500
     ttcggggcgt gagtagcata tattgcatgc atattcccgt ccgacacgtc ttctttcctt    118560
     ttctctgcag ttatcttcta tgtatgtgct ccttggagct ttatcgcccc actcttcaga    118620
     cttttccctg gttttcatgg gatagtcatt cccctttctc atgaatctgc tagacttaag    118680
     tgtcaagctg gtggaagagg tcaatttatt tctacgccag ggaagacata gtttagatgt    118740
     tttggaaatg gagaagcttg tcaacaagat caacgaagtg cagcttcttg tgaaggactc    118800
     ggaaaggaac ttcaagcaga ttctcaagga aatcgaagga gaacatgcca ggtctgattc    118860
     tgttgtaatc gtaacaaaaa acaaaaagct tgtctgcgtc ctaggagaag agatagttaa    118920
     gccaagaata gaatccattg atgcggaaga ttccaagtgc agccatactc catttttcta    118980
     cgagttcaag ccatttggaa gtacagtgta tgtagagaca cttgatcaat tgctggatgt    119040
     agacaagaga atcacccagg cagccatcga ggtatttgat cacacttata ggtcctatag    119100
     aggattttca tgtttaattt cggtgggaga cacagagggc tgcatctaca taatagatgc    119160
     gataagattc agggcagcca ttcctagact tgcattgctg aaatgtggag ttccaaagat    119220
     agtccattgc gagcagtgtg tccaaaggct tctacaggac tttaaacaca ttggatgctt    119280
     ccgaaattat gaaatctctt cggatatggt tttcattgat tggaggatac gcccggtgcc    119340
     aaagtttctt cttgaagttc tgtgtaaagg agttcaaaag ataagagaga tgctagaaag    119400
     aggtgtcgag acaagaacct attgctccaa agagattgat gaggtggagg atattgccgt    119460
     gaggtacgga atcaagagta ataatgacaa cgacattctt aaggctctcc taaagcttcg    119520
     gagatttctt gcaaagaaca acgatgaatc cgttcactat gtcatgacag atgaccaggt    119580
     tgtccggttg ttgagagtca agccagacac acaagataag tttcttggag agataggaag    119640
     gctctcccct ctggcaagac agcatgctat ggacttcttg cttgtgttta atggcaaaaa    119700
     agggagtttt cagttacaag atctcctccc tccaagtcaa aaatgacggg tcagccatct    119760
     tgctgttgag aggccccctg acctgaaaca agacaaataa accatctgga ataacgtctg    119820
     ataaaatcga atggggagta aaaataaagg caggaaagtc gatgtctccc aaaatgtggc    119880
     ctggacgttg caacgaggaa gttggataat ccatgtgctg gttatacttc tcctcaagat    119940
     gacgctttcg gtggttttca acgacagcat aggatggcag ctctcactaa ttatctacaa    120000
     catctccacc tttgttttct tccacatgat ccccggggat cccttcaacg acagatacag    120060
     cctctataca ttttgggaac agatttccga gcaactggag ggcacacccg atctcatctt    120120
     catagctctg ttccctctga tagcatttac agctgtcaac ttcattataa ggtggaacat    120180
     cttcttgttc tggatttgtg ttgcaagtct gttcattgtg actattccaa agtttggatt    120240
     catgcatctc aggagaatct tgatattcaa agagtagaac ggtaggccct gcgatcaata    120300
     aacttatgct attctacctt gtccatcaga agctccttct ttttactgta ggactctcct    120360
     ctatattcta cacagcctaa gacatctgct gcaagtttgg ataggttttg aagaacaagg    120420
     atctccacaa actcgaggat cagaaactcc tcaacactgc tgaagctccc ctttctggac    120480
     agaatgcatt cgacaatctt gtggatatct gtgtacttca taccaaacgc ttctttgaag    120540
     agccttatcg actgatctgt aagccctttt ctggtgtaga acttcattgc atgcactttg    120600
     atctggagat tcccgggatt tgtctctacg gctttcttca gaaaaaactc cgcattttcc    120660
     atcttctctg tcttggtgta aacaagccca catccaaaca ttgctctata gttatctcca    120720
     agcatcttca acgatagatt aaagtatttc atggctatgt cgtattcgtt tctttggatc    120780
     gattcatatc caagaagtgt gtaggtgtat gagtcttctt ctatcctcag gcttcttttg    120840
     aagcagagga tgctcttctg gtaatcgccc tgatggctgt agaaattccc taaagccttc    120900
     catgtgatgg gagaatcagg tgcatgctta atcagattct tgcatagcat tccaagctca    120960
     tagacatctt tcgaatgcca gagaatagtt gagtagtagt ccatactgta gagaaacatc    121020
     ggatcttttc ttctcaccag ctcaaaacat gccttactct tatcgttcat cccaaggttg    121080
     aagtatcttc gtgccgcatt cgaaataaaa taagatccga tcccaggaac atactccaaa    121140
     tactttttca caagagagtt cgctaggctt tcgtggaatt caatgctgtc ccacacatac    121200
     tcctcttcaa tccctccttt ccctgcttgc tgaatgttct ccttgtccct cttctgagga    121260
     atcttgttct caagaaggag gttttccata ggagagaaca gaaagctctt cccaaaggac    121320
     cttagatagt gtccaatccc ttcttctctg catccaaaca aggtatataa gtctccgagg    121380
     agagactcaa gaaactcgtc atcgtccgga tcaacaaaca tctcttgtat tcttgcatcc    121440
     acgtcgggat ccctctccac ctttccctcg agaataagct ctagactctt aatggccttc    121500
     ttgtagtctt ttctcttttt gtagcaaaga gattcgtagt acttggaagt acatgtgtta    121560
     agcttatgga gatgaaagag ggcacgggaa tactctccgt tcagatagag cactatagac    121620
     atgagtgtcc tgtattcagg cctgtcatgg agtagacatg atgctaggaa aatagcagtc    121680
     tcgtagtccc tgtatcttat tgacttgcat atctttccaa tcagcttggt gtccatttga    121740
     gggcaagctc ttgttgtttg aagactattc taatattcta aggatcttta ttgtccaatt    121800
     gtagttatct tagaaaacat tcgagaaagg ctatcgatcg gaggttttgc tcctggaagc    121860
     acaactcgtc gtcaatgaca gatccaagaa tttctatttt cttgcaaagc atgccatcat    121920
     cctttatgtc tctttcatat aggaaaagaa taaatccaat gaattcagag aagactggta    121980
     caagctcctt gaccgtaaag aactcaatca ttacatcaag gacactttct agttctcttc    122040
     tattcagatc ttgaagcgca tgtacaaatt cccgtctttc atatatgtag ctcatcaccg    122100
     agaacacctc ctgaatatct cttttcctta ctgcatgcat catcgatttc ttgtactcaa    122160
     atgcattcag cttcttttct aagtatgtta acttggtttg gcggttccga acaatctcaa    122220
     tctttatctc gtcgtgaata ccatcttctc tatccttcag ctggggagaa tccttctccg    122280
     tcttattcct tgccagctcc agcacccctc catcctctat cccaaggtac aacacatcgt    122340
     tgaagatact aagactcagg attcctcctc gaactccaac ctttgatatc atcttaagat    122400
     ctcttgtaaa tacccttaca tttccatcca ctgacgccgt atacagcctg ccttcgtaaa    122460
     acaccataga cgtcgcctcc ttgatatgga aggctcttcc aacctctact cccccgttct    122520
     ggacgtcaat tgcacaaacc tcgttctcag ataaaaaagc cacacgccca cttccaagca    122580
     tgcaaatcct cgacacacgg cggtgggtat tgtatccaaa cacctttttg aacgttgtta    122640
     ggcagtatcc gttgatgaat ccatcgtaag accccgaaaa cacaacccca tctccaacag    122700
     caatgctttt aacatagtct gtgttgtcaa gtatggtggc aacagactcc tcctttgata    122760
     gctcaaatat ttttatcttc atatcgtcgc tacaacttat tatcattgtt ccattaagtt    122820
     ttacttcatt aaccctggct tcatgttcgt ggtactgccg gacaatgctc ctcatctttc    122880
     caaccacttt gacacatcca ctttcatccc cgcacaccgt tagttcttca tatacatcta    122940
     tggcgcttac gtctctatgg aacttaacta tcttcttctt ccttccttct tcttttctga    123000
     tcactgccac atagttcttg ttgaccacaa aaactccatc cttcccactg cataggtgga    123060
     agactccctc cttctgctcg tagatggtgt cgaagttttc ccttgatgaa tcctttatcc    123120
     caaaattatt gcttcggaag tacaccatat gggcttcgac aagacagaaa ataactcctg    123180
     gagcttttcg gtctctgcag atgtaagaac catgaatcag aaagcagatg ccttcttcag    123240
     agctagacaa aactctaatc ctgtggtctc gacaaagaag aagatcctcc agtttgcaaa    123300
     agatagccaa gtggatatga acaaatcttt aatcgaaata gaggagtttc cgaggaatgc    123360
     atatgcagac gaactggaga gatttcctgt tctaaaggac taatagtaaa tcaccgatgg    123420
     aatcaatgct tggatgccga aaatactcct cccaacctcc ctgtcaaccg gaaagttgtc    123480
     tgtaaacaga accaggtggc cctttattcc gtttagcact tcccagatga agtcactttc    123540
     caccgaataa agattcagat gccctcctgc atagcttttg atgtttccaa acatcttttc    123600
     aaacatctct gtgttccctc ttgccctagc cacaatccta gtaaagacgt cgtcacttgc    123660
     aagatcaagt tcgttgccga gaagccagct ctccaaaaag tcttttggtc cgtatctgtt    123720
     ttggtcttcc tcccaggctc cgagatgttc tttcaacagc ctcttcaaca gcttacagac    123780
     aacctctctt tcgtccctca ccagtaacgc tacttctgtg tccctgtttc ccagcatgct    123840
     tctgtcatta agatttgcac ttcctactat tgccgatgtc ccatctgcaa tgatcatctt    123900
     ggaatgcacg tagatttgct cctgtccaat tcttttccca tcaaagtgga tcttcctcaa    123960
     acacataaat acaatatacc gtcctgaatc aaccccattc ctctttagca cctgatgcaa    124020
     gcaagtgtct ccccttgata tcgattctga ttggattctt actatctcag ctgcaggagt    124080
     caaaccaacc atgaatcccc catcaaatat gggacagaga ggaatcacaa catacacttt    124140
     gaattcctcc ttagctctat ctgcctggat tattctctcc acaagtgccc ttccaatggt    124200
     attttccgga tatcctggtg caaggtcgca ttttgtgatg aaaaactggt tctccatgta    124260
     tataaacctc ttggagttac gaatcacctc ggaatatcct cttgatatcg aatcttcatc    124320
     atatccaaga gaccatttcc caacagatct cagcacttga gtttttggaa atgctctgtt    124380
     tacctccagg tctccgagtg tctgctctat ttctatgaat tcttcatttg ggattaagag    124440
     ccttgcactc cctccctctc catcatactt ggaaataaca aagttccatc gttcgatgaa    124500
     atgctgcgat atgtcaaatg cagaaccccc cacaaccttg cactggacat catgccatgg    124560
     taattccagt atcttggaaa acacttcttc tttccttctg tctgttccca ggcctccaca    124620
     cgcccattcc gtcctaaaga gagaatgttc ctgtgtgtcg tacctccctg gtgccaaatc    124680
     tatccctcca acatatgcta tcctttggtc tataacaacc agcttttcat ggtgtgtcca    124740
     gtatatcggt gcatgtccta tactgtcagg atgcctgaga acctcgattc tcttgtgcag    124800
     gttcgacaga aactcgcagg tgtggttgga gttcatcttg agtgccccaa atacttctcc    124860
     atatacaagt attcttattc ttattccttc ctcggccaac tctttcaaga catagtcaat    124920
     cctgtatttc tcatccaact tccctccaac atactccctt cgaagataaa gcgtaggata    124980
     aatccaccat ccagcaatga aaacctctct ccgggcaaga tgcaatgtct cgtaaagatt    125040
     ccaaaaatag cttttcccat ccacataaaa gtttatcatg cttcctctcc tcactgggct    125100
     gaaggagaaa agcctctccg atccccttct ttcctccaac cccttctgaa tctcattgaa    125160
     caattgcagt acagaatcgt gtctaaacga cttaattaca tatttcctcc cgtctctcac    125220
     catggttatc ttactgtaaa acacatctgc tttatacttg acatccagat cccttctata    125280
     gaacagaaca ttcatgtctc tgtagccgtt tctgtaatca acaaacacta gatgcgatct    125340
     cttactgaca acatatatct tccctgagat ttccaggact ccataacagg aagtcctgca    125400
     tctgctctcg tttaggtcca ttatgcttac atggaactta tcttcaaaca tctttgtacc    125460
     attgaacgaa tatctggata tcctgaagaa gtcatacacc ttgccaatat ccaagatccg    125520
     ggatcgatgg aggacagtcc taagaaactc ctcaacacct ctaaactgtc cctctccaca    125580
     tatgttgggc ttgtccctcc ttaaatccgt gactcctctg taatggagat atgcattcaa    125640
     ggaaaacaat tgcactatcc ctacatttat tttccatttc tgtctcccgt agctcagatt    125700
     tactgtatac tttgtggctg acgaagattg gctgtccaca ttcaccttaa tctgatctag    125760
     taaaacagga aacacaggag ccgaggactg aaatccaagc ctcctgaaag gaatcatgaa    125820
     aacagactcc agcaaccctc cgtacacaca agcactcttc gacacaaaat tcccatcttc    125880
     aaactcactt tccatcgacc ttctaggtat cccatcttcc gaggttttat ctggaatttc    125940
     cataaccaga ggaccacctc tcaaaatgaa atatatctta ggcctgaaga tgggagagag    126000
     ctgtcccggt gtgtcaagta aagatgcagg aaaagctaag gaatgcaaag ggtgtccgaa    126060
     tgcgtcatac tgctcgcaac cagcccagcc agacccagac atcaagataa tccaagagaa    126120
     tcttcgagga gtaaagacca ttgttgctat tatgagcgga aagggaggcg ttggaaaaag    126180
     cacagttgtc cggaacatag cagagtcggt gtcttcaagg ggaatcacaa catgcattct    126240
     ggacttagat ctatctgggc caagcatccc gaggcttacg ggaacagacg gaatgtcgat    126300
     gtgtgaaaca agtggcatca tacagccaat agaggtgaac aagtttttga aagtagtttc    126360
     tgttggatat ctccaagact gtggagaagg aatcatgttc agctctagct ttaagacagg    126420
     aatcataaag aagtttctgg cacagtgtaa ctacgagggt gtggatgtac tgcttctgga    126480
     tactcctcca aatgtgacgg acgaacatct tgggatggtg aacttcataa aacctaagtt    126540
     tgcaattgtt gtcacaacac cgcagaagtt ctctctgcag gacgttatca ggcagattga    126600
     cttctgcagg aaagcaaaga tctctgtgct tggggtgata gagaacatga aaaggtttgt    126660
     atgtccaaga tgcagccatc aaaaaaacgt gtttgtcaat acagaggttg agtcttattc    126720
     taaatcaaac ggtattcctt atctgggctc tatagacctc aggcaggaca tagctaaagc    126780
     atctgatatt ggaaggccga cgcgagaaga gatcttcgac aggatggcag atgccgtcct    126840
     atcaatccat gaatcatgag tcttattcta tataaataaa tcccaaaaga atatggcgaa    126900
     tatatttatt taactcctgg tatttcataa ctcctcagcc cctctgctgc agattcactg    126960
     cttgtgcctg tctggtctat catcctgacg gatcctctgt cgacaaagca gaccttgtta    127020
     aataatggaa gcagatcgag gttgtggact atggccatca cggtaaccga gctttcgaaa    127080
     tctatgatat tctttatgat gtctatctcc gcctccttgt cgagattgga ggttggttca    127140
     tccatggcaa ggatttctgg ccttcttagc agagctctca gtattataat cttctgtctc    127200
     tctcctccgc tgatgtgtct tcctgcctcc ccaacattgg taaaataccc tttctcaagc    127260
     ctcataatgc tatcatggat gttgaatctc tttgcaagct cgacaacagt atagtccgaa    127320
     acattggggt ttccatactt aatgttgtac atcacagtct cgttgaacag agaggagttc    127380
     tgaggcacat atcctatgat cctcctgaac gaaccgtttt ctatggcgtc gatactgatt    127440
     ccatcgatgc atatcgagcc ttggtacctg ttgaacctca ggaaggtctt tagaatggtc    127500
     gactttccag atccgttaga ccccacaatt gccaccttat cccccttttt gattgtaaga    127560
     ttcacatcgt tgagaatctt cttgtctccg taatacaggc ggacgttttt aaacacaatg    127620
     ttcttcccaa accttaccat ggaaatattt tcatttgttt tcagatcata atcctccgat    127680
     agaacttccc gagcattcag catggcctct gtgaatcggc agtatgtgta tccgagattg    127740
     ttgaggttta taagtagaat cctgcttgtt gtgacataga agatcaaaac ccttccatcc    127800
     atcttacttg aaagcagtcc atacactcca agtgcaatca tagaagagtt caaaaatgca    127860
     aatataagct tctgcagcat gtttagaatg tacagtcctc ggaataggtt tgttccaaac    127920
     ctctcaatct ccatcagctt tccatcgtat cttcttacct caatgcagta gttgttgaat    127980
     gacataacag actcgtgatt actcaaggtg tcgtacacaa tgttggatgc agcattttca    128040
     gcactgttca gagcccctct gatcctattc cttctcagag ctatcgatat cgtcatgaaa    128100
     ccataagcag caacagcaag agcaacaata aaagaggcaa gaactccaag cttcagatac    128160
     acctcaagcc caacaaaggt tagcgaagcc accactggga acagattctg gatcgaaacc    128220
     tccacaaagt cgctgattgc cttgctcttt cgggtgatga tgctttggat tgttcccgat    128280
     ccataagact caaacatctc cgtttccatc cgaataaagt actcgaaagt ggttctcagg    128340
     gtgtatctgt aaacatactg gattgcactg acaaacacaa atccttgcaa ctctgtgaag    128400
     atgatgcccg ttagagaaat cacaagaaac atgattatcc tgcttcgggg aacctcctcc    128460
     aaatctaggc cctcggatat gtaacttata caacttgcaa ctttgacttc aaaatacttt    128520
     cctgcaaaga tgctcaggag aacaggaaac acaatgattc ttgcctgcgg gatcccgagg    128580
     atgtacttcc tgacaatgat gctcaaagtt tggagctcgc ttactttctt ctttccaccc    128640
     atttccgtaa tatttttcga aaatatttat taggcttgtt tagaactttg atctaaaaca    128700
     caatcaagat ggcgtctctc ctgttccttg cttctttgtt tctctggatt ttgccatcag    128760
     aatagacgtc tccacatgct gggtaaggat cttcgacctc tgctccagtt ttctaagggc    128820
     ctggtcacac tctgcaatgc tgttccttaa tacatcaaac ttctccttca aactcatcca    128880
     ggggcttgac attcaagatc gaataaggct cctggcccat ctgaaaccca aagtctcagg    128940
     acacttttta ggattgaaca gacaaggcac aaaagacagg atcttaaaag attagtttaa    129000
     tttcaaactt cacaatgacc ttgtatatat gcattagtac ttgcagtcat catcaccaga    129060
     gtccgaaggc tcgttgatgt atatcaccct ctggttctta cctcccttct ctggcgggat    129120
     gtacacctcc ctcggatgat tgtccacatc gatatgtgta gagatgtctt catcgcttgt    129180
     gtcatcaatt ccaaagacta ttgctccatt aacactgggc ttggaagcta tgcaagtatc    129240
     tacatactgg caaacatagg aaagcttgtc ttcatcccta ggactcgggt actcctgatt    129300
     gagaaacaga tccttcgccc cggaaatggc ctcggatatt cctgacttga tgaagtctat    129360
     tgtgtcttct gtccctctcc acaacacacc tattgacctt gcacattcct tcggctcgcc    129420
     aattactatc ttggacatta tgttttcgtt atgagatggg caactccaca gaaacagatg    129480
     gattcctatc ttcttgtcct tgtatgtact gaggagatgc tcgtggacag tggttgtcct    129540
     tgtgctcaca ggttccacaa gctcacagga actgtcaaac ctctttgttg gcacaagctc    129600
     gttgacgtcg tagtcctttg catcgaatcc aatcttcacc ttgtacttcg ataggaattc    129660
     gttgtaaggc cccaccaccc tgctcttcag gtagtgttcc acagcttctc tttcatcctt    129720
     gcaatcagaa aaggcagaga agatggcatc tatcgttcct ctgtcaaagt gtgcatacag    129780
     actaaccaga tagattttgt cgtcttttgt acatgcagga tctgcttcga agcccccgaa    129840
     gttgtattca gatgccaatg caaagccttc tctgaccaac ccaatgagaa gcaaaagagg    129900
     agatgatgtc attagaaaca tggttttggt gcttctttct cggaaaatat ataaatattt    129960
     tgtttgaaac agatgttttg gctccaagga ctttgttttg ctatctctca cacacctgat    130020
     tcacctcctc cgtctgaggt atcaatccct tcctttccct cctggatctt cttaactgtg    130080
     ttcagaatgt tgaaaactgc caggttattt ctgtcttcta tcttctcgat aaacatcaag    130140
     agagccgcct ccatagtaga cattgagagt tttgtccagg tagtaggaat ttcccctctg    130200
     ttgaggtaga agtaatatcc cacttccttc gacctaatcc tattgagtgc attctccact    130260
     cggattcctc ggattccaga gacatacgac tcgatcgatt cagacactcc taatccattg    130320
     cagattgacc gaagtgcaat caaagactct atctcggcat ctgcctgaaa cacaacaatg    130380
     tcaaatccca gggattgggc tatctcaatg gtctgtctag gaagtggatc tagcctagta    130440
     gaagaggaga cgtacttatc agactcgggg cgaagatcta tccaggaaga aaaacccata    130500
     tctccaagat agttcttgag ttcctggatg aagctggagg ccactgagaa cttgtgtatc    130560
     gatctgttct tcaatcgact aagggcatga gctatcacaa gtgactggag tgttccatcc    130620
     agatagagga gtattttact tccacgagga agcttcctga agtgtcgaaa aaccttgtga    130680
     agaaactgct tttcaaagca tgtgtcgcag tagtccagat tacttattcg gatgtttgga    130740
     gctgcagtgc agattataca tctgtgttcc atggataaat ttttcgatcg aagatcacat    130800
     ttaatgggca cggagcacac gccggcaaat gtcgagaaga taaaaggagt gatggatggg    130860
     atcataggag atctggaagg gtatctcgag atgtacaaga gccatgcaag gttcctccga    130920
     ggtagaatca gcagggataa gcaagaagga gaggttcttc tccaaacagt gacgtccaca    130980
     ctgaacgaga tgaaggaaag gaacgaaaga ctagttgacg aaaggaatgg acttaggctg    131040
     aggattgagc aagatgtaag ggacctaagg gcttctgagg atgaaaaaca tgagcttgtg    131100
     aaccagatcc gagagctcga gatgggaaat ctcaacctta aggaagtctt ccgagagaag    131160
     aaaagcattg aaaacgcctt tacaaagaag atggaacttg tttcggaaag gagtaggcaa    131220
     agagaggtcc ttatggaggc gaaggccgaa tggtttagaa gatatttggg aatggacatc    131280
     attcctgtcc gggagaatgt aatcaagatt gtcttcagca gaatatgccc tgaagacagt    131340
     gtggagtgtt ttgtaactct ggacctgtct ctggaagggc ctgttgttga tctgtttcct    131400
     aggatgtatg atcttgaaaa ggccaacaac ctgttccgag agcacagcaa cttccatgac    131460
     ttcctaagga ctgtgagaag ggagttccga agagaatact ctggggtgtg actagtagtc    131520
     tggttgatta aagatttatt ttgtgattgt tgaggaagtt gaagacggcg gcgaaagaac    131580
     cccaatgaaa agttacaatc ttgtgtacaa gccagagcat ggggaaaaga ggtttctatt    131640
     caccaacatg gatgtcaagg agctctctcc acctgtgatg atttcacgag agaggcctct    131700
     acgagaagag gttgtgttta gcacaaagaa gaagagtgag caagttgaat atgaggatga    131760
     ggaatacaag aagctgaagg agaaggaggg atgtttgttg attcttgaag atggtgagag    131820
     tagaatatac tcgggaaaga tgcaggacct gggggcaagt aactcgtgct attttgtgtt    131880
     tatcaacacc gggacgtatc tgaaggttgt tcctgtccgc aaatggtatc gctttagcca    131940
     gaagtcacag ctggacatta tccaggagta cgagggcgag ggtattggag aagagaacgg    132000
     agacggagat ggggatggaa cctcaacgga agagagggag gagattgatt ttgatgacga    132060
     ctttgacgac gacgatggag aggatgcgaa tgtgtttatt gtgagggaga agaggctaaa    132120
     cagtgcagga cggcggatga ggaacatcat ggagaactac gaggagaaag aaagaagcga    132180
     gagttctgag gagaaggata cgaaaggggt tgaaaaggtg gacaaagttc ttacaaagga    132240
     cgagattcgg ggaatgttta agggaggaag aattgctttg agagatcttc ttcgtggggt    132300
     gaaggtgcga tttgggctca acgacgagga gaaggagctg gtgaaggagt ttattagaga    132360
     aagttgcacg tttgagactg acgaagggag caaggagaag tatcttgttt tgaggaaata    132420
     gagtgtttga gggattgaaa gatttatgaa ttttggatag agccctaatg aggcggatat    132480
     tagaggacag actgatgagg tacttgagag aagtgggata tgaggttgtt gagaagagag    132540
     ccttagaagt ttacatggga tctctcgaga cttatatgct tgagcatttg aaagcagttg    132600
     tgtctgtctc caggcatggg ctgaagtctc actctacctt gctggatttc ctacgcttta    132660
     tagagggaaa aagatttgaa tttcctttct ttgagaatgt tgtgtacgag gaagaggtta    132720
     aggaggagga gaaggagttt gccagtcctc tggcgtcaag tattgagaag tacatccaca    132780
     tatatgactt catgcccagt tttccgccga tacatgcgtt ccggcagacg attgtcaaag    132840
     ctggaaacaa gggcagcaag tctatgaatg tgaagaacag attggaacag agtctaagga    132900
     ccgaagggaa tcttctgaag ttgatcaagg catctggatc tcttccgccg tttgttaact    132960
     tcttgtacaa gaatgagtgg tcttaatgga ttaaagtggt ttattgttct atgtttatgg    133020
     attccggggt tagagggggg agaagtggag ttttgtgtga gattgcgggg gatgggggac    133080
     ttccatgagc attgatagta tagtggttat tatgtgagct tcccaagctc atggcccggg    133140
     ttcgattccc ggtcaatgca ttttgtcggt gtcattggcg ggaagatttc cctccatacc    133200
     tggaatatat gccaaagaag acagggagag gctgatgata aagaggctcc ctgaggatat    133260
     agggagaaga ataaaagccc agcgatccat tccaaacact tacattgttg tgaaagaact    133320
     ggtggaaaac tcgattgact ctgaatgcac atggataagg atacaagtcg atgactctat    133380
     agtggttgag gacaatggat gtggaataag cgatctgcgt gatgttggag ttgagggaag    133440
     tacttcgaag gagtcgatgg catactatgt gctaggatgt gtcgacagag tcgagaagcc    133500
     ttcttatggg ttccggggac aagcccttag ttctctttcg gaggtgtgtg atttggaaat    133560
     tatttcccga tcagaacatc cgtttggact caaaaaagac ttttcaacag gcatcgtttc    133620
     aagatgtgcg agggagaaag gcacaactgt ccgtgttcga aatctattca agaattgccc    133680
     tttaagaagg tcggcaagcg aaagcaggct aaagaaggac ctgggaagga tctgtgcttt    133740
     gattgaatca taccgctgta ccaacaagat aaatttcacc ctgttccaca agagaaaggt    133800
     tcttctaagt tgtggagggt acgagacgcc gagagagtat ttcgaatcca actatccttc    133860
     ctttgtcggg aagtatatgg agctgtgcaa tgggcaggtg gaattcttta tgcttccggc    133920
     atctgtccga gagcccaagc agctgatgtt tctggaaaga aggccgattt cgaacaaaag    133980
     gatatcggct gcaataaaga atgaattcaa tctgtatagc gaaggaatcc cgacgtttgt    134040
     cctggtgatc aaggggtatg gggatgtaaa tgtatccacg gacaagagcg aggttatatt    134100
     ttctgacgag ggtgggattc tgagtcttct gaagtctgag attggcaggt tcttctcttc    134160
     cgaggtgcat atgcattctc ggagcattcc caagactctg ggaagttatt ctccagcccg    134220
     aaacgaaaca gaagacaata gcggagaagg atttatggga agtaacttct ctggaacagc    134280
     tgtgcaccat ccggctgtga gactatcacg agtagctccc tccctgggaa agagggagag    134340
     aaagcagaat gaaatgacag aagaaaatga agaaaggagc aaggattcat cgtcggtgga    134400
     agaaccctca tcaggaattg ggtcgctgga caacaccgaa gtgaagcctt cttcatcaaa    134460
     cctctctgaa gagttggagc cacctctcga ggagaaacaa caagaagaaa tatacgaaaa    134520
     cgaaggccat ctggcaacag gagcatattc attcttcaaa tacgacgagc ttgtccatcc    134580
     gaagatttcg ttttcaaaga gcgacttcaa cagacttgaa atcataggcc agtttaacaa    134640
     cggatttatc attgcaaaac tggagaaaaa cgaaaagacc tatcttatag ctgtagacca    134700
     acatgcagca gatgaaatca ggaactttga gaatatcaag aaaacatttt acctaaagaa    134760
     acagagtgtg atagtccctg tgaaattgga cctcacaccc attgaggaga tgattgtcaa    134820
     cgagaattca gaggtgtttg aaaaaaatgg atttgttgtg aagaatggca tgctggagac    134880
     gattcctgtt tacagaaacc aggtgtttgg aatcaaggag ttcagggaac ttctcgagga    134940
     tgtgaagaac gaagaatatg aattcaagaa aattcggagc ataattgctt caaaggcatg    135000
     tagaacaagc gtaatgatag gcgacgctct ttctgcagcg gacatgaaga ggatagtaag    135060
     gagcttgggc gtcttggaca ggccttggaa gtgtcctcac ggaaggccta cgttcatgat    135120
     attgaatgag gcagagatat agccaatgga ggacataaga tttatttaac catgaagcct    135180
     tcgatcccgc gggcctcatc aggaataact ccgaaactct tttgatgtcc tcaagaacca    135240
     cctttccccc ccttttgctt gccctcaggc tagatattgt cagcaagttc atagagtatc    135300
     tcagcccaga ttcctcggag atcgaaacaa gggcatccac agcactgccg tcgatgagaa    135360
     catcctcctc gagtattctg tgtctgatga ttgcttcgag atcttctcgg ttgtatttct    135420
     ccatagaaat gatcaaggca cggtcaataa agtcttttgg cattccatag ggacttgtct    135480
     cgtcggttcc ctttatcaca cactccttct tgttggttga aacgaggatc actgggcaga    135540
     agtcctcctc gatcgccttg tttagaaagg caaagctttc gatgtcaagc atgtgaacct    135600
     cgtctataaa caaaactcct cggaccacct cagcctttcc ctcattgatc cagttccata    135660
     ccttcttgtt cacttcatcc cttgtctctg ttcgaatttc ccccgtttct ccactgaaaa    135720
     gagcaaggta tccttcagcc ttgttgttta taacatcgat gtcatgaaga gatatctctt    135780
     gaatctcctc tcggatcttt atcaattccc cctcaggaca aggaacaaac cgtgcatcca    135840
     tccctaccat ctcattcttc ttcaccatgc tcgttccaat cttatacact cttcctctct    135900
     ccttgataat ccttataaca tccccggcgc ttaccttctc cttatcaagc tcattcctca    135960
     tcttttctcc tatgtcaaac gaagactcca tatcaacagt cttgagaaca attctccttc    136020
     cactcaagct cacaacttct ccttcaatcg tccgcacaga ctccttaatc cttagcccaa    136080
     cagacttccg aagagcctgg gtaatagcct cggacttact catctccaga ctatatatct    136140
     ctgtcccgct gatcgagtta aaatgcactc cccctaggct tttcgatagt cctattgcca    136200
     atgcggtctt tccacttcct cggtctccct taatcagaac tatctttccc cctttgttgc    136260
     tctccaccat ctttcttata agcaccatcg ccttcctagc cttaacctgt ccaaccagtc    136320
     catccttgtt gtactcaacc tcatcctcat tgcatccaag ccccacaatg tgtgagtgga    136380
     gactgattct attcactgtc ccaacatctc ggacctccat cagggcaaag cccttaagaa    136440
     aaatttcttc aagcacacaa tcttcttggg aagtgattta tttcatccta acatcctctg    136500
     gaacacctcg tctatctccc tctttagctt gtccagctta gactccatct ctttccccgg    136560
     aatcacaaac ttcatcttca tcaggccata gaacacatcc tcggtttcct tccggacagt    136620
     ggaccagctg aacctatagt tcattatggc attcttgcag ttgtcaaaat acagaatgat    136680
     attccgaagc atcatccttg tctttgtaaa cgggcaatag ttgtcgtact tcgagtatcc    136740
     gttctgctgc aaaaagtcct cttttatcag cttggatatg tccagaataa gcttctcggt    136800
     ctctgaaaga gcgtttttcc ctaccaattg gacaatctcc gaaagatcgt catccagctg    136860
     tagaatctcc ctgcactttg tcctgttcac aataaagtct ggatctactt tgttgtagta    136920
     cggctccagg tttgagaagt acttcgagta gctcaggttc cagtttatcg atggaaaatg    136980
     ttttctttgt gcaagtttct tgtcaagccc ccaaaacacc tgtacaatcc caagagttgc    137040
     cgatgtcacc gggtccgaaa agtcccctcc aggaggagag actgctccaa ctattgtcac    137100
     cgatccggtt ctcttgggag atccaagaca tacaacagat ccccctcttt cgtagaaaaa    137160
     tgcaagcttt gctccaaggt acgccggata tccactgtct gcaggcatct ctgcaagcct    137220
     tccgcttatt tccctcagtg cctctgccca tcttgatgtc gaatctgcca tcatcgacac    137280
     attcatcccc tggtcccgga ggtactccga aattgttatc cccgtgtaga tcgacgcctc    137340
     tcttgctgca acaggcatat tagatgtgtt tgctaccagc acagttctct tcataatact    137400
     atcctctttt cctcctactg tcagcttcgg aaactccatc agaacctcac tcatctcgtt    137460
     tcctcgctct ccacacccaa catatacaat tgcatcggag tttgagtatt tcgataaaga    137520
     ttgggaaatc accgtcttcc cacatccaaa tgcacctgga atcgccgtag tccctccttg    137580
     aacacaagga aacaaagagt ctagaatcct ctgcccagta aacaatggat gtgtggcatt    137640
     ccttttctct tcaataggcc ggggaacccg aacaggccat gtatgataca taaacatctc    137700
     cactcttccc ttgctggtct caagctccat cacaacatcc ttcaaggtat agtttccacg    137760
     ggctgctatg aaaacaacct ttccgctctc ctttggagga acaagaatct ttgtttcaat    137820
     aagactgttt tcgtagacct tcccaaaaat gtctccccca acaacatagt ctccaacact    137880
     gacttcgggg acaaactcgt attctcgctc tctgtccaat gaaggaatgt ttacaccctt    137940
     gggtatgaag atcccctcag acctttcttg gatttctttt agaggtctct gaatcccatc    138000
     gtagatgctt tcaaagagtc ctggccccag ctctgcacac aacggccttc ctgtccgaac    138060
     aatcacatct ccaacacaca gcccgctggt gtcttcatac acctggatgg tagctctgtc    138120
     cttgtcgatc ttgatgatct cccctgctag tccctcattt ccaaccttca caagctcgta    138180
     cattgcacat ccaaccatgt cacatccgac aacaacagga ccgctgacag aataaacctt    138240
     tccttccatc ccctttactg gctcttctat gcttagcttt gcaaatgttt gctgtacaac    138300
     attcatcatc ccccttgccc aacctaactt tttatttctc taattgtttc gatttctctc    138360
     gatccttgca agcaggatgt tcaagtatta ggagttctga tgcacaagtc catcatgtct    138420
     ttgatgagtt ctcttgggca atctcttcca tttgctacga acaagctact gagactttga    138480
     gaggccgaat gtctctttct aggatcaaaa gacaaaagat ttccgacaaa gtcgactacc    138540
     tcctgcccat aacatccaaa gtcttgccca aagcttgcct caaagctacc aggtcttctg    138600
     atgttcttga gatggggaag acatagccct gcaaagtctt cgtctgcagg atatcctaga    138660
     agtttgaata tcctatcaag ctggtctatc tctccttccc caggtagaat tggccctccc    138720
     ttcagcatct ctccaacaat gcacccgaca gaccacatgt caatcgactc gttgtaggtt    138780
     tctgacccaa gtaatacttc aatggctcta taccacaggg taacaacaag attggtcatt    138840
     gtgcttccaa cagcccttgc aagcccgaag tctgctatct tcagatctcc gctcctcata    138900
     agaagaatat tcgacggttt caggtctcta tggactactc cgattccgtg cagaaactca    138960
     agtccttgaa gaatctggta tgtaaagaac ttggccactt ccataccaat cccccctgtc    139020
     ttcagaacaa tggacttcag gtctatgtca cagcactcca tcacgatgaa aaaatcattg    139080
     atctcgcatc cttccaccac ctcctcgatc cccatcacat tcttgtttct tgcatgcttt    139140
     agaatcatca cctctctcat gtataggatc gaaaacccgt tggtgtcgtg acacatcgac    139200
     ggattcatcc tctttagagc aaactccttc ttgtctgtct tccgcctcac cctgtacaca    139260
     tttccaaagc tacccgagga tattctgcaa agtttctcgt atttctctat actgtcacat    139320
     ttacgtcccc ccttgagtag cattcctggg attgtctctc tcgttttatc attatcagaa    139380
     caaagaaaat aaccatggcg atttaatact tatttttaga ccatcttcat agtttgatga    139440
     ccgagattcg tggcctaggc cccctatttc tcaggtctgt ggctccttca tcatcacctc    139500
     cactactcga gacatcttca tagcttgctt cgctctccga cggatatacc agagtggctc    139560
     tctcccttgt gcttccatct gaaagatgaa gagtggtggt atgactaagc cctttttcat    139620
     tccctccctg aagcccactg cttaaggcct ttgcttctgg cttgagaggt tttgaagtcc    139680
     tctcggttga tacgctagct tccctactga tgggaccttc cagctttcta tcaacaatcg    139740
     gacttgatga tgtcttggtc tcctccccat ctttttttgc atatactatg tcttctttct    139800
     tctccttact gctcaaaggg gatcgagaca cggagccttg gctgctccca agatcaagct    139860
     gcccattgcc attcttcatc gagttactct ccttcaaggc tttacttttg tcctgtgctt    139920
     gcttaccatc ttcaatcagt acctctgaag tcgatggctt gagaacggtg ctaaagcttt    139980
     cgttaaggaa ttctccaatg agtttctcaa ggctctctcc actcgaaaca acattttcaa    140040
     ctgtattgct tgagctgcta cttgcaggaa gcccagatac tccaaagcct ctagaagagg    140100
     gtgtgctgga agattcaggc ttcctttcga tctcagcgga cgagctgggt ttgccggaaa    140160
     tagaaatccc gtgaatctct accccagttg cctttccatg aagatcaaga tcccccgaat    140220
     actttgagcc ctgggaattt atgacgctgc ttactcccaa gctcttttca ggcaattcca    140280
     catcactaat gtccccaatc tgggtctttt ctccaagata gtatggcttg ttaaatagag    140340
     acttggaact tagtggggtc ctttcggaat aacgatatga gtacttgggg acatggtatg    140400
     tgctttcgct cttattaaac tcatcttttt ccaagctaga cctgttggag gacttgagct    140460
     ccccaacaat ctcaatcact ctgtccagct tcttgtttac catatctatc ttttgtttca    140520
     ggacatccat cctgtcgacg gtcttccttt cggcgaactt cccgccgttg tcttcttccc    140580
     aaacagaggc attcttcccc tttcgacaag acccatagac ttaagagagt ttctctttgg    140640
     tcccatgaga tctatcgcga gtaggaccat aactattccg gttgtgatgc atcccatcag    140700
     aaaaactgtt ctttggcctt tcatcagatg ttgtaaataa ctcagctcgt tttatacctg    140760
     acttcgagac actgtttcat atctcccttt cccgccatcc caagcttgtt tcagactgga    140820
     tcgaaagagt agatgaaagc actccccatg aaggtatgtg taattggtgg aggacctgca    140880
     ggactgtaca ctgcagcttc cttactatcg agagacgtca atgtaacact atacgagaag    140940
     gaaccagagc taggggggct gtacagatac tccttgctcc ctgagtcgag aatgtctcca    141000
     tttacgaaac tactggagca caagaacttt tctttgaaat tgaattccaa aattgatctt    141060
     gagaagctaa gtggtatgga aaaggaattt gatgctttcg ttattgctac aggacctgga    141120
     gggccaagaa agctggcaat tcctggagca gaccattgca tcggcagtct tgacatagca    141180
     aaatcgtggg caggagaaga gccaaaatac acagtaggaa gcaaggttct gattgttggg    141240
     atgggagacg tctctatgga cattacaaaa tatctttttg gatgggccgg gcctcagttc    141300
     aagtttccga aaaatgctct tgaaagagta aaagaagtta gagatgtaac catcacatct    141360
     agaagaaatg tcttggaaag ttcattctcc aaccatgggc tgagaagcgt acttgaaatt    141420
     ccaaggctag gattcagctg gtcctcgcca aaagacatat cttgcccgga caaagacaag    141480
     accaaagacc ttgagcagaa attcacttat ctgcagaaag atgatgggaa aaaagacaat    141540
     attaataagt ggaaggagag aagactaagg ctgttccaag gagtcagaga gggggccaaa    141600
     agactcaggc tgatgttcaa cactaacata aagtcaatag aaagagttgg aaggcaatac    141660
     aaggtgaaga tggagcaggg tggaattccc atcgaggaat acttcgacac agtgatatct    141720
     agtgtgggct tcagcagggc agatcccaga agtttaggat ttacaaagcc tgtgtattat    141780
     gttggatggg caaagcatcc aaaggggaat gccgaaagag caaaagagga tgcccaagat    141840
     gttgtaaaca aaatagttga aatgaagaaa atgtagatag gccttcaagg cattatgaaa    141900
     agagaagttc ctgtgtctac tatgtcatat ctgatctgcg gcattgttga atacctactg    141960
     gagcaaaaaa aagatgtaga agcaagtctc aagaccatag gatacgaaat cggcataaag    142020
     cttcttgagg tatgtaactt tgaaagagaa gtacatattc caacacttct ttacagaatt    142080
     gcatttgact ttctctcctt ggttggagac agtgacaaga ggattgacaa gtctgaagac    142140
     tccgacaaga cctacttcct cacagatgcc gatggagtcc tctcaaggtt catgtctgtg    142200
     cctaccgaat gggatgggtt ttccgcagat tcggttgtgt gtggaatgat agaggccgtt    142260
     ctgatggcat ctggataccg ctccgaggtc acggcatttc caaaaccttc ggaaagtctc    142320
     tccaacagag ttatcttcca gatcaacatt ctcgatccat agcatcccca tgcttccttc    142380
     aactaaatct agattatatc ttatatttta tttacatttt acttggattg acctcggaaa    142440
     ccacaaacct tttcatctga ctcaccaaac tcgtagatac atcaacatca caagattcaa    142500
     agtccctttc gtcgttggag caatctccag acgactcgga tctgtcaaga atctttgtgc    142560
     tgtattgcct cactctcctt cgtctcttaa actcctcttt ggacaggaat tcgtggtcaa    142620
     gcatccattt tcctcccttt ccccgtgtcc ctggatcccg aggaaccttc ttgaaacact    142680
     tgtttagaga caggttgtgc cgtatggagt tcttccacac cggatttgca tatcgatagt    142740
     attcaaacga atcctcaatc cacttgtaaa tctcgctaag cgtgagcttt ccagtcttgc    142800
     tcgtccttat ggctctcgtt attatctgtg catacgagag agagggcttt gctcttagga    142860
     catcgcaacc accgaattct cttgtctttt cttcttccac attctcgtcc atctccttca    142920
     tttccaggaa gttaccgtaa agacttcgag gatttatcct tgcatcgggg cttgaaggcc    142980
     tcattctatt ctccataaat ctcatgtaga acctgtggat agcactttct ccctcaacct    143040
     cctgttccag gaactcccat agagaggact ctgcttttcc tccttcttcc atacacaagt    143100
     cttttacatc ctggtccata tccgactcca gaagctctgt gtccaaaaga tcctggaagg    143160
     tcgtgctcca gctcatatct taggatcaac tagcaaatat ataagccatt ttgtacttat    143220
     taaaattggc ataatagtcc atatttggta caacatctat ctttttgata aatttttaag    143280
     gctttcatta atatcaattg tgttgattgg cctgagaaaa agtttaatgg ttattaataa    143340
     ctaatcgagg ctatttacca ttgaaggcca tgatctcgaa gatcatccgg cacagggttt    143400
     cttttcctcc attcttgaaa atccaaagag atatttccaa agaataagcc atacaactgt    143460
     tattcccaga accatagcca aagacaccag gaatcgtttg agccaagggc ccctgaagag    143520
     agattggaac tttttcttaa ggcttttttc ttccttagtc ttatcatcgg acaactgaag    143580
     cctcacagag ggagtaagcc ttctgtccag aagaagaata cttataatac taataatgag    143640
     aaaagaaata aataacatta cgagcatggg gaagatagat ccgatattct ccttctcctt    143700
     cttctccttt acactttcta ctagtaaatt acaaaattta tctattcgag acctaaaggg    143760
     cttctgaaca taaaagatag tttcataaaa aagttcaagg aaagaagaaa tcgattgggg    143820
     taaaaaaccc aaaatttcct ttggtagtag caggtttttt atgaccttgg gaattcctag    143880
     agttacgagt attgggacaa ccaaattagc tacaaaagat aaaatctttc caagacctgt    143940
     agagggttca gccacagaga caatcatcat gcgaggaaga caggaagaga aaaacattaa    144000
     tattaggttg gtgaaaaaga aaggaaggtt tcttgtttct atagtcccga agcaatagag    144060
     agttcctaat cctaaagtgc atctaatgac aatcatcaaa aactcaaaaa ttaccgacga    144120
     aagccagaag gttgcagtat tgtacaatcc tttactgatt tcttctctgg tataatgaag    144180
     acttttctct agtattgcat ttgaaaaagg tatcaagcta aggagaaaaa ctaggtcacg    144240
     gatgcaagct acttgacgcc ctgtcttagt attaacttct gcaaagaaga ttgcgataga    144300
     taatcctagg actatggcca agctaagtaa aatctcccgt gatcgaaccc cgcttaaaat    144360
     caactgtctc ttgatcaaga ggatggccga tgaaaggctg gggacaaggg aaattctagt    144420
     atcttcttcc accttgagtt ttatctcctt aacttttctt cttttttcct tttcttcctt    144480
     catctccctc aacatattat tgatctgagt ctcgtactgt tgtgactctt tacttccttt    144540
     tgtgaagagg ctgaacagaa attccatgtt agtttttgat aaacctgaat tgtagattcc    144600
     cttggtattc agaaaatcaa tgaacttatc gggcggacca gcatatacct ttgcccctct    144660
     gttcaaaaac aggagactat caaaaagatt gaagagctcg ggccctggct gatgaaccgt    144720
     caatatcact attgcgccac tccttcgagc atattccttg acaaacctta ccacctttac    144780
     tgccagccct gagtcaagct cacttgtggg ctcatcaaga agcactactc tcaatttccc    144840
     ctccagtaaa agcatcttaa tcaaagcagt agctatgttt gttctcttac gctctcctcc    144900
     agacaacata ttcatcttgt gatggcgtac atcattcaaa ttgagaacat ccttaagaac    144960
     tatatctatg acctcgttaa tgcgttcctt gtcttcgtta gggaaagaaa acagaactgt    145020
     atagtaaatg aactcgtcaa gagttagatc ttcaattgag tatccagact gcctcccaca    145080
     tgaatgctcg ctgtgccatt tgtagtagtc tctttcctcg ttgtctatta gtatctgccc    145140
     gcttgtcatg gattcttctg gaaatagacc tgatatacct tccattattg ttgtctttcc    145200
     acttccacta gttcccataa aagcatatat ctcttcagat ctaaactcca catcgacatc    145260
     tttaatcatt atatcaaacc tttcattata ggacatgtct tggccaggag ccacgagaac    145320
     aacatccttg agttgaagat gatgattttt cattgtaggg cttctcatac actgctttat    145380
     aaacggaatt atcaaaattt tactaaatat gggtaataga agattatcaa aaatttttct    145440
     tctaaaatct atgtattata gtattgcgga ccccaagcaa atacgaatta aaatcccaag    145500
     acaagaagaa cccatgaata agcttccatc aaggttccat gttaccctca aagtccttga    145560
     gaattccggc aacgaaattt ccaaagacac ctatgagaag gacttgaaga gtatatgcac    145620
     cctggagtcc caagaacatg tttcctatct gttgcatcac ttgaaagact tcgataaaat    145680
     agacaagcaa ttttatatca acgtatttaa agagggaatc agccctgttt gggaagacga    145740
     gaacaatatg aatggatgtg actggagtct tatgcttaag aaagaggtgt gccagagata    145800
     ctttgagaga cttcttgtaa atctatgtac aggctacttc aagacgtttg agcccaccgg    145860
     aattgtaggg atacacaagg acaacagatt caagcttagc atatggtcga agaacattcc    145920
     atcgacagca gattgcgggg caataatcaa cgagctgaag gctgcactgg agatagattt    145980
     tgtaattaca ttccactaca aaaaccattc gaagatactg gcatatcaca aatctcttga    146040
     tgcatgatag gaatttcctg gaaaagaccg gcagcagtat cgggtgatca aataaagaat    146100
     atatcctccc aagattttga gcctctgaga aagcaataga gggtaattca acccaaagaa    146160
     cacggtttat tgctatatgt cgtccaactc aaagaagtta cctcttctcc tgaaattaac    146220
     actaggcttg gagttttttt cttcgatctt ttttgcaatc tcgatgtact cgctgtagga    146280
     gataggcctt cttacggaat agaagtgctg tgcaagtgca ctttgcagca tctctccctt    146340
     ttccttattt atgtgcttca gcgtagaaag ggcctccagt gacctctcgt ccaacaccct    146400
     acgtatcaac tcgtccgact ggtccatggg tcccgtgtgg aattcattaa actacatctg    146460
     gtttactcta cagtttatta taaccatgat tttcaagaga ctttagaaac acacggcaaa    146520
     aatcaaaaga ggagatctca tcataacaag ctgcaagggc ctttggtgca cctggtgctt    146580
     tcatcctgat ccagagaatc gtcaggatct cctcaagatg catttttctt tctatcataa    146640
     acttgatact ttcaatcact gtagacgaaa tggcatccat ctcgttaagg ttgtctatta    146700
     gatataccca gagattcttt cctattccaa gatccgtcac ctttacggac gtcctgtttt    146760
     gaagagcagt tcgtaatctg aaaaacggat tctggccctc tacaggcaca atccggtctc    146820
     ggaattgatt gatgaagttc tttacgtggg ggtattcctg gggacagcag taggccaaat    146880
     atgaggaata catcttgaca tatccagaac ttctcttgaa gaactgcatg atctgtgtta    146940
     taggatacat gagctttgag ctgtaagatc cacactttag ggcttccatt gcaagaataa    147000
     ctccttcttc agaatcaaag catctcaaga caaatctatg tcctaggatt tctaggaagc    147060
     aggatgtaaa tcccggaacc tgggacggag atagaacctc tagcacagag tagaccaaag    147120
     acctgtttgt gggcgtgtcc tccatgatat ccagcgtctt gacaatgaat cttgtgtaaa    147180
     gcttgaaaaa tagataattc ctctttctat atgcctccag aaacacaaac aagctttcct    147240
     tgatcgactc atagagcttc tccttgatga gtcctggaag aggatctatt ttcaaataac    147300
     aatatgaagt agggattctg tggtatctta taaagtggtc ccaagacacc ttgaatgcag    147360
     atcgtatgtc cacagatcca ggatagttgg ccctttccat aaattcagga agaaacatct    147420
     cgggaacagt tgtaaacttg cagctacgga catactcgtc gtaatcagat gccccctttg    147480
     cttcgatgtg catcattaaa ttgctaatct tctggaaaaa atcaaagacc cgagggttgt    147540
     cgccatgtcc tgcaagcatc tcaagtgtgc agataaagtc gtagaccgta cagatctgca    147600
     cttctgcagt tataagagat gtcaggagcg agatcacaaa gtcaagattc ccatctgcaa    147660
     gcggagtctt cgaaagggcc tggtcgtatt ccacaacatt gattagattg tgctctataa    147720
     acttactcac aagactgaca ctgaacttcc gtgggtcgtt ggaataaata agccagccca    147780
     gaacttcctt ctgagtcttg aatgatatct taaatatctt ctccatacat tcaaacagga    147840
     agtcctcctt gctcccgctc ttgataagat gtcctgtgat gtacctgcac aaccggatac    147900
     attcctcgtc cttatcctca ctgctctcca cgctctccag tattctccta aatacttctt    147960
     ctctcccctc gttcaaaagc ccatgccatt cgtcggctat gatgttcttc ttcgaatatg    148020
     gaatcttctt gcttagttgt acaagatgcg cctttatctc ctgatactct ccgttgtcaa    148080
     ttgccttgat tactatcttt tcaatgtgtc caggatcttc aagaagagaa aggtgcattc    148140
     ccttcggctc tccattggaa tactctagat tgttgtagca agtactgatc aactcactaa    148200
     ccttcgaagc ccccgacttc tggataagat cgcagcacac ctcttgattc tcctgggcta    148260
     ttttaaacac tctttcggtg gaaaagtcta gagagcaaag cttcatgaag tatgagacgt    148320
     ttccagaaat gcatgccctg atcggctcct gtgcagaaac tagacatagg aacttcgtaa    148380
     gattcactac catatttcta aacaggatat attccatccc cttctcaacc gccatcgtcc    148440
     tgaaaagttc cattcccgtt tggattgcaa cagaacatgc cttctccaca attggcccac    148500
     atatttcacg aacacttaga tccagggcaa gtgatatcac atgtctaacc acaaggtctc    148560
     tatcctcaat aacatactct gccagatact tcttagactt cagccctaag ttcttgaact    148620
     ctctggggac aaggtcaaca gaaaagtggt tgaacaaccc ttggatctca tcccttacag    148680
     gctttggagt acagctatat atctccgaca gaagattcaa gatgctcatc atccacgggt    148740
     tatttggaat aaatatgatt ccactctttc cctgctttag aaagctcgtt atgaagctca    148800
     ctccaaaccg aatcctcctg cactccacag acttcacaac aaacttcttg aagtcaaact    148860
     gctcagaagt tacaattcgg ttcttggcaa gcatcactcc tccaaggaca tatcccaagc    148920
     ccttggcaat tcctatctca ttttcactcc ggtagtccaa gaacatttta agaaactcaa    148980
     aagaccttcg aacaaaccgc aaatagaact cctttcccaa cccttctaca atagctacaa    149040
     gccttcttcc attctccacc tcaatgttct gaataatgta cagtaccacc tcttccctat    149100
     ctagaatccc tttttcaaga aattctccaa gcctttcaat tcctccttca gcctcaatct    149160
     caagagactt gatcatctcc tcagtccttt cgttcttgga gccacactta aatattaatt    149220
     tcactatatc ctcttcatca agcaatggat gggaggtgga atctactaga atcagctctt    149280
     tcttgacaag gatgctatta acactttcta tttcttctat ctctgcaaga atggttgggc    149340
     acgatgggag gaatacctcg aggcatcgga atccaaacga gtactctctg tcattctcgg    149400
     gatatttcaa ggatcccttt atatattcaa tagccattct gcggtatggc tttggaaaca    149460
     ctccttcctt gatcaaccct ccatacagca gtgcaataag gtctgagttt gggagcttgt    149520
     aaagagatcc atagttctca agtagtgccg aaaatatccg agatgccagc accttgctca    149580
     atgcattccc ttttagaaac tccttgattt gattaatgct gctttcgatt cctctctgcg    149640
     aattgattat ctgcgaaatg aaattgcttg cttcctcctc aattctgacc tccttgctcc    149700
     tttgtgtacg gagtccatgg ggaattctag atttgaattc attatacatc ccaacagtct    149760
     caggcttcag tatccttaca tactgctcta cagcctttgt aaaaaccccc ataatctcaa    149820
     cattcagagg aaacatcttc tcgggctcat tggatttcga aatcttagaa tccaaataca    149880
     gcactaatga cctgacaaat tcatcctttc gtgtcgtcag gttgtttgac agccatatcc    149940
     caaggttcaa gtggtccctg atcgaactca gcacaataat gtcgaaacag agctccggcg    150000
     gattcaggag ttcggaaaca agaggaagca tcttgtgctc taggaacatg tcaagaattc    150060
     gagacacagg tatcccctct cggataagaa ccaacgactt ctggagcatc atctcgggat    150120
     ggttcttaaa taatacatgc aaaataaagc tgtttggtgc tccacgggca aagccgctta    150180
     gaagatcctc gaaaatccgt ccaaacttcg gctgtacaaa gccaagtcct gctgcacacc    150240
     actcaggaga cttccgggca atcagctcaa ctaatggaat ggacccaagc atcccaatgc    150300
     attggaaaag ttccacacag ttgaagttgc tttcatatcc catcacattc ttgaaccgat    150360
     ggcttcgtga atcttcaata ctgatgatcc tgctgaaaaa tacatttgaa tacagctggg    150420
     tcctcttctc gtcgctctca ataatcagcc tcagaaagta catctgtgct cgttcatttt    150480
     tccatctctt gaaaaatatc tcatatggaa cagtgatgat tccactgatg tgaacccagc    150540
     aatcgacaat cacatacaga gactctagag tccatatgct gaagttcacg tccagaaaac    150600
     atgaatacac atctctccag ttgatctcct caagattgct tttcatcgac ccaacgatcg    150660
     cagggagatt ccattcccta tctggaaagt ctgccataaa tagaattgct cttgccacct    150720
     cttgcggcgt aacctcacgt cttctcttta tcttctctag cacatcgtcc ataaaacccc    150780
     ggtccacctc ctttggatca ctcttctcaa gtatatcttt tatctcatgc ttgtatcctt    150840
     tctcgtccat ctacagtgat ccctttattt tcaaggtgta aaatttgtct ttttattcgc    150900
     cgcccaaatc aaacaacata caggaacaaa gaggctattg tttacatctt ttcccctaac    150960
     caaaacttac aaatccaagt ggatcccaag gcgggacaca agaaatacat aaaactcttg    151020
     aaataatcac gttttaatct cagcggtact tctgaagaac caacgtattt cttcttctcc    151080
     agcaggatcg gatggaccct cccttcgact tgttgaatcg gattcccttt ccaagtcctc    151140
     tgctcttccg agacgcagac gtaaggcccc tgcactctct gtgcttcatc gtgttcttgc    151200
     atatccagtt tatcttaatg tcatttctta tggcctggtg atgtcggtcg accattatca    151260
     cctcatagta cttgtaggct gcatcctgcc ccacccagta ggagttcagc accccaaggt    151320
     tcgagcactt cttccctgct accatctctg ctgtcgcctg cttccgaagc gatggcttga    151380
     tctggttgat tcctgcattc acgcattttc ctcgtgtgtt accgttatgg taattcctct    151440
     tcatattccc tttcttcacc cgtgcaatgt acagcacata tccttgcttt gctttgtatc    151500
     caagggttct ggccctttcc aaaaatgtcg gcttctcaac ccggaagcac tctcctctct    151560
     gcctatactc acacactcga atccttagca gatatctcat cacgtcagac tgcttgcgcc    151620
     tgtggatctc cctgaggtag ttgatagctc ccattctggg gttgcaaatt tttcattatt    151680
     tccatttaca taagaatccc atcgcctgct tcccaccaac ctcggagata tattctttcc    151740
     cttaccaaaa aaccctcatt gcctctttcc cccgtctcgg tatccttgcc tccttccctc    151800
     tccccgctct tcatatcttc cttggcttct ctcctctcta tctcctcgcc gtcttcctcc    151860
     atccttcctc ccgttccatc cttcccatcg tccttctcca gttcctctcc ttcctccttc    151920
     tcgctctcct ctgctacctc gtcttcctct tcctccatcc ccttctcctt ccttcttaat    151980
     ctcactgaac cctcttctca ctcctccata cttctcatcc gtccattctg ttcctccccg    152040
     tgcaaactca cttttccttc tctgcatatt acagtattcc ctccaagtcg tctcattgaa    152100
     cccataattg aagtagtccg tgatatctgc cccaggttta ttccaaggct tatctgtaaa    152160
     gctttctatg tcgtagtcca agatgttttg cccctcggcc tcttccttct gttcttcctt    152220
     tccagaagcc ttgtccacaa tcagctccaa gtcagacgat gtattctcgt cttcctggtc    152280
     cccaacaaag aactcttcat cgttctgcat ccaaagggct ccgaaaacat tcatttgagc    152340
     taccctccag atcaatcctt caaccgcaga tccaaactct ttatccacat cttcctcaca    152400
     accccaatga gcgatcgctt ctgcaaagag tgcaacaacc ttctctatcc aaaggaagac    152460
     gacaacactc tgtttcttgc atgtaagaac tgtgaacacg tccaggaggc aaaatcacat    152520
     cgcctttatg tgagaagctt taggcctaag tatgcttcaa tagagctgta cgcaagggat    152580
     cttgctcagg acccaacact tccttccgtg aaaatcaact gtagaagttg tggattcaac    152640
     agagggctgt acttccagac aagaggcagc gaagacgacg ttgcattgaa tatttattat    152700
     ctgtgctgta gatgccacca tttatggtca tgatgcttct ctgttaaaag tactccatca    152760
     caataaatct ttatgctctt ctccttcgct gtccgaacat aaatctagat atctattctt    152820
     tggccccgat acatctcttt catcagcttt tttctcaaca tacacgccat ctgagagata    152880
     tatttttttc atctcttttc ttcttgcttc tatatccata tcttcttcag gcctctccat    152940
     aaacggattg tatcttctag ccttctgttt ttgaggccga taagattcct gcgaatcccc    153000
     tttcttgagg cctgaacata gacggcactc atctccgcaa atatcattgt tttgcctcaa    153060
     tacctccatc aagtaggctc cctccttgcc ttcgcacata tcttcgatac tagccctgtg    153120
     tatcactagc tcttcgcata caggcctcat gtacaagggg gaattagaca aggtctttag    153180
     aaagtgcact tcgttaatgt ctgccggatc tccgtatgtg tcgcattctc ctccgcaata    153240
     tgtaaacttc tctattcgca gaaaaaactt cttgctttca aagctatatt cgtaatgaaa    153300
     cctgtcaact gtgatgtagc atccctggat atcttcaatt ccacaagcta tctctcttcg    153360
     gaacatctct atcgattcct ttgccaggac tccaccgata aaatgcctgg agtccgacac    153420
     acacacctca aacgacccgt ccttaagttc ccgcccaatc cttgtcaact gtccatggaa    153480
     cgacatttgt tgctcttcct tccaatgctc ggtgttgtaa acctgtttgt aaatagtttt    153540
     ttcgatccag aagtccctga gaaacaaaag catccctagg atatctttta attatcccaa    153600
     ttactcggaa tgcactaaaa acattttcat aaacaattta ttcgagtcat tggggcctta    153660
     cagaatagac atagtcggaa attcggactc cttccccctc ctcggagaca tggctgcatc    153720
     ttaccctgat ggggtcctcg gtctccctca tcagaagaat ctttgttaat gcatgcacaa    153780
     agttcgactg aataaatcgt ttcaacagcc gagccccgta tgtcgaggaa tatgcctttt    153840
     caatcacatc gtccttcact ctatccgaga tctcaaacga tatccccttc tcgtccagct    153900
     tcttcctcag ctgacccatc tgatactcaa gaatcttgta catgctttct ctatcaagat    153960
     tattgaagta tatcacattg tcaatgcgat tgacaagagg tggcccaaac cggttcagca    154020
     ccaatctttc aatttctttt ctgtcttcat ctctaagctc tggagacctc atcattattt    154080
     cttggcctag gttggaggtc ataatcagta cacagttcct gaagtccaca accgtccctt    154140
     ttccatccgt aacacgtccc tcgtccaaga gctggtatag cacattcaga actgtttggt    154200
     gtgccaagtc cacctcgtcc aataaaatca cgttgtaggg cttgttcttg atgggctctg    154260
     tgagagctcc tccttcattg tatcctacat atcctgcaga tgctccaatt agcttggtta    154320
     tactcatttc atttccatag tcgctcatat caagcacaag catgttcttc tcgtcgtcaa    154380
     acaactccat tgcaactgcc ttggcaagct ctgtctttcc aacccctgta ggcccaagaa    154440
     gaaggaaagc tccaatcggc ttatcctctc tgctcagtcc cactctggat tgcaagatag    154500
     aatctacaat cgaatccact gcatgcccct gcccaaatat ccgtctcttt attcgagagc    154560
     tcatctccat aagcctctca ttctctttaa tggttaacct cttcacagga attcctgtcc    154620
     atctgcttat gacctcggca atgttcacag gaagaattac ttctacactc tcgagtctct    154680
     tgagctcact ctcaatcaca ggaatcacat tcatcttaag gtcatatgca acatatgtgt    154740
     ctctctcagc ttgggctaac ctcagcttag tatcctccaa cctcttcttt agcttcttgg    154800
     cctcgatcac atgtcttttc tccttcagat atgcctcttc catcggctct atacttctct    154860
     ttacctcttc tatcttttca accacgttct ccagcctctt cattgtatgc tcgtcctttt    154920
     cccttgcaag atcaatttct aagcttgcct tttcaagctc caaagaccat gccttcgacc    154980
     ttgcattcag aatctcttgc ggctcgcttt ctagtgctat cactgcactg gcacatgccg    155040
     tgtccaccaa gtcaattgct acatcgggaa gtcttctgtt cgaaatgtat ttcttcgatg    155100
     agtttgctgc atacacaaga gcattgtcag ctatcttaac tccatgatat gcctccaatc    155160
     tttctctaag cccccgcagc atcgtaatcg agtcctcgat cgatggctca ttcacaacaa    155220
     cctgcacaaa tcttctctca aatgcaggat ccttttcaac atactttctg tactcatcat    155280
     gtgttgttgc cccaatgcat ttgatcgtcc cggctgcaag cccaggcttg agcatgtttg    155340
     ctgcatccat tgccccatca gtcttcccgg ctcccaacac aatgtggatc tcgtcaataa    155400
     acagaatcac ccctggcgtt gtttcagcct ccttgactag actcttcaat ctctcctcaa    155460
     aatctcctct gtgtgctgtt cctgcaacca tcgacccaac atccacattg tagatccttg    155520
     cattctggag agtgggtgcc tcgccgttcg ctatcagctg tgcgatccca ttcactatgg    155580
     ctgtctttcc aacccccggc tttccaacca gtattgcatt gctctttgtc tttttcgaca    155640
     ggatctcaat gacctgtctt atctcctcat ctcttccaat cacaggatca aaaacattct    155700
     gccgtgcttg ctcaaccata tcaacagcaa atttcgacat tgcatttgtc gcatcgtcgg    155760
     aatttcggga atcaaatctt ttgttcttcg tctgctcctc aactctcttc tttatgtctt    155820
     cggaattgat gagcagctcc ttgatacttt tgactgaaag aagctgaagc accaatgcat    155880
     ttacagagac atatccatct ccccccttct cggctgccgc tagaaccctt gcaagtgctt    155940
     ccccaacccg tggctccgta cagttgtact gctttgcaaa gcctcctatc ttttttataa    156000
     gtgcattttt aatgtcgttc ctctcagtag ggttcaacac actgtacaac acagatgtct    156060
     gatcgttcag tattaccttc aggagatgct cgggctcaac aacattgttg ctatttgcaa    156120
     ttgcctcctc cagacacccc cttaaagcgt tctgtgctcg ctccgtatac ctctttgcat    156180
     tcatacttca aatctccttc gtccttaaat acttttagat gtccaaagtc atgaggtttt    156240
     tccctcactt ttctggaaaa ttcttggtgg gtagcttcca gttccaaaac tacagggtaa    156300
     agaaaagaga gtatctacaa ctccaagact ttattttctc atttactgct tccttaagag    156360
     agtaggtgtc ataaatccca tcatacaccc cagaatggac agaagcacac ggtcctgatt    156420
     ctgggaccta gtggccatag ccataaacat agggatgaag ctgtatatga acaacgaggg    156480
     tattgagaag atagagagaa caaccattac cagggccaag gatgtatagg ccacaagagg    156540
     tgtttcgtcc acatatttct catagtcctc cttccgtatt ttacaacagg aatcactcat    156600
     tctagggtaa taaatctctt gccccaaatt ctgcatgctc tatctagttg gattcggatt    156660
     gcattcgtac aaggatataa ctctcagagg attggaggct gccaagagca gcacaagagt    156720
     gtatctggag aactacacat caatccatgg agaaccgttg gatgagtttg aagagcttat    156780
     agggaagaag gtattcctgg cagacagaga gatgatggag caaaccgaca aaatagttga    156840
     tgagtccctt gaagaggatg tcaccttgct tgtagtggga tcaccattgt tcgcaacaac    156900
     tcacacagac ataatcataa gggcgaagga aaagggaata agagtcgaag ttattcacaa    156960
     tgcctccata ataaacgtgt tggggtgctg tgggctttat tcctatacct ttggaaaggt    157020
     ggtgtccatc ccgtactttg caggaaaatg gaggccgaca agcttctacg acaatatagt    157080
     aaagaactat cagaacaatc ttcacacact atgtcttctg gacattaaag ctgacgagca    157140
     taggttcatg agcgttaatg aggcaattga ccagatctta gaagcagcca ccctcaccgg    157200
     ctcctcgctt atcaacgaag acacaagaat atttgcaatc tgcaggttcg gatctcctac    157260
     agaagaagtt gcttatgaaa gaatcgccga cttaaaactg aggtcttttg gagacccact    157320
     tcactccctg atcattcctg ccaagttgga cagagtcgag gaagaactgg ttggttctct    157380
     gtttgaataa atctgtctga atagaagcaa aagtacaacg atttattaga aaaatcatta    157440
     ttattacttg tcttggctta atgagctatt tgtcctgtga atcctgtggc tggaagctgt    157500
     ggggttcctg tggttggtac gttagcgcct gggaacgaat aggaaagccc attcattgta    157560
     tggtcgggtt gcccgggctg aacttgtctt gtaaatgtat tgcttgtggc cggagatgcc    157620
     ttaacttcag gcttcaacgg gttttgttgg ctgcttggta ccccggaccc cggaatctgg    157680
     ccagcccctg tgttacttgc cgttcccgtc ctccctggag tggaagatgc tcctgcttgg    157740
     actccagttg aattctttgt tggggttgga gttacggttg ggtttccttt gaacttgacc    157800
     tccccaagaa cttgtgtctt tctagggtcg tttggtacag atacagaaat ctcagttgtt    157860
     cctgtaggtg tcttcttggt ttcaatctgc tcaacgctct tcagattggg aacaatcatc    157920
     tgctctagta tctctccgcc aactgtgtta ggctggtggg tcaccgtcga tatgttgttg    157980
     aatatcatct cggtgatcga cccgacgttg gtcttgctgt caggtaaaat gttagttatc    158040
     tggctataga agtttgttcc tgtgatgtct ttacgagctt ctggagatgc ttcgttgtag    158100
     cttatcattt ccttaattgt agagtctgga agctgagaaa tcatgttgag gaacgtttct    158160
     gtagaaatgt tcatcccttt ggcatagctc tcagccttac ttatgatgtt gttcctgacc    158220
     tgagactcag tgctggtcga ggttgaaatg tgttcgctga tcaactcctt gttgtactcg    158280
     tcgactattg ctgccttctc tccatcaatc tttccgttga atacattctt cttggccacc    158340
     tcatttccgt tccctgactt ttgaatctcg gaaagcacat tacttatgaa agtctcctca    158400
     gatcctttca ccgagtcggt tactgccatg tccaatggaa cgtccgggga tttcttctta    158460
     agctcctcgc tgactgctcc aacagtcgaa gacccaacac tattaagact ctcgattgcc    158520
     tggtccatcg tcattatctc gggaactcca tatggagagg aaatctcaac aaacttgctt    158580
     ccatcagggt ttgtataaac ctctgttgtg atcccttcta ggttctttgc tttcttctct    158640
     tcctcaactc tggccttcat ctcagaagct gctgcaacct cgctttcgtg agccagcctt    158700
     ccattaatca tcggcctcat ttcctttaca aattcgttcc atggcgtctg tataagctct    158760
     ccatcctcaa tatccagctc agatgccgat ccaatgttta agctcttctt tccatcagtc    158820
     atcgtagatg gaggaacggg atcaagagga gatggaagag gtaggacaaa tccatccaca    158880
     tttgcctcgt agtatccaac acccttatcg agctcgggtc tctctcctgt gttgtactgg    158940
     tgttcaagta gcgaggtgtc cagtttctgg ttctccatca attcctttgt tccttcaggg    159000
     aagataacct tccctttgtt caccttcaat gcctttgctg cctcagagat atgcactgct    159060
     ccattctcca tctcaatgac attcaatcca ctctcaacag ctgtcccaac aaccttgttt    159120
     ctcacttgat tccttctgtt cttctgtctg ctctgtacaa tcacttcctc ttcagacttt    159180
     ggctcttcat tactgaatcc cttcagagga agttttactt ttccatcgga aatcccaatt    159240
     ctgctggtgg ttggaggaat aatttcctta acattgaggt tcgatgtaga agtctctttc    159300
     cttagtgcct caatgtttga ttggtgtgcc atctcctcct catacttctt gttcagctcc    159360
     tcaaggttcg atccaacaac attaagtccg gcatgtgctg tagccatgtg atcgacagcc    159420
     tcttggatcg agtcgttcat tcccatcggc cccagcatct tcatcacctc ctcctttcta    159480
     acctctcttt catggttcaa tgtctcctct gttatcttct ctgcctcttc ccgtgccttt    159540
     tcggcctgca ttatgtctcc agtgctctcg aaaacctttg taaatgcact ctttccctca    159600
     ttgttgatga tctcctgttc tgctgctttt gcaagatgct cctctgcctc ctttactgca    159660
     ttgttctcgt tggcttcctt ctgcactctt atagcctcgt tttgcatctc ttcgttccta    159720
     cgattcatct cctcaattgc cttttcggtg gaaaccttcg aaaggaagtt cagagcattt    159780
     gtctttcgcc ctctcggctt gagctgtgcc ttggcattct ccaggttctc atgtgccttt    159840
     gcaagatctt ctgcactcga aatcgccaca tctgtcagaa tcttctcctg aacaacaggg    159900
     ttcgacaacc cctcaacact tgctgcttcc ttcaatgccg ccgcctggct gagcttctga    159960
     agcgccctgt taataggctc ggttatatgg accttagaga ggtaatcgct tatgtctcgt    160020
     gcccgttcaa gtctcttctc gttaatctct tcctccttct tcttcagagc cttgggccga    160080
     agtccactag gtgtccttac tatttccctt gcgttcttct cctcaatcaa agacctatct    160140
     tctgcacttt gtgctgctgt ttgccctcct ccggcaattg ctgcagacct ggttgcatgc    160200
     tggtaattga gatctgctag gctcatggcc tttgcatatg caacctccgg agacagacca    160260
     cttgccaaag cttcattgta cttatcaatc aaaaatcctg cttgataggc ttcaaaccct    160320
     gctttttcct caggagatcc cttttcgata tatttctcat acacactctt cacaagcata    160380
     tccctgtctg cttcagaaac aacatcctta gaatttacta tcttagcaag ttgagcctga    160440
     ggaatataag aaggattcac tagtggctga gaaatcgtat ttgccctctt tttcctcagt    160500
     gcctttttgg cattggcatc tttaatctca tctgcaacac cctgtgcaac aggtacagaa    160560
     tgccccatta gaaccaacga ggaatatgca ttttcaggaa tttcatcatc tattggactt    160620
     tcgttatagg tcagagcgtt gatctctgcc tgctctttgt tggtccttcc agtggccact    160680
     ccacccgaga aatatgtttc ttcagggttg gaatagtccg gtggtgtctc cacagaaaca    160740
     agctccgact ccaacggtgc aacagtggcc ggccttgcac ttgggcttcc aagaatagaa    160800
     ctctccacat cctctgcaac atccggtgtt atggaaccgt cgttgtaaag catatcaaga    160860
     gcatcgaggt ttccgtgagc tgccatgttt gcaagatcct tttcttcatg ggacaggttc    160920
     tccggattgt ttccatgact gttgatcatg ttccgaagta tcttctcatg gtttttatta    160980
     tgaggcttga tgcttcctcc atatttccta tggcctccct tatgatgggt acgatgaaca    161040
     cgacgattgc tatcgtcatc gtggcggcta tgaaccttca tcttaatacg ggcgttgcgg    161100
     gtagatctat ttccatagtc catccccttt cctgtatttg cttctttgct gcgatggatg    161160
     gcatcagggc ttaccttggt ttcactccgc acctccatgt tgtagagaca aagtagaaac    161220
     agtagcatgc gttcgtgtca ttttcccact aggtatttaa atatttttcc taaaacgctt    161280
     tcccgacaat gtttcgaaaa ctagaggtca tgcccaatcg tctgagatag actcctcttc    161340
     tagcctgatt atttcctctc attggacatg gatgaaacgg actcaggcct cttgtgtagg    161400
     aggggaaatt gcttcaaata taaacatccc agcaaacaaa ttaaatttat tcaactctca    161460
     atcttcttga gacccacttc tttgaactct ccactactgt cgggcacaaa acacttgaat    161520
     cgggagtctc catatccaac actgagacta aatccagaaa agctccagga aaggctatag    161580
     catggctcat ccaggacaat cttctgcaat ttgtattctc cttcatttct agtgtagatc    161640
     attacagtgc cgtcttcaga acagcttgcc atgcaaaaca gcttgaagga attcggcggg    161700
     cagacagaaa catctcttac aaatccctta tgatccctaa accgtgcaac ctcttcgctt    161760
     ccttcccaca ctgccacaga gtaatccatt cctccactta caaacccgtt ttccgtagca    161820
     ctgacacatg aaaccccaaa ccggtggctg aagatctctg actctgttac gccaaaggag    161880
     gaatcaactg ctaggaccct tacatttcca tccgaacacc cacagaacaa ggtaaacgag    161940
     cctccgttcc atcttcccga aatgtcgttt accgatccat taagaagctg cttttcatac    162000
     ttcttgttga acttcccgtt ctcatacttc caaacaatga ccttcccgct gaagtaagat    162060
     gatgcaataa actcaccttg atttagaaaa atcgcttttg ttgccgggcc cgagtttcca    162120
     ttcagctcca tctccagagc caggttgtga ggagagtctg cagtgccctt cgaaaagaca    162180
     cgtacaattc catcggagca cgacgtaaca attttctttt ggctgaagtc agtctcgatg    162240
     ctatggatag tatccttgtg gatgtccatt ggggcttcta tatttgggaa aacaaataaa    162300
     agatattaca tgcgatgaaa cacaaggtag atgagacaag ataaatccga agatgggtat    162360
     ggataggagg atgagttgta gcggtgtggg aaaaccgatg attaagatac acctgggaat    162420
     tttaaaagaa cggaaaaatt ttcaccctac gaatggtaga ttttcatatc agcaaagttc    162480
     acgagcttat gacgaaccag aagaacatca ggaacatttc tgtgatagca catgtcgatc    162540
     acgggaaaag tacactgaca gattgtcttg tgatcaaggc aaagatagtt tcgaaggatt    162600
     ctggaggagg caggtacatg gactctcgtg aagacgagca gcaaagagga attactatta    162660
     agagttcggc aatatctctg catttccaga ttgaaaagga tgttttggaa gcatatacaa    162720
     agaaggaaga taccaacgga accgagtttt tgatcaatct aattgacagc ccagggcata    162780
     tggatttcag cagtgaggtt acagcagcac ttcgagtgac cgacggggct cttgttgttg    162840
     tggactgtgt tgatggaatt tgtgtgcaga cggaaacggt gcttgggcaa gccatgggag    162900
     agagaataat tccaactctt gtcctcaaca agctcgacag agctattctc gagttggagt    162960
     atccccaaga gaagcttgga gaggttctta ggagaagggt ggagggattc aatgccaagc    163020
     tcagcactct aggatacaac ttcaaggtgg agtctctgat gcccgagaag aatgatattt    163080
     cgttctgttc tggactacag ggatggggat ttaccctcag gcattttgca aggttctatc    163140
     ttgagaaatt caacatgagt ggatttgagg gagaaaagaa gctgacaaac ttcctgtggt    163200
     cccacaaggt gtcctgtaca tcagacgatc cgtttgatcc aaacatcaag cacattgcca    163260
     agcctaatcc tgcacgatct ccttttgttg tgtatgtgtt aaatccaatc tataaagtca    163320
     aggacttttg caacaacgga cagattgagg aaattaagga atacctgaaa ttctataagg    163380
     tagactttaa gggagttaca ctcactggaa gtggaaagtc tttgttcaag gaggttatga    163440
     aggcatggct tcctgcagca gactgcatct tggagcagat tgcgctcaaa cttccatctc    163500
     cgttacaaag ccagaagctt cgatatgact atctatacga aggcccaaag gatgacgagg    163560
     taggaactgc tatcatgaac tgtgatgcaa gcgaagaagc tccggttaca atgtatgtct    163620
     cgaagatgat ttcctcaaac gacaaccggt tcatagcatt tggaagggtg ttctctggga    163680
     agatatatcc aggaatgaag attagggtcc aagagccggg atatacaccg ttgccagagg    163740
     attctgaggg atcccctctg ctccacataa agtctgtctt gagaactgtt gttatgatgg    163800
     gaaggggata caaggacgtg cccaactgtc ctgccggaaa catcataggg attgtcgggg    163860
     ttgatgactg tctgaagaag actggaacca taacaaacag aaaggactcg tacaacatcc    163920
     gatcgatgaa gttttctgtg tccccagttg ttaaggtggc tgtctccacc aaaaggccag    163980
     aagatcttgg aaagctccag gaagggctca aaaagcttgc tcagtcagat cctctttgcc    164040
     tggtcgagag aaatgacaag ggccaaaaca ctatagcttg tgcaggatcc ctacatctcg    164100
     agatctgcct taaggatctc caagatcaat atgccaaggt acccatcatt tccgaagatc    164160
     cgttggtgac atacttcgag ggcatatcat cctcgattac agagcctaag atgacaaagt    164220
     ctgcaaacaa gcataacaga atttacatga ctgttgaacc actcgaggag aagatagttg    164280
     acaatctgaa tgacgtcaag tccgaccaga tcaagacaat gacaaccaac ttccgagaaa    164340
     tgcttgacat aagagatgac tggatcaaga agatatggtg ctatgcaccc gagatcaatc    164400
     ccttgaatct tcttgtggat ggaacaaagg gaatctctat catcaacgaa ataaaggaac    164460
     acgtcaacac aggattccgt gcagcagtca atgacggtcc attgattgga gaagtcatgc    164520
     gtggacttaa gtttgagctc aaagacgcag tcctccacgc cgatgcaatc cacagaggta    164580
     tcaaccagct gctccagcct gtgaagagtc tctgcaaagg actcctcctt gcagcaaccc    164640
     ccattctcta cgagccaata tatgaagtag agataacctc tccaaacgac ttctccggag    164700
     ctgccaccac tattcttctc tcgaagagag gaactgcaga ggacttcaag acacttcctg    164760
     gaaacgacac aacgatgatt accgggactc ttcctgtgag ggagtccttt acattcaatg    164820
     aggacttgaa gtctaggacc ggaggaaagg ccggagcatc catgaggttc tctcattaca    164880
     gcatcttgcc cggaagcctc gacgacccaa attccttgat gttcaagacc gtcgaaactg    164940
     ttaggaagct caagaaaatg aaccccgagc ctccaacagc agactccttc ttcgacaagc    165000
     tttaataaaa agttatggag ttatctagaa agttccgttt ttatttgggc cgacattctg    165060
     cccggagaaa caatctccag tgacggccta ttccttgttc ttgagctgct ccatgccctt    165120
     gaggaattca aactttgaat tggactctat agctcttaca ataaactcgg gagacatcct    165180
     cgaggagttc ttcttctttg cttccttgag ggtgagtcct accacttctg ccaaaaacat    165240
     ctcgatggcc ttgcttgcaa caacaggtac cgaggcccct atctttccta tgtcctcgtt    165300
     cagctgcatt atccttttca atcttgatat cgggaacttg gttagctttt tcttttggga    165360
     ctcctgcctg ggcattgttt accccttcca ctctctaggc tttaacaaag atcagatatg    165420
     gaagaatcct cctaccctcc atatcgagtt tattctcaag atttccaatc ccaaaatgga    165480
     cagggaagcc ttaagatgca gggtgcttac cactctttcc aagtcgtcgt tgttccgatt    165540
     cattgaaaac atcctagaag agggcaaggt gaattccatg gcagtcaata tcacagaata    165600
     tttattaaac aataagtaca gcagagaaag agctcagcaa catatatcag actacttgga    165660
     agacgagctc gagaggtcag ggatagacct agacgatagt gtcgacggtg tctccctggc    165720
     cattctattc gtatacgaag agctccttga aaataagtca gaattctttt tgaagattga    165780
     ggaaaaggct ggccatacca ttcctctttc cgactccgac gaatgactct ggcctagaac    165840
     ttaatactct tataaagctt ttcctttctg cttcttcttt tttctttcgc ttccacttcc    165900
     tccttagcaa cagctttttc ttcgggtgcc tcatcttttt cagccctact actttccaga    165960
     gtaactcttt cttccaactc ctcaatgtac accggcttag tgtactggtt ctcagtgtta    166020
     tagataacct ctacactctc ttgaagaatg ccgttttcag ctattccagc ctctgcctca    166080
     accaggggct ctccccaacc cctaggctgg tatccataca tacatccctc aggtattggt    166140
     gcattcagcc ctggaatcct tgcattcgga taggatggcg gcattccata cttctgcatt    166200
     ttgaaaagcc atggcggcgg agtggtgttg tcgattccca gagcttccat gagctcaacg    166260
     ctcatcgtac cagaggagct cttctttata aagtagtccg tccccggctt gaaaaattct    166320
     ccataactac tgagatgcgg tttttcctct atggaaaacg cctcatacag tatccgttgg    166380
     tcgaccaagg atttccccag ttttggatac aacttttccc ttaccctttc ccgaagactc    166440
     atccccgcct ccctttcctt catcattctt cttaactcag gaatccctgt cttcattaca    166500
     ttccagggaa tctgatatcc aggcttatgg tatccatgcg gaaacattct tccagagctt    166560
     gatctccaat tgctggggac cggaacacta ctctgtccct tcatcttatt gtgagctatt    166620
     ggatctgggc atgttacatc ctcaaactca aaaagctctg gatatggaac aacaagcttg    166680
     aggtcctcat atctgtgttg caatgccctt tttttcctct gccttttatt caagggattt    166740
     ctattgggtc ttatttcgtg aataaatcca tactcatcat tgatctctgc tctcatatgg    166800
     gcttttgatt ttattctgtc cattcatgct atgaggagat tcagattcat acagaagctc    166860
     agtagagggg tacatgggac agtgtatctt ctggaaacaa cagactccaa aagagaaaag    166920
     gtagtctgta agtcggttct atggaggtac aggaaacatg ccgagaacga agccaggata    166980
     ctttcctcaa tatcttacaa aagaatagta aagcttattg acttctttcc atccgatttc    167040
     ggcctattta ttgttcttga gtatatggat tgtggaagtt tggacgaaat gatgatttac    167100
     tttatggaaa gcaacttcag agccacggat cgcttggcat ggtctgtatt gacacaaatt    167160
     gcaggcggcc tgagatattt acactccaag aaaatcattc acagagatct gaaaccatca    167220
     aacattcttg caaacagagc tcgagcggaa ggaggcttga tgctcgagtt caaactttgt    167280
     gatttttctg tgtcgaagaa gctcggcaag gatgggcaga tatctggaat tgctgggacg    167340
     ccctcgtaca tggcacccga aatggtatct ggaaggcatt acactacctc tgtggacatt    167400
     tggagtctag gtgtttcaat atacgaatta ctagccctaa agaagccttt tgaggggaag    167460
     aatagaaacg aactctttga aatgattaaa caagcaaaac ttccacaaga aatgtgtaaa    167520
     gacatggact tggagagact tattcgaagg tgcctttcca aaaagaacag aatatctgcc    167580
     agagacattt gtaactacag aaagtcagac cttacctgta gatgcagaga taagtcaaga    167640
     gatgtttttc ggaatggaat ttcgtaagaa acaatggaca tcaatcattt tcaaggctaa    167700
     ttccgaattg catactgatg aagcgaagta ttttcttaca gaacaaataa ctagacaaga    167760
     aacatcatgc cggtttcaga tgagaaataa aaaaaacctg ccacaacttg aaaatgcata    167820
     atagaaagca tctatcacaa tgttcacata caacatgctc caacgatgca gatataaaaa    167880
     agatatcaaa ggtactcttc atcattctaa tgtttatgtt cctggagctg tggggacatt    167940
     ggaaaacaaa cagtttgtcc ctcctggcag attcgttgca tctgcttgtg gacatatttg    168000
     gatttatagt tagtcttctc tctctgagct gggcaaagag acctccaaat aagaaaatga    168060
     catttggata ccacaggata gaaatcattg gatccttggt ttccatcggg ctcatctggg    168120
     cagccgtggg gtatctcgca atcgagtcat tccacaagta ccttcatccc agcgagattg    168180
     atggagggat gttctttgca atagcagttg tcggtttctt tgtgaattgc atctgtattt    168240
     acgtcctcca ctatgacgaa taccagcaca agcttaagca taagaatcta aacatccgag    168300
     ctacctatgt ccatgtgatt ggagatctta ttcagtctgt aggggtaata atcgcaggga    168360
     tggtgacgta tttctatcct tcaaaagcaa tagtcgatgt ggtctgtacc ttgttttttt    168420
     ctgtgcttgt tttgacatcc acggggtttg tattccgaga tgccatccac atactggccg    168480
     agggaacacc tatggatctt gacatcgatg gaatgaagac agatgtgcta ggagtagaga    168540
     atgtatacaa aattgttgat ttatatgcat ggtccatatc catgaacaga aacgctgtat    168600
     ctattaagat actggcggat gatttgctga tcagcgacta tgaaagcatt ctgttggagg    168660
     tgaaccacat aatcacaacg aaatattttg tggacatagt catcatacaa atagatacgc    168720
     caaacacctt ctatggagaa aagggatttg ttgttgatgg agtagcgatt gacttggaag    168780
     ctcttgaaac cccagggatg atgattccgc aggcctagac ttctcatctt taaggcagat    168840
     ggagcccttt cagttagcaa ccagacttga ggaaatggat ttcaccccgg aaatggaagc    168900
     aaagagcatc aagaaaggcc tttacagaca gagagcacat gcaaatccgt tcaaagatag    168960
     caatattgtt attccccaaa gtcccgagtc gatagattgg tcttcttact ttgtagagaa    169020
     caaaagaccg gactttgttg atataggatg tggatatgga aaatttcttt tgaaagttgc    169080
     agagaagagc cctgagcata atgttcttgg actggaaatt agggataagg tgtatgaata    169140
     tgtcaaggca agaatcgagg ttctgagaat tccaaatgct ggggttatga gaacaaacgc    169200
     attgatcttt ctacctaata tatttagtag aggtcaactg tctaagatct ttattttgtt    169260
     tcccgaccct cactttaaga agagaaaaca gaaaggacgt gttgtgtgtc agcagatgat    169320
     ggagatgtac gagtacatac ttgcagatgg gggaaggctg tatgtatcta cagatgtgga    169380
     ggagttgttt gattacatgg tggaagttat tttggcacat gggagattca gaccactttc    169440
     caaagacgag gctagcaagg acccggtgtt ccctatgact tccaaggata cagatgaggc    169500
     tttaagagca ggagtcaaga caggaaaagt attttccgaa gttttcgaaa taaaaaagga    169560
     ttaactactc ctttcatttt ccattcagga gacagacagg acagtcgact ccttttgaaa    169620
     tactttctta gaagtaaccc caatgggaaa tgacaaggtg atagttgagt tgctctttgt    169680
     gctgtctctc ttgagccttt cattgacatt ttttccagaa ctgataaagg attcggtgga    169740
     tgaaatgggg tacttcaaag gaaacagggc ctccgagaat tttaatgttc tagggatacc    169800
     aaaagaaaac aagattgaat tctacacaat gtcagggagt aggagtaaca tcagtattac    169860
     ggactttcca aacggatctc ccattagcag ggccatgctc agcctctata aaagaaaaaa    169920
     aaggttcagc atatatattg atgaaaaggc aagaagcgta tcgatatact cggaatctgt    169980
     aattcccaag tacatcttta agatgaagga ggtgcccaaa agaagcctta cacctgcaga    170040
     aactatcaag ggattggatc gtttctatct tccgaatggt cctatggacc aaaaactgat    170100
     cgagacattg gtgtatctag aacttcgagg atgtctcgaa gataagctgt tcatccttta    170160
     cgaaaataca cttatcctca tcaatgagga gaagcagatg atcttctttg atatagacct    170220
     cgagcatcta tttgggatga tggttgagga agtggtttcc caaacagaaa gaaaagacgg    170280
     atcaaataga cttctgattg ctttcaaggt agaatcgaat attttcttct tgttcagtcc    170340
     tggagatgaa cagaagggat ttggaaggag gataactgga aatacacttt cagagggctc    170400
     cataaagctt ttcccttcgt caagggatgt ccagataaaa aatgcagtat ccaaagacga    170460
     ttatgtgggg atatccaaga taataagtga cgaagaaaga aaagaaggaa tagaagtgtt    170520
     gaagaagttg ataatagacc ctttcagatc ggaagatctt tcttttttta gatgataatg    170580
     gatcaagagt cctagcttac tggaatgcta tgaaaagatc ctttggaaaa taaggtacat    170640
     ttaattagat tggtgtcatt aattaacctt aatgaagccc aaaacctgat aaaaaagaga    170700
     ttccatcctt ggacattatt actatgaaac aaatcaattt gtttactttt ttcctagttg    170760
     gaatgcctgg aatacagtta ttagttgtaa acggggagga aactagtaag aatacaacca    170820
     catttccgat tcagaactca gaggcaattg aaataaaaag aacttttgcc gaaagaattg    170880
     caaaggcaca agagatcttc tccgatgggg acttcttaaa ctcatacatt gatcctgata    170940
     aggtgaagac atattacagg ggagtttatg aaacagtagt tgtcgatgtt ggaggaacac    171000
     atctgaagat aagtaaagtt ttcattgatt ctagcctgcc caaaagagaa ggcgctctgt    171060
     cctttgatgg tgcaatggaa tgtattccat ctttttacag gtatccagac acttctaatc    171120
     ttcagaacga agataaaata acctggaacg attgggttgc agagaggatg gttgagttct    171180
     atggccaaga ccttccaaaa aagaagatta atgcatcttt gacattttcg tatcctcttt    171240
     tccaaacatc gattagcaat gcaaaaatgg agagagctac aaagaacttc tgcttccgga    171300
     tcgatgacca cacatttgat gaggatgtgg ttgaggctct taacacttca ttgagaaaca    171360
     ggaatgtcaa tgttcatgtt agctgtgtca tcaatgactc tacagcaaca tatatggcag    171420
     gggcgcttcg gggatatgac aacataatcg ggattgttct ggggacggga accaactctt    171480
     ctttctgtgt gaagaagaac ggaacagaca gtgtgacact ctataactct gaatggggat    171540
     ctacaagtgt accaagaagt atgctaacag aagccgacct tgccgttatt acagacctgg    171600
     aaaccaaaaa gatttcgtat agcatcattg atgttttggt ggggggctgt aaactcaacg    171660
     acatgatcct aaacagtctt aaaactctac atccagagct gtatgaaaaa tatatagact    171720
     gtgaggagga attatcttta gccatcagtt tagctatcaa aagacagaat gaaggtatat    171780
     tgaaggaaga cgtcgatttg tcacaaacat tggcttccat aattaacgat tttaatgcca    171840
     gaggaatgaa gatactggca tccttggtaa gtgccgtaat tgaatcttgt atgaaagata    171900
     tgcagtatgt cacactgatt ctgaatggaa caaccttttc ctacgaagac cttcggaggg    171960
     ccctcaaaga aaatgtaaag gaaatacatc caaacatcga cataagactg gagttccttg    172020
     gaaacgcttc cctagaaggt gctgcatttg tgtctctcat gagttctgat aattctaatc    172080
     ctgaaagact atagcttttc aaggttatta aatccttggc ctttcattta ttgaccaagc    172140
     ctcttaagaa acttgcttct tccttatact tttccggatc tggagtctca agaattagtg    172200
     ggatgttatc aaaaatccta ctgttcataa tgaatctaaa tgctctttcc cctatcattc    172260
     cctttccaat tgattcatgt ctatctttct tcgatcctaa tgcctcttta ctatcgttga    172320
     tatgcatggc tttcaaaaaa cttagtccaa ctatcctatc aaaccgttcc attacctccg    172380
     tgaacttctc ttctgttgaa atatcaaatc cagctccaaa taagtggcag gtgtctaagc    172440
     atatgcctat tctctgttta tcttcaatgc ctcctatgat atccctgagc tcttcaaagg    172500
     aacttccaag aacatttcct tgccctgcca tgttctctat caacacagtg acaccctgaa    172560
     ccctcgagag tgctgtgttt atgtggctac taacccctct taggcactct cttctgtttt    172620
     ttcccttgtc actccctgga tgcatgttgt acatcttaat ccctaaagac ctacatcttt    172680
     ccatatcgtc aacaagacat tccatgctct tgtctatcag actgggattt ccaaagttta    172740
     taagatagga accatgagga actatcaatt ctggatgtaa aacatgtgcc tggaacatct    172800
     ctgcagcacc atccttcatg ggtggtgcaa gatacctcct ctggctcttc agaaatatgg    172860
     cacatgtgtc caacccgagc aattccattt gtgcctggat tgtatgaatc cccttgctta    172920
     tcgatagatg tgcaccaatt atctttgcca ttctgccaag gactagatcc ccactgaaat    172980
     gtttaaaaat aaatcaagcc attgccttga ctgcagatgc aggacttttt gaaggactca    173040
     aagagaatcc taaacgacat agagacactg aactcatata caaatagtat tgactaccta    173100
     agttcacaga agaacagttc ggttctaagt aaagaggagg agaaggggct taataaccaa    173160
     atcgatgtgt tgaacggacg gtttcgagta ctttcaagaa agatcaagga aagaatagat    173220
     aagttctcct ctgaaacagt agagcttgag aagcacaatc agaaggataa gttctaccat    173280
     gaaacaagga agattcatct gcatgcccaa tcgaagaaac ttaccgaggc cataaataga    173340
     tacagagagt cacagatcaa gcatcgagag gatgaagtgg acaaattccg tctccagtac    173400
     atcattgcaa agccagatgc aacagagaag gaaatagagg atttcatcgg agatgacgat    173460
     gggacaaagg tggcctctgc atatgcatta ggggcacatt cggcacaagg aattctcgag    173520
     gaggctgaga ataggaaaaa aaacatcaag aaaatagaag agatggtcca ggagatcgta    173580
     gacttgttaa atctgatcag ccaggaagtc tccaaacgca cggaggtggt tgaggccata    173640
     aacgatgatc tcattgctgg agaggaaaac actgcagcag caaatgcgga ccttgagtct    173700
     gctttggaat accagataag agcaactaga atcaaaagaa tatttgtgta tggaatcctt    173760
     attattgcac ttatattctt gatatacttt gttttcagaa ctaacttttt cggagctttt    173820
     gacagagtcc gttattacta gcttaggagt atctcatccc cttttcctgc agaataatag    173880
     agatgttaaa taaactattc catttatctc ccaaggtgcc gatgttaggg ttgagctcca    173940
     acaaggttgt gaaaaaggaa aacatcatat gtatatattt gaaccaaccg aaagacttta    174000
     tatatgacat agatgacata gtgatagaat ataacgaagt taaaaaagat gtggaagtag    174060
     ttaacgactc aataccggcg ttcataaagg ccaacatgaa aggattcttt agaggagatc    174120
     tagaagagta tacgcgattt ctggaggaaa acttggagat cttctttaaa ggagaggttc    174180
     ccaagacaaa agagccagag aaaaaggagg aggtgataag gccgtttgag cttccgtccg    174240
     actacaagtt tcccattggc aggaaaggac cgatgaacat aaacatagag gtggaaaaga    174300
     gatatgtttc cattgtttct tgcgaatgtc ttaacttaca agtaggatgt aacagatgtg    174360
     gaagagtcct aaggatgcca ggggctggag aatgcccagg gtgtagatct gtgcttgaga    174420
     taaggtacat tccctctgtt gactccgagt ttcttgggtc cttaagcttc catgggtgta    174480
     ggtttatctg cttcaacccc tccagatacc agctttcttg cgatggttgc catatgaact    174540
     acgaaacaaa cgaactaagt ataggtgatg cttttcgcat caaatgctat gaatgccttt    174600
     caaatatctt tctgaagata tctagcataa acctcataca aagaaagaga gaaacactaa    174660
     agccaggaca gcccttgcct gagaaaggta cttgcaggca ttacaagaaa tcctacagat    174720
     ggtttaggtt tccatgctgc aattctcttt atccctgcga tatatgccat gacgaagaga    174780
     gtggacatgt acatcagatg gctaacaaaa tggtttgcgg actctgttca aaagaacagg    174840
     gtgtaggcaa ggagtgttct tgtggaatga atttaaagaa gtcaacgtcg ttttgggaag    174900
     ggggaaaagg aacacgaaac aaggcaacaa tgagcaggaa agataggaag aaatacacaa    174960
     agtaagacgg aataatatta atgttctttt aagagaagaa gtactggttg ttttcctttt    175020
     gcattctatc ctttgcagac cctggcttgt tgatacgggg ccttagatta cttggatccc    175080
     ttcggaaggt cacatccaag ttcttaagga agatattcat gcctgtcaga aggtccattg    175140
     gggccgaggc cacacttgaa accccgggct ctccctcaaa cacaatcacc ttgtctgcaa    175200
     gatatgtccc aactataagg tcatgctcga caataaatgc tatcttgcca tttgaatata    175260
     taaacttctt tatgatcttc gatattgcta ttctctgatc ggaatcgaga aatgccgacg    175320
     gttcatcaat aaggtatatg tttgcgtctt tcccaagaca tatggctatt gcaatccttt    175380
     ggagctctcc tccactcaag ttctgaaccc gctgatcata ggtatactcg attccaagtg    175440
     gctttataac ctcatttaca aacgattggt caagaaacga cgatctgatc tttgacataa    175500
     agagctctct gacagtgccc ttgtacttgg gaagtatctt ttggggcttc aagctatagc    175560
     ttagcttagt aaactcctct tctccgtctg gctttatgag accggcaatt aggccgacaa    175620
     gagtagtctt tcccattccg ttttccccta gaaacacaat gatctcggaa tcgctgaagc    175680
     tcccttcctt cacctccagt ttaaatgatc catgggtctt tgtcatgcct ccataccagt    175740
     actgggccct tttctccatg tccttagtag gtctttcaga aatgtcaaac ttgagctcag    175800
     aaggtctaaa cctcatgttt tccgtcggga tgtagccatc gagaaagatg ttgattgcag    175860
     actttatggc atatggcgca gtaatcaccc cgtaagcacc agactgccca tatagtacac    175920
     atccaaagtc actcatcaaa tccagtattg caagatcatg ctcgacaaca atcacatagc    175980
     tattgtcttc gcaaaggtct ctaatctcct ttgcagcaga aagcctctgc ttgacatcaa    176040
     gataactcga aggctcatca aatatatata catcgctctc ttgcatgcat gctaatgcta    176100
     aggagaatct ctgcaactct cctccactta gctcttcaac atccctatcg agtatatttc    176160
     caagatacat tttctctatg taatagctct tcttccctct tcggtccatc tcttcaagta    176220
     catctttgac aagtagcttg tcacttaatg tttctctgct ttcgtccaac gataggctct    176280
     ccagcgaact cttcaacttg gcgttaaatt tcttcttcaa caactttgga agcctatcaa    176340
     tgtactgtat cttagatgtt atcttcaggt gtccttcaag gatcttggta aaatatcctt    176400
     ggagctcaga tcccctgaaa taccccagga tgtcctccca cccaggggga tcatcatact    176460
     tcccaagatt aggctttatt tctccagaaa gaatctttag tgccgtactc tttccaattc    176520
     cgtttgtccc tactagccca agtaccttcc caggccttgg gattggaagc ctgtgcagct    176580
     tgaatccatt cattccgtat ctgtgcgtta tctccttatt cagatttgtt ggaagattga    176640
     tgatggaaat ggccttgaag gggcatttct tctggcatgc agaacaccca atgcataggt    176700
     tttccattat tatagacttc ttctctatct ttatgcattc ctttcccgtc ttgttcacag    176760
     ggcatgcctt cctgcactca gacgcacatt gggatggctt acaaagctcg aagttaacaa    176820
     cagctagtct tgtaggattt gtcttttcct ctcctcttcc catctgatag gggattcaac    176880
     cattttgact tcaaatccga aagaccacaa agattttgtc ctaaagtatt atttattacc    176940
     aaaaagatat actttatata tgcaggtgta cttcttgttt cctccgttgc ttcgaacaac    177000
     aatctcaaca gaactgattg gtgtttcctc ccattcaaag gtctggaacc cacatgtgct    177060
     tgtgtcatat tcaaacctcc ccagaagtag atttccctca gggctattag aaaaaacctc    177120
     gaactcacga attgcactac ttgtatcctt tgtaacaggg tggtagagcc caatcttgct    177180
     gatagcagct tccttctcaa gatcgatgga aaacttacat ccagcccctt tgaatgctag    177240
     acattctcca ataccaacat tctcatcaaa tatagttgat ggttccttgt gctttctaaa    177300
     gcccagaaat ccatacgaaa acagctgaga catgctttca attcttattc ttgccccttc    177360
     ttcgatcttc gcataattca cttcctttat atgcttcatc atttcaatct ggctacttat    177420
     cctagagttt tcctccctca gtatatttat ttcctccatc agatttgtca aaatcatcga    177480
     gtccattggc ctctttatgg ccatgtagaa aaacagaaca tatggaatgg caatggccat    177540
     gtaaatggga tagtctttta tacccttcct ttcctgacca tatccatttc cctccatcgg    177600
     ctctacactc ttgttagccc tcgcctttgg agccgccgct tgaagtatga ttgtttcatc    177660
     catccccaag ttcaatgtcg agtcgggggt tctcttcact tgaaggcggt ctcttctatt    177720
     catgtaccca tgggaagacg aaaatttaaa actcttggaa cacaatcaac tttaatgtat    177780
     tttcctcatc cgtctatagt tgtgctcccc ctactcagaa ggtacatggc aaatgcagca    177840
     gtaataaaca aggtattaac atagaagtat gacatcagct tcgacttgac gcttagattg    177900
     taagccttcg aatagtgagt gattgatatg tgtataattg atgatacaaa taaattgaat    177960
     ccaagaacaa acttgtatcc agatccttcg catacgcttt gcagcccgat atttgatact    178020
     gttttgcata aggatgaaga caacgaggct agaatataaa acagatatga gtatggcata    178080
     gaatttgatg ctcctaagag atatgtgaat gccactgtgg ttatcgatgt taaaaatgct    178140
     aaggaaacac atctattttc tggtacgaac cttgatatct gcaacccggc aaaagaagaa    178200
     agtatctttg agcatccttc gatatatccg tgaataatga cgggcttgac tggatttgag    178260
     tggtaagata tcgagttgtc aaaattggag aatatcttaa ttaatgcata ggagacaagt    178320
     cgcacaggct ttgccacaaa aaacagcatt ttgttgacct taatgctgtt ttccattcca    178380
     ttcttccttt tctcaaggaa tattcctgcc gagtaaaagg aaaggcatat gtaaagaatg    178440
     cttgcagatg acgagagtaa ggacacaagg actacgtggg acttgtaagt gtccttgatc    178500
     tttttccatg catccatagg gttccacatg taatctatga atttctcttc ttttttactt    178560
     ggggaagtgg caggaagtag cagtacagtc aacagagcaa gagatagtcc aagaagagaa    178620
     atagatatgt ttacaaagtg gtttccccca cacattatga tatcctggcc aatccatgat    178680
     gaaataacac ctacggatgt tttgatatta attgccgttg atagaatcac ttttttgtct    178740
     tctttttctt cagcagtaga gttgagaatc gacttcatca caaccccaaa ggacgttgtt    178800
     gccccatgaa gcacatagac agtttttgtc agaaaggtat ttttgaacgg catgaacata    178860
     aatatcaggt acacaagtat ctcgataaac gtgtcgacaa agaggctcat tttgtttcct    178920
     agaagctcga ttatcagaaa cgagaagaga gaaacaacaa tggaggacat aaaaaagagt    178980
     gggctaaagt tattatgaag ctctctatta tggaatccct tctgttctac aaggtatgga    179040
     accatgaaag aaagaaatgg agtaaaggac ttcaagccaa agtattgata cagcttgatt    179100
     gtccatgaca tctatctttg agggtctcca aagaaatcaa ctaatagaga ctcttgagaa    179160
     attttttgcc tgggttgata aaactataca caacaataag tccgcaggaa tttgccaatg    179220
     ccgagaagtg ccctccataa tgggaacagt gaaatagtcc cgaaatgaag agtggggtgt    179280
     gtgaaaacct cgaggatttg gacgcagaaa acacggagag aagatccaag gaaaagcaaa    179340
     gaaaaacatt ccaatgtctt tcaagaagaa cagttgcact gagaatatcc tacgatgggc    179400
     gaagatatag tggaatggca cctcagagtg gaaaagagac tgtgggaggg catcttgaaa    179460
     atgccttgaa gtttacagga ctaggagaaa aactggtgta tgcgggaaga acagatgcag    179520
     gagtaagtgc aataagcatg gtggtatctg gagtgtttat atcgaggatt gaaatgccta    179580
     atagaagcta tgttgtaacg gaaagtgact acaaagagta taagtacgac atgatattaa    179640
     acagtcatct tccttcagat atacgtgtga ttggatgggc tcctgtgcca gatacattta    179700
     gtgctagatt tacatgtata caaaggcaat atcgatacta ttttcacaaa gaggaccttg    179760
     atgcagacag aatgagggag atggcatcta gaattaagaa aatggaaaac ttctactatt    179820
     ttagcaagca ttcagacaaa aacgctcggt acgaaaggaa gttagacgag tgcaggatag    179880
     tcgacgaggg agatgtatat tacctagata taagggccag ggcatttctt cataacatgg    179940
     tccgaaagat tgtttgggct atacagaaag ccggaaaggg agagacatat gatgctgaga    180000
     gggtaggaac gtcggagccg gatccactag tcttttgtgg agctatatat ccccatgagc    180060
     tttgtttcat caataaccct cgctgccatg aagaatttcg tcgacaaatg gaaaatgacc    180120
     agatcagtta taagatatcg caggctagac tagagagcct tagaaacgaa ctttgcaaag    180180
     aaaccaagcg caaagaagaa gaagcatcac ataaataaaa aattttattc ccgaactttt    180240
     tcaataatct ccttgacaac ggtttttccc ttttctgtga gcatgtcctg aggatgatcg    180300
     tttatccacc ccatgttctt tagattctcg agtacagaga tccctatttc tggataagca    180360
     ccaacatact tgctgggacg gcatcctctg tttttggagg aaccatattt atttgcaaga    180420
     tactcgggag taactgtgcc ccttatagat atctgcctca caatagaggc cattctcgtg    180480
     aaataccagt cttcatcaat aggtgcttgc tcccgtcctt ctcccgtctt catgatatca    180540
     tggtctttta taggaaccac tttgttagtt gatttaagat aagatttaag tgcctcgttg    180600
     aacttttctg gcctgacatc atagatctct tccatcatct ggggtgaaaa ttttgctgtc    180660
     gtcaaaacca aaagccttac aattagggtg cctaccatga aaccctaaat gacgccttca    180720
     tacttcatat cgacaaaatg ttgcatggtt ccgcatatac cagatgccaa gtctatttct    180780
     tccacaaaca aaaatataaa gatatatgta gacgatattt tgtacaaaga ttcagcctat    180840
     gacggaggat tcgacctgcc gataagggag ttctgcgcca tttccgatat aaaaacatgc    180900
     cttggattta gaaacaagcc tagtgttttg gtctcgaaga gaggacacta caaacttaac    180960
     aaagagagat acgaaggact tcttgaggtt tggagaccgg actaccatgc cgactttgag    181020
     actgggaaaa tcattataga aggaaatgaa ttgattgagc ccaaggatac cagagacttt    181080
     gttgagcttt tgaatagcgg ccatttgctt tttggaactg aattcattaa tactctcgtg    181140
     gagcagggaa tgatgctagc ccttgagggg tgtagactcg atgttctcta aatattcgat    181200
     tgcaagtgct gcggagattt gtctcctggg tatctcaagt atctttggag cattcgagag    181260
     ataaatgcac taacatatct tgtaattcat aattttaatg ttcttgacag aatatttgaa    181320
     gggattggga acaataagtt agatggtaag gaaataaaga tgggaattaa ttcccagcct    181380
     acgccggctc aatgatagat agaactttta gtagtgcttt taattcccgc ttggggcgta    181440
     gacaaaggtt taatatacta gaaaatattt accccaaatg agcttaagtg ttgtctctgt    181500
     agatcagttt gtaaactttg ctctatcgat agtgtcaatg aagatctctg gaaaaccaat    181560
     gttccagaca ccaaaggcaa tatggatact aagggtgact tatctatgtt ccaatctcat    181620
     ccagcttatg ttctcacttt acataatgca gagaatcaag aagacaaatg atactcgcaa    181680
     ggtcaaaatc aaaagagaag cctctctgtt ccgagacaac aatgaagagg aggaggagga    181740
     aatgacttat gctagttacg atgaatcgga gctcaccaag atcagtcgga catccataat    181800
     tcaattcttg atcatcacag tgcttcattt gaagtggaag gtaatccagc cgctttttgt    181860
     ccaatcgttc gtgccgataa gaaatctcct actcagccct ctctatgctg cgtatgtctg    181920
     gaacagacct gtcctccggc cttttgaatc caacatgttg ttccagaagg cccccacgcc    181980
     atctgaaaag aagagggtta aggaggactg attaaacaat ccataaatat cttgttcctt    182040
     ttgagtctat cttccctctg gagaggcttg aatcccaagc tgtgtgttct gaagaagaaa    182100
     taaaagtttg gcctcagttt taatccccat atgggaaatg atataaccca agaaaagaac    182160
     gaagatgcaa atggaataca agaagaaaca aacacagtag aaggcacgcc aacgagcctc    182220
     tatggagaaa gtgacatcat tgaagaggaa agaagcatag ttcgtgtgaa ggttcagcag    182280
     aagaaaggaa caaagaaggt aacaatcatt gaaaacatac caaaagagct tagggaaagt    182340
     cttttgtcct ctctcaaaaa ggagatgggt tgtggaggaa tactccttga cgataagtcg    182400
     tcgatccaac tccagggaga taaaacaaat atgggaattg ccacctattt aaaaagatat    182460
     attaaaggtt gcaaggtcga attgaatggc cggatcagat gatgcaagag gaattcaact    182520
     tcctccagag aaaaggagac gatcgaatta aacggaaaaa tattattctt ttaatgggtt    182580
     agtttgtgaa gtctaagggt tcaaaaagaa tcctatctgg ggctcggaaa actcgagatg    182640
     ttttgtgctt gaaaagctcg ttgagaacat caaagtcata ccttttccct atcctcttct    182700
     tatttttgtt tttaacttca aagtcgtgta gcttgtgttt tgaattgcac atttcgtcct    182760
     ttgttagaat gtctttctgc gacctgtgct catgcaagta catgcaatcg ctgttttggc    182820
     acaatgcatt tctcagatag aatgtacaat actttgtcgt tccataggta cattttagaa    182880
     ccttcccatc caaaaggctt tcatcaacct cctgtatgca gatctttgcc tcttcgtccg    182940
     tgctgtatgt aatataagca cttgctgtcg actccagaga tgatgttctt ttattgacta    183000
     ctatcttcct tatcgcccca aattgcccaa aaaactcgtg cctactcagt acaccttcgt    183060
     cagcatactt ctgcggtata catattatgt aaacaagatt cttctgcacc actcttacat    183120
     tcgagaagtt tccccccggc tgcccagagg ctatcaacat cggttcttta ggcatctttg    183180
     gggattgtct gcaaaattta atatttattc gcggtcttaa tagacctaaa gaaacctatt    183240
     agaagccgag ttttcctcca accttcgggc ttctagttta ctctaataat tgcaaaaaaa    183300
     gatcctaagg gtgtaccaat aatcagcagt cccgtctaat tcccaaacac agaacggtgt    183360
     tttaaacaag gcaacctttt ctaaaattaa acacagacca aaaatttgtc atattgcttt    183420
     aattcaaaaa cattcccgca tccatgttgt atacaacctt tcctgcctcg agaatccata    183480
     tctcaacgtt ctctttggtc aaagcatcgt cttccgggtg tgcattcttc agagccataa    183540
     tcccaaccct tacgagttcc tcaacattca tcttctcgta ctccgagcag taggcctcca    183600
     atacagtcct ggacgattgt gctctgctac ctatgctcat tccagaaacc tccttggcat    183660
     acccctttgg gttgaattca acgagcctta ttccttcata ttccgccatg taaagccccg    183720
     agaccccata aagccttctc ccatcaacta tcgttctttc aaaagtatct cttagcagat    183780
     cctcaaaaac atctaaaaaa tgaataggtc tccctttgat gacctcttct tggacgcttt    183840
     tgtcaatcaa gtaatccaca atctgttgcc catcattggt aatgccagaa aacgtaaaca    183900
     gagaccttcg gtcaattgga aacacctttt tctgggtatc tgcaagcttc gatctctttt    183960
     cgttgtgggc aatcaatacc ccggctccct tgttccgaag cccaacaact gtgtttccaa    184020
     gctctgttgt ctgttggatg aagtcaagct gcttcacata tccctcagga ttgaatatct    184080
     tgaacatgtt atatcttgcc tgagatccca tctcaactgg ggtcagtcct taaaaacatt    184140
     aaacatcatt gcatttattt ggaaatcttg ctctctagga tatgataaat ctcacatgct    184200
     cttgcaatat ggggatgtcc atgtcttcaa taaacttccc tagggactcg gaatatagtc    184260
     gaatcacatc atccataggg cttcttatgc ttctttccat tgccgattcg ttaagatccc    184320
     ggagttcctt gaagatcctc tccacaaaat tgaacattcg gaaggcctcg ttgaagtaga    184380
     gggaatctgc cggtgccgcc ttcagaatct cttgaaaata tcctttaatt ctttcctcta    184440
     gatcctcaac agtctccatc cgaggcgcct cctcaagtct ttcaaatatc ccatttcccg    184500
     tcctgcttgt aaacagttta aatgtgtcct cccggacaat gaggtccata accctataaa    184560
     gcatcattct aggggctaaa accaagctca aaataccaat atacattaca agtttattta    184620
     aaatgacata catatccgca gaagggcttg gctggcaatc tcatccatct catcaaagtc    184680
     gtcctcgtcc aaggaccctc cattagggac gtattccgga agattctgga cactgatgct    184740
     tctcttggtt ttccggccca tgtccccttt ctgaagccca aagccatact cacctttctc    184800
     ctgcgttatc ccatgagcct tctgaaattc atcaatcgaa cagaacatac ttcttctcct    184860
     taccttctcg cttctccttt gtatcgacga attccaataa ttctttattg cattatccgt    184920
     ccttccagga agatacttgg ctatctccga ccatctgttg ccaaatttcg aatgaagttc    184980
     aattatcagt gcctcctcct ctacagtaaa tggtttcttt gtgatttgtg ggttaagatg    185040
     gttatgccat ctctctctac attgctttcc aactctactt ccaagcctct ttgcaataaa    185100
     cgaccagttc ttaggggaaa actcctttac caactttaat agcttctcgt cctcctcatg    185160
     cctccatgga cccttgacta acttgatgtt tgcatccttc tgattctgtg ataactgatc    185220
     caacgaagcc atgaaatggc acagggatta aggtttatat tcttttgttt acaaaattaa    185280
     atttggtgat atatttgaca caattttgac tccaagattt aatcattccc caaattacaa    185340
     ataaacttat atgagcctga acttttcaag gcagatggaa tagattccac tccatccatt    185400
     ttctgttaat cccttcaatt ctccccaagg cttttcttcc tatgtctgtc tcttcaattc    185460
     caaaaaggaa ccatgtaatg aattagtacc gggagattct ttaataaaaa ttactattac    185520
     atggtatatg ggcgccaaag cccagtcttc ctaagattcc cactttccca aactagtaaa    185580
     ttttaattgt tgcgggaaaa gctacaagcc tggcacactg aagattggaa actgcattta    185640
     ttttggatct ttctataatc agtttagaag gtatcaacct tcaagtactg aaataaatag    185700
     tacagtcttc ttactttaaa ttctatctct ataatactca tattctccat ttctaaagca    185760
     ctccactaca tatgagacaa tcctttcgac atccacttcc ttggaatcca aggctcctat    185820
     aaactcaatg agctgctcgc cctgaagctc cagtattttt tttgcaaaga acctgaggat    185880
     ggctgcagca aagaacataa aaacagagaa atcgaagaac aggaaaaaat cccacattct    185940
     tagagccaac ttgatatcaa accttgtaaa tagcgtcaaa taccagccca cggcataaac    186000
     cccgatatct atgctctgat gtagtagatg gccatacacc tcaggtatta aagcccggaa    186060
     aatctcatcc tgcactctct gcacccgagg aaccttgctc agcttcttgt caaacaaggc    186120
     ttctagattg ttgttcttga tgatgctgac aagcatctca aaggcttctt cctcagggaa    186180
     atacattaag agcaatgctg cagcactgga cattccttgg cagtatccaa cctccggatt    186240
     gtaatttgag tatgctgtaa ggatattgaa caattcgcat tgccctcttc catattctct    186300
     gctgaagaga cagtgtcttc ggaaagtcct ctgaacatcc acatggatct gatgctcata    186360
     tccactcctt tttgatatta gacttgagta actgaatccc gaggccttgg gagtaaacag    186420
     tccccataat ctgtacttca gggagagagg aattccttgg tatatcaatc ttctcgcagc    186480
     ctcgcttctt cgcagctttt ctccattatt tttgcatctt gctatgagat cgtaccattc    186540
     gtttttgatg gagacgggat tgtctctggc ctgggagttg aagctatcta caacgaatcc    186600
     atactcgttt gtgcaaaaaa tctcttcgga catactattg gcattgtaga gatctcttat    186660
     gcatctttcg ttcttcatgt tgttttcgag ccgcattttt ataaatagag gatctgaaac    186720
     atcaagaaaa ggctgattgc cctccagata gatgtgttgt aactctttga agtccctgcc    186780
     ccgtgacaca tgtgtagagt ccggcctgaa aatcttgtct gctaacgcct tggactgaaa    186840
     caatgcaaga gatctgtgta aattaagaaa aactcaatag aacatatgca tcataagagc    186900
     acagtcaaaa agacattcaa agtcttgttt ttctttatcc aggcattagt gtttatttca    186960
     ggggttggag ggtcgatagt tggaacaaca gtctatctaa ctgcacacga actccttcag    187020
     atacctaaaa aggcacttgt gatttcgtac acattgggaa ttctagaagt gacatcgggg    187080
     attcttggat acacggcatt ggtgtcgaga agaaagattc gaatgcttgt ctacatccta    187140
     atcacactta tcctcatgaa tgcccaggcc atggcggtgg tcaagaactc agctatctac    187200
     gagaagtcac attcatgggc agatcaaaga tggagtttat tgagtgaaga acaacgaaac    187260
     tttattcaga tgaagtttag atgctgcggg ttttttaacc cagccgacag aaatggatcc    187320
     agctgtggag gagagtatgg atgtgcagaa acgattgata agctttccaa gagtacggta    187380
     aagcttctgc aaaaaattct gatgtttttg ttcttcttgg agtcggttgg agttggaatt    187440
     ttgagtatgc taagacttag aaagtgaaac tgggggaatt ccgaaataat aaaagtagtt    187500
     agcttttggt ttggtctggg cttaggagag tataactaga agaaggattg agatgaaaag    187560
     gagttgtagt gctgcttgga aggaacttat aatttaaaaa tttgccccct tataatgcac    187620
     caggaaaata gaaagaaacg gattccaggt attcactcat acctagcagt tataggagag    187680
     cttcggcaag agcttgggaa ggttaatgag tcgataaacg acctccgaga taagatatca    187740
     gctatttaca agcaggagag agaaaactcc ccaaagaata atttatacaa gaagctagaa    187800
     gagctgggta acgagataaa ggcattgaag gaggataggt cgaaagcatt taactctaaa    187860
     aacgatgttg tgggagtata tgagaatgta aagagtgaga tccagccgga aaagggaaag    187920
     aaaatgatga gtgcacagga aatcgatgcg cgcatgaagg agataaacct caagctgatt    187980
     tcttcgaaat gtgattccaa aacagaaaag atatttgaga tggaaatgga aaatcttagg    188040
     aaacagaaga agaatatcgg gatgatggag cagaagagca agcttgctgt agatatgaaa    188100
     gccaagcttg attcgttgaa tgcagagatt aaggatctga gccagaagat agcagagagg    188160
     cagtctgttg tagatggaat aaaggctgag cttaaagaga taagcgacca aggaaagcct    188220
     aagaatccgg ctgttgaggg gtatgagaag aacattcaga tactcaaagc caagagaagc    188280
     gatctttcgg agaagataaa ggcacaacag gagaagataa gagagaagga ggttgagtac    188340
     gataaattcc ttgaagagat ggctattgca caggcacttg agaagcaaaa ggaggagatt    188400
     aaacagagaa taaatgctct tgaggagcaa aagaacattc tctctaaaga ggagtcgaag    188460
     cttaatcctt cgaagtttga ttctataata tttagaatgg ggtctcttaa cctgtctgga    188520
     gagaagatca gccttcctgt cgatctagct ctctatctaa gtcagcataa gattccaatt    188580
     ccaacatccc ctagtcaagt ggaacctact attgagacac ttaagtctca gaaggaaaac    188640
     tttgcaaacc aagtagttga aaagaggaag gaatttgaaa gcaagatctc tgacctggaa    188700
     agaaagatat ccgaagagaa gaaaacttta atggagatgc ctcctactga tataaaggtg    188760
     ttgaagttca agcgggatta aactttggtt gcattttgcg gtttgattta ttatatttag    188820
     aagaaacaga actttcttgg acacttccaa gtaatccctt ctttcaggag atgtttgctg    188880
     gatgttaatt atcttttccg gaaggacttg gcagtgcaca gccaataatc gtcgatttca    188940
     tggcgggtgc tgtgagtatt ttcttttttt gcttatgtga tagccgaacg atgcggactg    189000
     tttctaggga ggggagttct gatggccttg gcgaatagta aacccctgca tatctctcgt    189060
     tcatcttatc gagtgttatt cttgttaaca ttttctcttc tttgttttta ctccccttgg    189120
     gcttattttg ttttatatag acatatgctt ctggaaagtt ctattggtac aaactatcta    189180
     ctaagggttt cattggttaa aaagagggca gtgaatctaa aaaaatcata gggctaggag    189240
     ttttacaacc ggtataaaaa agtaaaaaaa aggcacccca cttaccacgt ggagatgaaa    189300
     cagccttcat gcggttttca tcgtgaatgt ccaattctca ctacacaaaa tggagcaatg    189360
     ggcattcatc tgggcaacac cctccacaca atttctttcc tgggagatta agcaagatct    189420
     gctttctcct tattatctaa ggtttgtatc ttttccaagg ctgagcaact ctggaatgga    189480
     gagacatcta taagaggcca ggcctgtctt tcagttaacc tccgtctttt aggagataag    189540
     acacaaataa atatgtctga tgatccttta caaaaaggag atgccctttt caaacattta    189600
     tgaaaacacc cttcaaattc accggaatag aaattagaaa tgaagagaga agaaatagat    189660
     gatagtaacg attgccgcat ctaccacgat gacttccgcg gcggcagaca taggcccata    189720
     tctgcaccgc cagtggataa gttcttcatt gaggatgaag tggagcttgg ggatatacaa    189780
     acagatttga actactctat tttttacaga agaaattgta agaacgagcc tcgactgcaa    189840
     ccaccgagct tttttataag ggggcaaagc ggatattggg ctagccaata tgatgacttg    189900
     ataaccaagg cgttctcaaa caccgggttt tttgacataa aggttactgg agagtcctct    189960
     gcggagctgg aaaataacag gtctcttgca gaaagaattg acgaggatta cccggaatct    190020
     gagaagagta gtgagtataa gggcacatca agagcaacaa cacccatagg gaatatgaat    190080
     gtattagata ccgaggcatt tagtgcgatg ctaaatctca aggggggaaa aggaacagaa    190140
     accacttccc aaggaagccg tccctctcct cccgatgggg gtattgaagg aattcctatg    190200
     gacagcaagt ttctgagaga gctcctagaa gtatacgagg agcaaagtgg aagaggaagt    190260
     aaaaacatat ttggaggtaa taccatgaaa gagatatgta tcaatgtaag caaagaccag    190320
     gagggaagca gatgcatcca aagaaaaatg gacagcattt ctagggagga gatttcatgg    190380
     ttcttcaata atattgtaga agcggcatcg gaattatctg ctaatctgtt tggaaactac    190440
     gtcgttcaaa agattatacc tcttttaacc gaaggagaga gaacaatatt aataacaaag    190500
     ctggttgggc aaattcatct tctttctgtt catccttatg gatgcagagt ggtacaaaag    190560
     ctggtggatg tttcttcgga tgttgatttt atcctagagg aggtaaaggg caacttacta    190620
     gaactaatag aggatcaaaa tggaaaccat gttattcaga aatgcataga gaagtgtaaa    190680
     gacaggaaaa ttatcctaca acaattttcc gagaactctc tgtttctggc cactcacaag    190740
     tacgggtgta gagtcattca gagaatgctc gagttctgca agaaggacga aatcaaaggt    190800
     attgtggaag tcctcatagg aaacataaag acacttgttg atgaccagta cgggaattat    190860
     gttatacaac atattctggc agttggaaaa gaagaagaaa ggaaccttgt catcgaaaga    190920
     ataattgaaa agagctatga gctaagtaaa tgcaagttct caagtaacgt tgttgagcaa    190980
     tgtgttaagc tttcaaacaa tggccaaaga gagcagtttc tggagaaatt cttggagcct    191040
     gtaggtggta agcctgggat gtattctatg tgcaccgaca tgtacgggaa ctatgttgtg    191100
     cagcgtctgt acgattcctc tggagaagga gtacggaaag agattaagaa cacactaagg    191160
     ccttttgtca aggacctcaa aaaatctccg tttgcaagac atatcctctt caaaatcaac    191220
     acatgatcgg cttccatgta aaattttgag aataaaggta aaggtttaat cggactcttt    191280
     ttttaccaat tcccctggga ttcaaccaag aaagtaaagt tggtatgtag ccctggaatg    191340
     accaagggtt taaataacag ggatgcaatt atagccatga ttcttgcgat gatggggaca    191400
     gggataacct ttatgccata tgcatttaaa tccgcaggat atcttaatgc aatatttctt    191460
     atgatgttct ttggaatggg gacggccgtg tcatgctatt gcatttctta tgcagcaaag    191520
     cgttcaggcc agaaccatcc cacatattct agcttagcat ccgatatttc tacaacactt    191580
     gggtatgcag taaacatttc catcttcttc aatggatatc ttgcaggtgt taatttctac    191640
     agatatctat cggatctaat tgttaagaac tcatactata tccaaaatct taccggagac    191700
     tacgagaagt ctcggaaggc tgttgttctt gccctttcaa ttccatttct gtatctgtcc    191760
     ttcaagaaga cactgtcggg ccttgtattt acgtcttatc tgagtattgc atctgtatta    191820
     tatctgtcgt ttcttatgat ttatctattc cttgttgtag gaacctcgtc tgtgggcgga    191880
     aaggcaagac catttaacgg atccttggag gaagccgttc cctttttcat ttcctctatg    191940
     gtgtgccagg caaatatggt caaaatatat acggaaatgg agaagaaagg caacagaaac    192000
     attgtgattg tgtctctagg tgctgccgtc ggaggaatgc tcatcaactg ttttattgga    192060
     ctttttggat atctcgtgtt tggaaacggt gtgtctgggg aaattataac agagctctct    192120
     gatatggaca gcccaatcaa caaacgtctc agggaaggct gggataagaa taacatcatg    192180
     tctggaatgg caatctatgg aataatgatt acattgtttg gagggtatcc agttcaagtc    192240
     aatccagtcg gagatatgat attcaagctc cttcctttgg aaaggcgaac agaacccaac    192300
     agaaaggcaa tggttgtctt actgtggttt gtagccgtac ttctgaacct tatgaaagag    192360
     cttaagacaa agataattaa gaaatttctt ggagctacgt tttccaattc tgtggcattt    192420
     gtatatccgt ttatatacta cttgtcgatg agaaaaacca gatctcttgt gccaacaatg    192480
     gtatgttgtt ttatgataat aatgagtatc gtagtaagca tctatactgt ctttaggttt    192540
     tctctaggtg gctgaatata gatcaataaa gctttattta gcaacaagta ggtctagctt    192600
     ataaagggac ctgcacacga tattatgttt ctatatccaa acttggcaca tagaagcggt    192660
     gtactcttgg tataatatgt tcctaagcaa cttcctttgt gatcggttct atcccaaagt    192720
     ctgacgctat tgtctgcacc acaggatgca attacacttc catagaagca gaaggacaca    192780
     gaaaatactg tattttcatg gcctgcatac tttcctagga gcttcgagct ttgaatgtcc    192840
     caaagaagaa ccgtcctatc tttactccca ctgaccagaa atttaccgca atgggaaaca    192900
     tccatacatg tcaccgtgtc tgtgtgacca cagaaaattc ttacaacaga tgccgtactt    192960
     atgtcatgca tccttattct gtggtcggaa gaccctgtaa ataaatagtt cgagttcgga    193020
     tggaacttta ctgcagtcac atcgcttaga gatgagatta taagcctttc aggcttggat    193080
     gtcgcaacag accatataat ggcttgcctg tctcctgctc cgcttgcaaa aaagtaatca    193140
     ttgggagctg catccacaca ccagactgga aatgcatgtg ccttgtaaac agcaagtaag    193200
     cacaaaagat caaggctcca taaacatact gtgcagtctt gggagcctga aacgagaaac    193260
     ttgttggaag agaagaactt cagtccatac actggcccag agtgtccaat aagcttgtag    193320
     ctgtttccaa cctcctcaaa tttctcttcg tttagagtct tgatatccga cttcgcaagt    193380
     tcagagctgc ttttgagttt cttcaagggc tcattggtta gcgaatatac ttctatgtaa    193440
     ctgtctttaa atccacatgc taatagtttt aggtcgttgc tgatctccgc cgccgttaga    193500
     ccttcgtagg tgttatgtat cgtataacag cagatgctag gaaggttgtt tttgttcacg    193560
     gcaactctct tgcacaggtc tttcagcttc tcaatttccg catgaatctg cgatgcattg    193620
     ggcttgtaag ctgaatcctt tggtttcatc tccctctgtt ttcggagctg cagcacatat    193680
     gtttcaagat ggtcgtacct gtattgctcg tctccaagta tggcatcttc acactccttt    193740
     gaaaccagaa aagtggttag gtcgatttcg gcatcaacaa cacttgtctc aattccctga    193800
     ggcctgtcct cgctcttagg tccaatatac accttaatat ccaggtgttg gttaagtatc    193860
     ttgagtatgt atgtcagatt cctttcttca aggaagttta taagaaggtc aaatgcatat    193920
     cttcccatcg aaagatggta cttagaactc ttgaaggtgt aggcaaagtt gttctcatgg    193980
     atgtgttgca ccgtatagat gctttcaaat tgtttgatct cttcagactt gttgtaatgg    194040
     tcatctctgt acttctcaaa gaactctttt gcttcgttgg tcttgttctg ttgtattaaa    194100
     tcgaagtaga tgtgaataaa cagaggatac aaaagaggga ggagatcatt cttgaataag    194160
     tcaagagagt cttcaatcca tgttttaagg ctaacataag atgtctccat ttgatctttg    194220
     gacaaggtct tgcttgaagt gctttctcta atgctctcag acataccagg gctttgactt    194280
     gaaaatttta gcttccgtta ctataacaga agaagaggct gaaaaaagct tcaatgaaca    194340
     acacttctct agagtgaaaa aatagaatat aagcattagt gaatatctct aaatttcatt    194400
     tatttgttta ggaaattata tgcttgagct tggcgattat gatgaattca agtcatggtg    194460
     tataaggtgg tggaggtcca tacgtataac tcggctgagg agttgcatcc ggaccgaaca    194520
     aactactata agatggcggc ggtggaaagt ctgcgggtgg atttccttcg aattggaaag    194580
     ggggtctagg gaatgaatgg ggacctcccg aagacgatat cagagtagga gaatctgctc    194640
     ctaactcatt ttgcgaagag tctttaaaca ctttgtaaaa ataaataact gctactacta    194700
     taacaataat tgcaatcaag actagcaaat caatagttac ttcgtaaatt gatgggatat    194760
     gttccttatt tttattggct ctcgaactgt tcagtattgt aagatgtttc aatgtttttt    194820
     tcttcttttt cctatttcca tcgagatgtt gaacttttga agtattttcc atggattaag    194880
     cacaattgaa atttttagaa tgggttttta aaagggaaaa gattgttaat tggttatggt    194940
     tccaaaaatt taattatcaa ttccatcaaa aaagtcaaca atgatggaat atgctttgtc    195000
     cgaaacagtt ctgtcgctac tgtcctgcag cccttctatt gcgtcgacta tatctgcctc    195060
     aacaatcttc tcatatatgg gattcttacc gtatcggagc tcccactgtc ttcctccatt    195120
     caaggcgtat ctaaagcaat caagtatttg gcattgcatt tcaggaacat ttggaactac    195180
     atctaaatag ctttgcaggg catcaatgaa gctattgtcc ataagagtct taagccattc    195240
     aaacttcgtg tcagaactac tagggagatt gttacaatga tacattaagt tcaaaactgc    195300
     ccagcaagct tcctttctta taaacagctc gtaggacgac atcgagtcaa tgagaagagg    195360
     aacaagatcc gcatctacaa cggattttgc atgctctgca gttccagccg tgatgttcga    195420
     aagtgtccaa catatctcct tccttagtct tggctgcttt ttgttctcca gtctgtagaa    195480
     tataggtctg aagaatttca taaaccccat ttgtatcaga gcacttgtct ggtcatcgga    195540
     gcctgttact atgtttccta tcatccttat tattggagaa attgcgcaca ggcatatctt    195600
     tgcgtcttcc gacgagtaag atattccgat cagtcgattg gtaagagctt ccaggagaga    195660
     atatgttcta ctcattgttc cacttccaat cactatgtct ccacactcca tgctcacatc    195720
     tacaatgtaa ctaagagccc aataggcatc actaacaacc tctggatctc ttatgttaat    195780
     tagcttgaaa aggacctcca atgacttttt catgttctgt tcatttggcg gtggatttct    195840
     ccctctgttg agattcgaaa ggagccaggt aagatttcta actattttta tgtgaatcac    195900
     gctttcatgg agtttttgaa gcagtccgag aacagtatcg atggctcctg tttcaagtat    195960
     tatatctctc atcccctctg aatctccggc aatgtttccc aaggcccata cactttgatc    196020
     cagaactgcg tcatttgtgt ccagaagcat ctggatcaga agagggactg ccccgcaatc    196080
     tataactact tttgtttgct gagtggatcc cgatgagata tttgttatga cccacgcagc    196140
     ctctacccta attttattta ttatatccat agcaacacca aactcaggca tatcctgctg    196200
     tatcctggag attgggattc cgctcattgt catttcggat gacattaaaa aggatatatt    196260
     cataagctct ataaacctgg gaacacatcc agagtctatg actggttgaa tcgggggaga    196320
     atcttctaca ctcagcaatg acctgaactc ataaacaccc tgatgagctt gctctagatc    196380
     gttactaaat agcttttcct tcatagggat gaaattggaa atggttgatg cagaaatgga    196440
     aagatttctt ttcttgttca aaagctcctc ttttttttgc tgtcgaagct caacctgctg    196500
     ctcctccctc atttttcttc tgttttctgt tgttttacta tcaaacatat aggacctggc    196560
     catttcgatg ggttcaaaat ttactcgcct aaacacgttt ctatgaaagg aagagacaaa    196620
     agatggttga taaaggatct ccgcaaaata gaaacccata agaatgtatt tccaaaataa    196680
     aacaattcct ttccacccta gccatcatgg caggaatctt gaagagtctt gcagggcagt    196740
     ctccttctct caagcctgct cttccaccac aaatccctcc cggcaatctg gttcagaaga    196800
     gaatattttt tgatgcccaa tcgactactc ctgtcgatcc aagagttctt gatgcaatgc    196860
     tcccattcta cacaacggtg tttggaaatc ctcattcaag aacacatcaa tacggatggc    196920
     aagccgaagc tgcagtagag aaggcccgat ctcaagtggc ttctctcatc ggatgtgatc    196980
     cgaaagaaat aatatttacc agtggagcaa cagaaagcaa caacttggcg cttaagggtg    197040
     ttgctagctt taagctcaag gaaggaaaac ctgttcatat aataacagtt cagaccgaac    197100
     acaagtgtat tcttgataca tgcaggaacc tagaagaaga tggtgtggag gttacatatc    197160
     tccctgttgg aaaggatggg atagttgata ttgaagacat tagaaggaat ataaaagaca    197220
     atacagtcct tgtatctata ggagcagtaa acagcgaaat aggaacaata caacctctca    197280
     aggaaatagg aaggctgtgc aaggaaaaaa aggtcctttt ccacacagat gcagcacagg    197340
     gggctggaaa gattaaaatc gatgttaatg aaatgaacat agatctccta agtatgtgtg    197400
     ctcataaaat ctatggtccc aagggaatag gggctttgta tgtcaggcga cggcctcgag    197460
     tccgaatgat gccaataatt aacggaggag ggcaagaaag aggacttcgg agcgggactg    197520
     ttgcatctcc tttggttgta gggtttggaa aagctgcaga gatatgctcc aaagaaatga    197580
     aaagagattt tgaatacatt aagaagcttt caaataagtt aaaaagcatg tttaagaaga    197640
     acattgaggg agtgatcatc aatgggtctt cggaaggaaa ccctggatgt gtgaatgtat    197700
     cgtttccatt tgttgaagga gaaagccttc tgatgtatct gaaggacatt gcactcagca    197760
     gtggaagcgc ctgtacatcg gcctctttgg aaccatctta tgtactgaga gcacttggca    197820
     gagatgatga acttgcacat tcttcaataa gatttggaat cgggagattc accatacccg    197880
     aggagatcga tatagtagca agcaagactg ttgaagctgt caaaaagttg agagaaatgt    197940
     ctcctcttta cgagatggtc aaggagggaa tagatctaag caaaatcaat tgggctacat    198000
     gatattaaat ctaatcaaag atatcactcc tttttaattt ataaagtata gttagagact    198060
     attagaaccc tttatgtatt tgataaactt aataatctta aacggccatg aaaaagccaa    198120
     taaggcctaa atgaatataa cattattggt tcattttgat acaaaaaact atataatcaa    198180
     gaaaaaatta tgtgctttat tatgggatat attaatatga atagcagtag ccttattaag    198240
     ccatatgatg gggttgagct taatgagtcg gggaaaaagt ataagaaaat aggggaagac    198300
     atgcttaagc aaaagaagct gggtgtggtg ataatgagcg gagggcaagg aaccaggctc    198360
     ggctcagatg ctccaaaagg attgttcaag ataaagggta agactctttt tgagtggcat    198420
     atggagacaa taaaggagct tataagcaag tacagtgcag atataactgt atttgtcatg    198480
     acgtcttcat ttacagatga agcagttaga aattactttc agaaagagaa agggaacttc    198540
     ggcctaaaga tttatttctt caagcagaaa aattccttat gtgtgggaac agatggaaag    198600
     cctctagaac tctacgatgg atatgctgaa tctccatatg ggaacggaga tatattcaag    198660
     gcaatacagc aagtcaattt tgaagaggta gaggtcttga atgttatctc catagataac    198720
     atccttgcaa ggattcttga tcctgtgttt gttggggcat tttacagcgg agattacgac    198780
     attctgagca agtctgtgac caaggaagag aaggaaagcg ttggggcatt tttaatgaag    198840
     gagaaactta taatcaagga gtatggtgag aacgacgcga atggacaagg aatacaaggt    198900
     aacatctgta accatctgtt cagaacatca ttcataaaaa aaatgaagaa tgtggatctt    198960
     cctgagcaca aggcattcaa aaaaatccca tacactgaaa atggaaagct tataaaaccg    199020
     gaaaagccta acggattcaa gaaggagaca ttcatatttg atagctttga atacacagaa    199080
     aagaacggtg tgatgaacgt tcctagagag aaagagtttt ctccattaaa gaatggaatg    199140
     gactcaaccg tggacaaccc attgacatgt gccttggcag ttgagaagca tagaattcaa    199200
     acttccatac aataaaccct aacttaaatg gtctcctgta aggaactcca aagttaatat    199260
     taattaaggt cttctacctg atagaaaaat tctcgaacaa gaaaagtcat tgttaatcac    199320
     taaaacagac ttccgttgaa ctctggttta taaagaatgg gcccaaccca ttcccaagcc    199380
     ttcctacctt caacacaaga ctctcttatg ttggagtttt tgaaaatgat atcttcaacc    199440
     tccttccata tctttttatc aaccccgaag caatctctaa gctgttctat atatacataa    199500
     ctagggaaac tcgtattctt tgtagacaca tatatttgtc tcactaggac atctgcaatg    199560
     tcctttacta ttttccgtgc tgtctgtaac ctttcttgct ttttcctcct aaacattcta    199620
     attaccctga ttacaaccac tacgattgat agtggaatgg atatcatgag tattcttttg    199680
     aagtaatatc taaaaaaagt cttcacagac actcttgaat ttacggaata gatcatttca    199740
     ttggagataa ttatcccaac ttcttttttc agtctttcta ttacttccga gtccttagtc    199800
     aagagctcaa ttggaataga tttggtagga gccattctat acatgaaatc tccactcctc    199860
     ctctctaata tttttcttag ttcttttacc tttttttcca ttttcttctc ccgtcggtcg    199920
     tcttttatgc agtaatcttt gaaaatccca tgcctgacca taaagccctt gtcacatact    199980
     aatcttccat ctacaattct ggagtgcctt ggagggggaa tgcaagggag tttatctccc    200040
     gaacagtacg gacacacaaa cctaaagtat ataccaactg aaaccataat cattaaaaga    200100
     gttgcaaaac accactttcc tttccttctt tgtggtctag gcctactaat attaatcctt    200160
     gtagagttgc tggacatcga cctgggagaa gaatgcttgg attgaaaatc aggtttgtcc    200220
     agggttggat ctgaagtgaa tgctcttttc ttcattttta tattaccagt ttctttctcg    200280
     cttcttctgg aaagagacga acgttcttca gaagacgaaa ggatgaaaga tgacgagagc    200340
     gaagaacctg agaaatcaac tgttgagttg ttaaacatgg ttgatccagg agtttggttt    200400
     gagggatctt gttcttctgt ttcttttaag gtatctttct tttcctggat aggggcatct    200460
     cctgaaaagc taaaatccct taaagagaag tttcttgagg gtgtttcctt agaagctctc    200520
     tctccttttt taggagtccc tggactagat gatgttccac gagacttcct atttgggatt    200580
     ccgtctttat tattcgtttc tggaacatcc ggaacttctg taaagccata tttctttctt    200640
     ggagacgcat tctggaacga attttccaag gagatgttct tcttcctact tatcaacaca    200700
     tcaatgcgat catgaatgtt ctctttatat gctctcagta gctccgactt tttggatgtt    200760
     gcagggggaa taggctcaat tccgttctca tacataattt tacgcagctg agtctttgtt    200820
     agtttggtat agtcgaaatc cttgttcagg tagtcctcta acactgtgtc cttcgacatc    200880
     tttctaaggg tagtacaaat tttatttatc atggaggact tccgagtata agtcgagttt    200940
     gtctgaggga gtaaatgcct tcttcctttc taaacctctg tttggaattt tacacacttg    201000
     ttgatttatt taatcttttg gcccaaaggt ctcttcagga aagaatcaga aagagattga    201060
     tgaagatttg aatcgctatt gttccaacaa agactatagg tgcttttatg cttgacataa    201120
     gccatatctt tatcacatcg cctattatcc aacaaaaata tacttctttc ggtgatcttt    201180
     tagtctcttt ctttggagac tcaaaagtct tttcttctct ttccagtaca agctgaaaaa    201240
     gattaacagc tatttcaaga accgatgaaa accttccaca atgctcgtaa gatccataga    201300
     gagtcccgta tagatttatg gagaaaacaa aaacacatat tattcccaaa acacttcctt    201360
     ttgggccata tcttctgtag atcaccctca tagttctatt tccaagtatc tttgcctcat    201420
     atgtacttaa aggcctctta tttatagcta taaggaagac atgcagtatg atggtgaaaa    201480
     catattgtgc caagagaaat tgtgagtatc tctcaaagct gtaatgaaat atcttgagta    201540
     tgtttgtcat tatgaagaat gtcgaaataa gtggggaaag aagaatatcc cttgcaagta    201600
     tttgtgggac atacccgact attggggaga caacaaaagc agcgtaaagt gccggacagt    201660
     ctgttcttag taattttgcc gggttcatat tgtttttgca gacaaaacaa attatgtgag    201720
     gagaaaatca acaaatctcc gatttcttcc aggtgaacca aacaaatcaa tccaaatgat    201780
     ccctaatgat aaaagaaata gtaaaaagga aggttcttca actatcggat tactacaaca    201840
     agtctgaaat tttgtttctt ttggactata acctagaggg tggcaaggaa ttaagataca    201900
     aggcgtatat ccatgttctg aatgcactga atggagagat gaatgaaaag aatcttacgg    201960
     tgggatatac tattgaatta ctccaggcag ctctacttat tacagacgac ctaatggaca    202020
     attcggaggt gagaagagag aagccttgct actatcttaa gagaggaaca aaagtgatta    202080
     aagacgcttt ttttctttta ggagttataa gaaagatgat agacaaaagg atgaaaaggc    202140
     cctattcata ctcaatattc aagacctgta ttggacaaac acatgataca atccgaaaga    202200
     caagggcgga atacaacatt gaagcatata ctgccattgc ggaaagtaag acaggtgcct    202260
     atacctttta cttacctgcc atctttgggt atatatctgc caaaaagaag gagccagagt    202320
     atctttggga tttctgtaac ctcggggctt taatctttca aatgcaggac gattatctga    202380
     atttcttccc cgaaaaatcc ggaaaatcga tgaatgatct tgaggagatg aagtgtacct    202440
     ggtttacctc aaaaatatca cagatgaaaa atcccgctgt tgaaaggtat ttttcgaagg    202500
     gagaagtatc ctcggatttg ctctctatag taaaagatct ttttaaggag tattccttta    202560
     ctcttgataa actactggca aggcttacct ttgtggtaga tgaaaatggg aagaaagtac    202620
     ttggtgtttt catttcattt cttgaaaaga gagctctggt gtaagcctgg aacttagagt    202680
     atggcaagag gatcgaaaag gaaacagatc tgaaatgctc ccgtcctttt tccggctaga    202740
     gatggaatta tatttattgg aagcgaacaa ccccttggca tgaactccaa ttttttcaat    202800
     cagcaaaaca gagatgataa taatcagaag aacccatttt tgaacacacc ttttggatct    202860
     cagcaaaata catttggaag ccaaatgaac aagccgaaca tctttgggag ccagcctcag    202920
     cagggagcct ttggggcaca gcaaccggga ggaatgttta atccttcatc atctacagga    202980
     ttcggaggaa atggacaggg ctttggctca caaggatttc ctaataagca agaccaaagt    203040
     attgggtttg gttcacagca accacaggct caaccaacct ctttgtttgg gaagcccgca    203100
     agcattcagc ctagtggaaa cacctcaata tttggaggcc agagcactct tcaaccatca    203160
     acagacctat tcaagccaca gactgccgtt cctccttctt ctggggtgtt tggatcacac    203220
     caagcaagca atacatttgg gacacagttt caaccacaaa caagtaacat ctttggagca    203280
     cagggagctg gagttgggca agttactaac ccatttacta catctgcaca gaattccctt    203340
     tctgttggaa cacagtctgc accgagtcaa gggacggagt cttcgggaat aggatcaatt    203400
     agcggggtag gaacttcaca gccccttgga ggaattccag gcctaaaacc ccaggcaaca    203460
     caggcaggag gaaacaatct ccaagcttca aacccatttg ctaatacaac atcaagcatg    203520
     gcaccagcta cgggaataca aaataattcg ccttcgtttg ctgcaccaat gcaagctcca    203580
     catattggga gtaacgaaac attcaattca caagcatctc cctctacacc agacaccttg    203640
     ggccaggcac ttgagacaaa ggactcaagc tcttctggca gaaaggccag aacacctgct    203700
     tctgttttca atcagcctgt aggagagaag ggtgtgagct tcatacaaat gacacttgga    203760
     gagattatac aacagcagac aagaaagctc gaagaaaaca taagggtctt caaagagaag    203820
     gcaaaggagg ttttcgagca ggacgaaaga ataatcagat cattgaacaa ctataagtta    203880
     ataagaaaca aaattgaaga ggaagagcgt gtaattgcag aaacagaaga gaatgtggac    203940
     ttttttgaaa agtggctgtg cagcttccag gaagaggttc ctgaggggac tggagacgag    204000
     cttctaacat gtattcgaga attcgaaaga gtgtgcgaca aatataacaa gactattgaa    204060
     actctcaagg acgaagaaga tgaagttatg tgtctagtta acgaaaatta taatctcata    204120
     accactatcg aggagaagct tgaacttctt gagaagtact aagtaaaggt atttatttcc    204180
     tcttcgaaag aacttccata aatcaataaa atgcaggctc aggtatgaac ccttcttttt    204240
     aaccgatttt tctagaactt tcaaaagata aaacagggcc tagtggtgtc cccatggagt    204300
     ttgttggagt tgacgttgga aactataaaa cagtaatagc atcctccaag gacaacggaa    204360
     aggtgtatgg ggacgagcaa ggaaagaggt ctataaagac cataatggag cttagcatgc    204420
     cgatacgacg gtttggaaat agtgtgacca atgacacaga aaactcgctt gaagtaagaa    204480
     gcagaagctt cagggactct ctgtcggaca agaaggattg ggggaatttc gggatgttta    204540
     tgaagtatat tgatagggta gtgaaaagga atacacctac ccatcctcct gtgtgtatga    204600
     ctattccggt ttattttaag gaaaaagaaa gaagaaccct agtggatatt gcaaatgcta    204660
     tgggcttcaa gcttgagggg cttgtcgcag acatatctgg aatgggaatg tttgcatgtg    204720
     tcaggagaga gggtatgcct agccagttcc ttctttttga tttcggatat tctaagtcta    204780
     ctgctgggat ctttagtttt gaaaagaacg tgttcaagcc tctatatacc aaggctgtga    204840
     agataggatc tatgcagttt gatgagaagc tgattgacat catcatcgaa aagcattctc    204900
     tggaaaaaag ccaactgatt cgagagagag ttaaaagaaa ccttgacaaa atcaaaacaa    204960
     cactgaactc caccaagtgc tgcagtatcc aactgtttat tactgaaaac cctttggagg    205020
     tggttgttac acaggatgaa tacaaggaag cagttgagac ttatctaaat gatctaggtt    205080
     cttttgttga ttctgttatg gaagaaacaa agtttgatgg gctgatcgag gttgttgggg    205140
     gaaattcaat ttcgtttctt attaagaata tgctgaaaga taagatcaaa taccagtcta    205200
     cattggatgt ttcggatgcc tctgccatcg gagcagccct cggacttgca tgcagatcct    205260
     tacgggcaag atatctactc catgacattg ttggaagaga aatttccata aagattgaag    205320
     gagaggatgt taaccccaca gttattttca gtcccaccga actgattgaa ggaaatccaa    205380
     agaagattac atacaataga aagggaagct ttggaataga aattctagag gatggggaag    205440
     ttatttcgac tcttgaaatc cagaagatgg agacagagga gccaaaggca atccatgtgt    205500
     ctttttcgat aggaaagttt ggaacagtat gtgtaacctc tgtggaatgt gaagattctg    205560
     tagattacaa atacaagcct ttcgggctgt cggagattga catggacgat attaaggcac    205620
     tagagataaa gtatcgagac gaggagttgg gccttgaaag aataggagca atgagaaatg    205680
     agctagaaac tatggcagta gggcttgggg atgttttata tagtagattt ggagatataa    205740
     taagtgaaga cgagctaaat actgtcaagg aagtggccat ggacttgttt gacatggcac    205800
     aatccgagac tgtagcccaa gaagaggagg ttaggaattc catcttatcg aggtttgaat    205860
     ttgtgtcgaa gaagcttagc gactatgagg atgcggtgtc tgaggacctt aggaagcaca    205920
     aggaagccat cgaagagttc aaaagagaaa actccaaggt ttttacacct agtttctaca    205980
     agttgcaggg gcttctttac aaactagacg agtatctcaa gacctttgat ctgaatttat    206040
     ttaatgtaga atcgtttgat ggaaacttta taaccgaggt caaaagtgac atccagaagt    206100
     atctagaaaa ggctaaagcg gaggttgaag agaagaaaag agaggccgag aaggaaaagg    206160
     agaaagaaga tgaaaagacc aaagaaaaat ccgaagaaga tactagtgat gactcaaaga    206220
     ataagaaaga gtctgaaagt aaagataata gccatgagga atctgatgtt gcaagcatcg    206280
     atgaataaag tatgacataa tttgctttta ttaggctttt tttgcaaaat ccttctttgg    206340
     atctctttgt taggaggtct gcttggtctc tgggaacatt tctccctttt cctcaaagcc    206400
     aaagtagttc ttttgtatga gactttggta catcttcagg gttgttgtaa ataccagtcc    206460
     agccagtaag aacagaattc ctccaagcag tgcccttgtc ccgaagtctc tagtaactgg    206520
     aagattctcc tccccatcct ttggaatgat tttttccttg atattgaagt tgattatttt    206580
     ccttctacca tcatcaatga ctcttttctt tatgagaaaa aggtctctgt atcttctgtg    206640
     gtcaacattg ttacgttcca gggtgtttac aatcttgttg tgaaggtcag gactcatgtc    206700
     tgccatctca cggtggatca ggtcgttaat actctcggga ttaatcttaa actttcctat    206760
     tctcagagat ttgatggctc cagcaggaga ttcagcttta cttgagtcta aggtagaaaa    206820
     gtcaagatct ttgctctttt cgccaacaat ggtctctttt gaggcgttgt tttccccagc    206880
     ctcaagcaag ttggactcac tcacggatat catcgaggat tctccattgt agtcggaata    206940
     ggcctccctg ttacttattc tgtctatgta tgggataaga ttttggttgt agtactctgc    207000
     aattgcagta accgagccaa gtattaagaa tgtattgaat aacattttcg attcatttca    207060
     tcgatatttt aagcactgtt gaaacacggg gctaacgcgg tttcacatca gagaaaaagt    207120
     tacagttgta tcaaagaata ttttaattcc tgtttttcaa tccagaaatt ggacccttag    207180
     atgctaaacc tgagtgtctt cccctcaaga aatggttggc cgatatttta aaaggactta    207240
     aaccgcttct agacactagg ctactccctt gttggtctag gacttctcct gtgttattgt    207300
     cgtcagatcc gctttccgac ggcatagcca tctcgcttcc tcctgtgcct ttcgtatgag    207360
     gtatatcaat ggtcttgttc tgattgttca ttaaggacac cacaagtgtc atggtggaga    207420
     caatcagagt tagcagactt attataaatt ttaacataaa ctttgcatct ttccaaatta    207480
     aatactacga atgaaacaaa gcctcatcta cctgagacaa acttgtcaaa cagtatcaag    207540
     atgcatacaa gtataaagac aaggagggcc gctaagacta gaaatccttc gattttttcc    207600
     tgtctttggc tctccttgag tttttttctt gtgtccatta gagctttttc gatgtcagtg    207660
     ttcgtatagt tcaatcccat gagctttaag gtacttttcc ctaatatttg ttgattggaa    207720
     tcggcctttc ctatttgtct gtgaacaagc tttattgtat tctctagttc atcgatgttc    207780
     tccatacttt cagaagtttc cttgtgctct tgaatgatcc tgtatacttt atttctccaa    207840
     tctttaactt tgttcttaga caggtcatcg tattctcctc tctcgtagag atccttctca    207900
     taatctctta tcattgtctg tataagcgac acatggtttc gaaggtcttc ttgagaagca    207960
     aactcttttt tcaagagctc ttcgtttatc ttcttctcca ttccttgggg caaggtaagg    208020
     aatgacactc taagggagat gctgaaaaaa gcagtttaga tagaaaatta aaatctacaa    208080
     gaaagcttct atttatttgc cactccctct tcttgggatt ctattattgc tttcttttct    208140
     tgatctgtgc tatgcctgga tatccggtcc agaatgaagt atttgtagac aaataatccc    208200
     gtggttacag acgcaaagca gatatttaca aagaagaaca acttatagtt tgcagctcta    208260
     tcttctatag gaatgtcctt tcctttcatc ttgtcttcgg agaaaagatt tccaaataca    208320
     agagaggtag caagagatcc aagagccgtg aaggttccgt ggtagatcat ctgagaagtg    208380
     gatttgagat gtggagggca aaggttcatg gctagttgaa ctgcagatgg ctgaagaagc    208440
     ccaaagtata caccccttgt aagttcaata aggcaacagt acaaaaacac attaggatcg    208500
     tcgtagtcta atacgaaata gcatccgacc ctgagtatct ggaaaagttg agcaatgaaa    208560
     aagggccaga ctagcccaat tcttttgctt atagcaggga aattataaag cattataact    208620
     tcaaaaacca ttccacacat ggttgttgtg gctactggag attcattaaa aaagccaact    208680
     aaagattgaa gccaggaggg ccatgtgtca gggagatcgt atcctttgat ctgtaacaca    208740
     tctgttagat atactgtatg gtatatagac aatgcctgtc ttgttattcc gttcaaaagt    208800
     atcatgagta tgaagaacag ataagatctg tttctcatta gttccttgca gtttgcagtt    208860
     atatctctcc taacagccct tccctcgctt gcaggagatt tgagcaagag aaacactaag    208920
     gatgccgata tagcagtggt cactaaagag tagtatctca gattctcaaa tttgaaatca    208980
     tctccaaact tgatgcattt ttctattacc ttacaagaca aaccgtatcc tgccgttccc    209040
     cacaatttct gctttccgta ggctcgggcc cccgcctcag gaatcccatt caggtaatct    209100
     aatacagcct tgtcgagcaa tggaggaatc ccattattaa aagccatgta aaggagaaag    209160
     ttgatccaga acatccccgg aaagatacct acatacaaat ccacatagaa cagctgaaga    209220
     agagcgcagg taagaagaag agcaccaact ataaatagat gggatcttcc gaatttgtca    209280
     ttcatcgtac caatgaaaat attggtaaag aatattgtcc caagcatcgg gcccatgtat    209340
     tttgcaagat ccccgtccga ggctccaaac ttcttttttg caaatacccc tctgaactga    209400
     tgaagagtgt agtactggag attcacaaaa aagtacaaaa tttttggcgt aattagaaac    209460
     ttcctgttta gtttttttat agactctatc atcattctcc aaacatgaac ttttatttat    209520
     agatttctag taaattaaat ttaatatatt taaggagtac atcaacttta tatttagagt    209580
     caaaaatctt tcccatcaaa ttaatttttg atattcattg gacggcgcgg aattattgcc    209640
     aagatagcct tggttaggtt cttttctcgc ttttttttcg gctttgggta gtaccaaatg    209700
     gcgctttgat attttacttc aaaggcggtt tgatttcatt tatgcttttt gagatattct    209760
     tctacagaaa aaaagaacat tgagtggctt cttatctcta actccatact taataaggaa    209820
     aagaaagatt gagatggtag tgacaaggat gtttgacata aaaaatatcc taaatgactc    209880
     gattctcctg gcaataatct cttctgggtc taaggtttca ttgtttctga atacataccg    209940
     gaaatagagc cccgctgtta ctgaactaat agcggtaaat gcaccgttgt atatcatctg    210000
     agatgtagcc tttagatgag ggggacataa tttctcggcc agttgcactc cagccccatg    210060
     ggagaggccg aaatttattc ccttaaatat ctcaaacata caacaaaagg cgaacacatg    210120
     tggattagta ggagggagaa taagatacag tacaaatcgg atcgtctggg atatctgaga    210180
     aagaagtagt ggccagagaa gacctgtttt cttggagact atatcgaaat aaaacagaat    210240
     tcctatttcg agggagattt caaacatggt gatagtccca aatggaaagt tgttaagagc    210300
     ccataaactg cttcttaccc atgcaggcca agatgcaggg agtatgtatg gtttcacttt    210360
     aagtacatac ttaacataga tcggaaggta aagtgtcatt gcagcacgcg tgaatccatt    210420
     caggaaaatt ataagtatga aaaacaaata ctctctattt ctcagtaatt ccttccattc    210480
     agacataatg ttgtaactgg gtcctctgca ctcgcttttt gaatcctcta aaagtgtagc    210540
     caccagaatg actgcgatta ttgttgtcgc aagagaatag tatctgagac ctgagaaatc    210600
     aattccactt ttggaattcg ttgttcttat gattccctca agagcaaaga tgctgatcaa    210660
     atacccggct gtcccccaga ttctctgctt tccataggcc ttggtgtttt catctgaaaa    210720
     cttgtttaga tagtccagca caatcttgtc cagtaaggcc atgattggcg tattagttcc    210780
     tagataagca aatagattta tccagaacat agagcggact cctttgaaat atctttctat    210840
     atagaacagc tggaaaaaaa tacaggatag agacaacagg gcaaccatga agatctttgg    210900
     ccttccaaac ttatcgttca ttgttgcgag aagtatgttg gtgaagaaag tcacaaacaa    210960
     taagatcccc attgcaccca actcgctttc tccaattcca aacatttctt tagcaaacag    211020
     aggcctgaac ttgtgcaatg tgtagtactg catgctaatc gcaacatata aggcctttgg    211080
     acctagtaga tatttcttgt ttaaccttga aagtagatcc atcctagaga ttgaaggggg    211140
     ccttttatta ttttgattca ccaattttga aaaattttga tgaactttga ctcttgggat    211200
     ttccattaga tgttctatgt gctcctttat attaagttaa ttggttaatt ccagagtgaa    211260
     gaggggtagc ttagaagtac aaaaactaca gcccatagat agagggcatg gagaagaagg    211320
     ttaaggcagg tttagtgaat agtgttttaa tttccataat tattattctc gggatcataa    211380
     tcacgcatct ttcgttttac aatagcctcc gggatatgat tttcaagaat ccagagaata    211440
     taattctaat gaacaaaagg gacatagaaa aaaatatcta tggagataga atgaaaatcc    211500
     agattcctcc cgagagccta tctgaggaaa tgtgggcggg gtttgaaagc ttgtgcacaa    211560
     atgcaattat aattgtctcc cagggagact atgttaaggt cttcaatatt atctctagaa    211620
     agatgaacca gtataaacat aacgaataca ttaagcatct agaaagtatt ggaaattatc    211680
     tgtttttctt gaacaactcc aattatagca ttcgcaactt tctaagagat tcattgggat    211740
     atgacgggcg aaacgtaatt gaggattccc ccatgatata tggatgtcta atacttccta    211800
     acacagatgg aggactcaaa ttcatgtcga agtcaaagat aatggatgtc aactgcaatt    211860
     gggaaaatat tatgggatat atatatctcg accagaatat gtgagtacga aataaattat    211920
     atcggcacat atggttttat tagtctggga ttagtctctg tggagaccta agaataaata    211980
     aaaattacct gggaagggca tggagaaagc ggaaatgaat atagaggcag gacttatgga    212040
     aagactgagc tcgaagaatt ggaaggatag acaagaagca tataacatgc ttggttcctt    212100
     ctggaaagag ggaagggctg tagagccgga ggttgtccag atgctccaaa gtgagggaaa    212160
     tattcctgca ttggaggcag caatagatgc tcttttaaat gtaaataatc tcaaagtcgg    212220
     cgatgtcaaa aagatttttg gcaacattgg gaactccaag actagtatca aaacaaggat    212280
     cgatgcattg attggcagac tggaagatac cgaagaactt atggatgctt tgtgtgaaat    212340
     tttggattct aagtctccta gaaatgtatc tggggcatta tcggccatct gcaacgttgt    212400
     tagaagtaga ggatgtggct tgaagcccat tggtgaaagg ataggggaag taatggggca    212460
     tgcggacaag ggagtcagaa atgaaggatt caagctatgt atagagcttt acaaaaggaa    212520
     tggagaattg ctcttgccat acctaagtaa tttgaagcca atacagcaga aagagttaat    212580
     ggaagagttc gggaagtgta atcttgttga agagaaggag gataaaaagg agcttgtggg    212640
     tctatctgga gaccttctta aaggagcttc cgatgataac tggaaggtcc gattagaagc    212700
     catgcgtggg atcaaaaaaa tagctagatg tgttgagtac aatagtgagc tgaatagtct    212760
     tctttgtaga agaatagggg atgttaacaa tcaagtattt tatacaactt tggaggttct    212820
     tggagaacta aagcctagga acattgaaat tataaagggg cttgttgaga ggctcaagga    212880
     gaagaaagat gtaacctcgg agaagataaa ggaaatcctt tttaaggttg gggttaggat    212940
     aagtgggagc aatgccgagt ttctagggca taaaaatccc caggttagac taaatttgtt    213000
     agactactca ttgagagatt tgcagaatga caaggaattc atcaagatgg taggaaactg    213060
     ccttcttgat ccggttggag aggtcagaaa caaggcaatg gaagtagttt ctgaaatcca    213120
     caagaagtac ggaaacatat ttgaaggcac ggtcactcat aatgctcttc ctcgaatcaa    213180
     taaaataata ggaaacaata gcaaaaaaga agcaggagat ggaaattctt ccggcctgga    213240
     aaaaaagact acaccagaaa gacgaatgaa gatagaagac cccgatacta gggatagcaa    213300
     agtcttgagg ggaaaaaaga gtacaccttc taaccacaca agagagaatt ctaaagatgt    213360
     ggctttgtct tcccgagaag acgactctgc aagcaagaag aagcattcga aggtgggaat    213420
     ggatgtttta ctcaataaca tcagtaggca aagggccaag ggaagtggaa atagagaaga    213480
     gattttcact cctcagttta tccaaatgat ggacaaaggg ccttttcatc aagtctacga    213540
     cctattcgac agtatagata agacgattgt cagcgatttt ctcatagatt ttcttattca    213600
     atcgaatgct tcagaagcat ttatcaactc gacactctta tcgtttattt ctaataagta    213660
     tattctgaag gagtttgaat gcaaaaagct tgtggagtat cttctatcta acggaatgag    213720
     cgaggagttg gggatgatgg acagggtcta tcctgttaca aagctttttc tggtctacca    213780
     aaagataggc aataaggagg ccaataatga gatactaaag ctagtaagga agtacagaat    213840
     gttccgaggg gacaagaagc aatttattga agggattaag aaaagaggaa aaacagaggt    213900
     tgaagatgcg ataaagggat gcccagactt cctaagcttt gtagatgagc ttgagggaag    213960
     ttttatgtct acaggaaatg aagattgtga tgatgtaaaa atagaaaaga attttgaaaa    214020
     aacatccgat gaggtaggct ctcagaaatc ggaatacata gaaaaggtaa ttgatggaga    214080
     ggaaatagac atggaggttc catccattca cgatgactcc tttgtggttg gagatgccga    214140
     cattgaagct tcttttgagg ccttgagcat acattctgtc tccggagttt tcacaccaaa    214200
     ctcgaagaaa gttagaaagg aagttattcc ccctgaaaag caaagaaggg aggtaagcgg    214260
     tttggagctt gtactagatc atcttattga ctccaatcct ggggtcagcg aagtagcctt    214320
     taaaagactc atgaacatca tagattcaga gattggatct cttttgtctt tttcaaactc    214380
     cattgttagt tctatttcaa ttcagctttt tgatgtactc cacaatcctt ctttttcgga    214440
     cttgattctt caagttttct tcaaactcag ccagaacaag ctcttctgtg ggcagctaag    214500
     aaaagagacc ctgctcagtg ccaacacaga tctcgtaaag ataatgaaaa gacagaatac    214560
     caaggattat aatgcaaagg tatcttctcc aggctttttt tctcgagata cctcgcttat    214620
     aggagaaatt ctgattaatc tttgcctcaa ttccaggccc agtcttgtct tagaagtata    214680
     tttagaaatg ctggtctctt ctaaggaaga aattctgtta aaacttatat ggagacattc    214740
     caagtcgcta aaaatggatg atagagagga gctgtcgaag gttctggatg tattaatgcg    214800
     cttttatgat agcaactatc attctattct ttcagaagac aatgtcaccc tgaagatatt    214860
     acagcttcat ttgaaagaga tggttaaatt ttatagaaaa gatatatacg agtttggaat    214920
     tcgtggtctc gccaaagtat ttgtgggatc tatgatagga aacacagaat ccatacatcg    214980
     gcgagagacc aagaaggttg attccaacta agattggcaa taaaagagca gtttgatata    215040
     tttttggcat ccaagatctt gaaggactga tttcttttct taggagccca ttcccaatga    215100
     atagaagaaa gagagagaga agagaatatt tgctccaaaa agaaagagaa aggtttgaca    215160
     aagaaatgga gggaaaaaag caaaagctag acgaagcatt ggagtccaac acaaaaatcc    215220
     ctcacgacat taaaaaagac gcagctacat tgctgaacga aatgatttac gaagggaaaa    215280
     ttgaggaaga gcatagactt ccaaagataa tggtcactac atcgagaagt ccgagctcgc    215340
     aacttctgca tttctcaaag catctatctc tagtattgaa cggtgaaaat gtcattcgtg    215400
     gacaactatg cgaggaagaa ataagtgact tggcacacaa acatgaatac acatgtgtta    215460
     tcattataca tgagaatagg gggaggccgt ctgctcttgc ggtttcctac tttccgtttg    215520
     ggcctacgat gagattcaca ataatagatc acttcttgac aaggagatcc catcctcttt    215580
     cccctaagat gtactttgtg tgcgacaata tggagggacc cgtcgggata aaaatcaaag    215640
     agaaaatggc gctactattt ccccgatgcg atggagcaaa aagaatagtt agtttagtaa    215700
     acagaaacga cactattgca ttccggcact atttaataga gaagggagat aaaaccactt    215760
     taagcaagag tcttggaatg gaccttagag catatgaaat aagaaaagga actttcgagg    215820
     tggatgggga gtttgaatgg gcttataagc catatatgaa ctcaagaagg acccgggagg    215880
     aaataggacg tgcacccaag gaacaattaa agttatgatt atttgttgat tttggtatgg    215940
     catcctcata aatttgcatt ctcttatatc cctaaatgaa caatgatctt cttcttggac    216000
     agatactccg ggttcctcct atcacaagat gcatggtttt acttataaca atggtatctc    216060
     ttcttgtgta tgtggatgct gtatctccat acagccttta ttattctccc ttgtttctta    216120
     ggaagttcga agtatggaga atattcacat cgttccttta ttttggaaaa ccaacattgg    216180
     acatgttcat gcatgtggtt tttttgtacc gctattctag gatgctcgag gagggatgca    216240
     ttaacacttc cgaatatttc tggttggtat tggtaatatc atctactctt tttgccatat    216300
     cgaacatcta cggtatatcg gcactaggaa catcattttc ttcaactata acatacattt    216360
     ggacaaagag aaatccaaga gccattgttc agatatttgg atttatttcg tttcctgcat    216420
     tctatcttcc atttattctt cctggattca tgctattaac aaggagatca atatctatag    216480
     atgatgtgct aggaatagtt gttgggcatt tgtttcatta tttcaaggat atttatccaa    216540
     gatggggacg cgatattctg aagactccgt gttgggttaa gaaacttttc aaagaacatc    216600
     cttctggctg ctgcaagact cagaagggaa tcaccataag agaagggaga gaaaagtaca    216660
     agagaaacat tgaaaacgga aattttgcta aaaccgatga gaacaatgaa gtgggactca    216720
     tagatgcaac agatcctgaa atcaataaag tagatgatga atatgtagga gaggagagcc    216780
     caagccagag ttgcacagaa tctttaaggg aaaaggattt atccattgca ttctctcaaa    216840
     gaccttcaat agtctcttct acagtgatga cttcctcgat aggacctgaa gaaaattgct    216900
     tgggcgttgt ggaggcttgc agtagcaaag agccggtggc aggaaatgac cccgagagtc    216960
     ggtctaacga agaatgggat gagaaatggg gagagagcga taatgaaagt accggatagg    217020
     gaattaactc tttgccctgg ggaaagccgt acatgtactt ggctaccaag gaatccttga    217080
     tggttatcat cctcatcaaa aaaccctgtt aataaatttt tctggaaagt tgatccatag    217140
     gaagatgtac cacagggcct ttagtagatc ttacaactcc aaagtctcca ttgatagcta    217200
     ttagaatccc acatgttcct ttcttttctc cgtctagcac acagacaagg tcattttttt    217260
     gaggctgaac aaacgaaacc tcagaaaaag aaaaggtctt ttcctttgta ataaacaaag    217320
     catctttgta atcttcaagg attaactctt tttctgaaac ccggatcaga gtacctctgt    217380
     atggattatt ttcttctccg agccagtcca ttccaacatc ttcagaagca taaatactag    217440
     gtgtcttgta ccccggagtc ttgtatccag gtgttctgta tccaggtgtt ttatatcctg    217500
     gagttctgga tacaatcgat tcattgtacc ttaatggcct gcttgatatt tctcggcttg    217560
     gcgtaattat atgatccttt tctacaagca caaacttcat attagaattt aactgaatcc    217620
     tgcatatgct tctatctact tccttgacta taccgctatg acctttatac tctccagaca    217680
     atatttgtac ttctttgtta attaatgggt ctcttcggac cttttttcgt tcaatcccac    217740
     taggcctttc cttttttggg ctagctgtaa ccgggccttt cagatcatca atgttgacct    217800
     ttaactcctc ggtaaagtcc cttatagcaa ttatacagct ctttttgtct atttttacaa    217860
     ccactccatt ctctccctta taggatacca tctcgcctac atcaaaattc ttgacgagcc    217920
     ccgtactctg aatctcaaac ttcccgtctt taccctcaac aacagcaata ctcccattga    217980
     tgcttcgaac aattcctttt actcctataa gctctcctct ggttactcga accttgtctc    218040
     ctacagatat agggcagatt tgctgaaact cctcaagctc ctcgaaagtc ggctccacat    218100
     caaagtcaac actactcttt aaaacatcct tttccaagaa tccatctaca tatgtgtctc    218160
     gcttgtacac atagtatccc ctagacttta tgacacttcc gcttttaaag ttatcggggt    218220
     tgaaaagctt tttttctccg tcaatcctcg gaactgctct tatccttacc atttcctcat    218280
     catactcaat gatcttaaca agatcgttct tgtattttcc ttttcttatc cttccccatt    218340
     ccccacatat cttctgttca tggtacgtca tcgcttcaat catctccttc ggaggaacaa    218400
     cagatacacg gtttctgcta actccccgga gtgactctag tgcatcaata atatgttgct    218460
     tttggaaggc ttctacgtat agatatcctt tcaacccatc tttacagact atactgaata    218520
     tattcttagg atcgttctct acaattttca tcagaatctc tctttcagat cctctcttga    218580
     ctcttacaat aaacaatctt ggggatgtgt ttctaggaac taaatttgcc tgcttaatgc    218640
     catgctcaac agtttcctct tcttcctcgt caatctcctc gtcttcgggt atggatccat    218700
     atttttcttc aagctccttt gtaagcttgg tccaatctct acgaggcacc acagactctt    218760
     gaacctcatc taaatcctca tggctaagct cagagtcttc ttcggatgct tctatgctta    218820
     tgtacttact tccaggcctc tttgccattc aatgagggtt gaacacttaa gacgattaac    218880
     taacagaatc ttcagcccca atggaattga agaagttgaa gaaggcagca aaacttagaa    218940
     acatcgatca gatgatttct cttatagaaa aaataccatc gaagaacgca gcggatgcag    219000
     aaaaattttt gtctgatttc tacaatcatg aggtatctgt agccaatgct gtcttcgaat    219060
     taacatcata ctcaaaaata cataagacaa aggtaaaact tcctctcaaa ggctgtttca    219120
     cccttattat tccaaatcca aaggaacgat ctgctttttg ataataaaac catattccgt    219180
     taattcgtag ataaaagcta tccccggaag aatgagagtg tctatatcga ttccgcataa    219240
     tcctcataaa gatacaacgg cactacaaaa ggaactctta gatataattc caaactctta    219300
     tggtggagat cccgatgaga ggtccgaggt gatcataaga atagttgaag atgtggggcc    219360
     tcagtggata gtttttaagg atgagaagat acagctggtt ctaaagatag tccagtacaa    219420
     atccagagac tatctaaggg tgtccaagcc catttcaaaa gatcatccac ctcaactcat    219480
     tgtaaataac ttcacaacag atataggaat gcaggtagtt gaatttctag ctggtatgtt    219540
     cccattccat ccaagctcta gacaagttgt aaacttcacc gtccagggtg atttcatcta    219600
     cttcagatta tatagatact gttttgggga aaagagtcct attatggaga atgttgggcc    219660
     gcatctgact cttaggctct ggaaaataat agaatacagt ggaaatgaga agaaagtcat    219720
     gaatttcaag aagtttatca aaaactcaag catactatga ggtggaaaag atccagccaa    219780
     ttttgacaga gtggatattc atagaatcta ttctacctgg agggattttt ctacctgctt    219840
     gccgagatca tttatctcat ggcctccttc acttagcttt tcattataaa atctttccat    219900
     ctctatttct tcctccctta gagcttttat cctgctctca tacttatcgt tgaggatcct    219960
     tatggtttcg gtcctgagct tgagatatct agcttctttc attgctccac agtctttttc    220020
     aatgtcgaaa atcttcttcc tataggtatt gtagaacatg tggtttgtct ttgttactag    220080
     ctcgtcaaga tttgtatata taagaaggcg ttggagtctc ttaaagtcat tactctcctc    220140
     aagatctata ttaatgaatc cccaaatata ttttcttcct cgtacaatct ctcccccgtg    220200
     ttcatacatg gtttcgcttg caattactgc aaaaggcatg ttttcaacta tgtctgtaat    220260
     ctcttccgtg agatctccat cgttctcgtt gaagtatggt acaaagaaaa atatgttgtt    220320
     ttctgataag atttgcttta cagactcctt aacgcaagcc aactcgtcag gagtgtacat    220380
     gtccgccttt ggtattattg gtacgagatt acagcactga gaaagctcgt acatgttttt    220440
     tatctcttgg tctgtaagcg tgtcggatgg aagaagataa agacagacat ggattctgtt    220500
     gtccttaaat gttttgtaga ggccttgctc attgtcaaaa tattctctgt tcatggcatt    220560
     tatgtaatct aggactgggc ttatgtctag ctcgtggtat gtcacaatag agatgtctaa    220620
     agaaatatcg ttttcaacaa tctcgtttct tgttactgtg attgtgttcg gccttttctt    220680
     atcaaccaaa ggcgcagcaa atatcgagtt gattagtgtg gatgtgccaa gtcctcttct    220740
     tccaacagcc aatacattta gctcaaatcc cctagccatc gaactttccc ttacttggtc    220800
     tggaacagaa gaaaatccca cacggttctt gatgttaatt gtcccgagat ttctaactat    220860
     agttggtatg tttttcatgt ttgtttgttg tgacatcttt atttatcgct tggattgata    220920
     tggagaaaga acatccctga aaagagagaa aacttcgcaa ggtacaaaga aagagaaacc    220980
     aaatggaaac tcttcagcaa ctatttggcc agaagatggt aagaaactgt aagaagacgt    221040
     attacaaaag taaggtttaa ccaaagagaa gtaaaggtca ttaaaataaa agtttgttta    221100
     tggaatgccc caatggaatt gaataggata aaggaacttc agaaggaaag gaaatggatg    221160
     caattttgta atgcaataat cgattccatg gattcttttc ctttaaacga gctcttggac    221220
     gcttttctag aaagcgcagg gcaaattcat cctagatctt catacgaagt ctttctcgcg    221280
     ttttcggaga gattgaatcc ggaagaaggc ataagagtct tagcacttgg agaagaaact    221340
     ataagaaact ctgttctgta ttctgaaacc ttcgaagtag agaagatgtt tctggaaatg    221400
     aaaagatgcc tacttctaat tgagataggt gaactcaggg ggattgaaaa gaagctattt    221460
     gagtggaaag gttttagaat gccaaagaac gtgagaatta tgtataattt ttttgggttt    221520
     aaattgtacc aaaagattca gaatgttgaa gaagcttttt ctcatctcct aagatatgta    221580
     aacttatcgg ggtctgagga attgatggat tgtcttgtgg agtatgcttt acttagcaaa    221640
     gaatttttca actttacctt aataacatca ctgcctgggt tcgataaaat gaataatagg    221700
     gatctgaagg aaatattctt aatgtttaga gaaggaaatg tagagagact ggaagaaaag    221760
     tatgggaaat ttactgagat ctttggaagt aacgccgacg tagtcaaaga aaaggcctat    221820
     atgatagccc taataaatat atgcttttcg gaggccgaaa agaaagtatc gatcaagaag    221880
     gttgaagagt tgttgaagat accaaacaag atggttatct acatcatctt aaagtccttt    221940
     ggcctggggc ttataagcgg atggattgac ggagagaagg gaattcttta cttcgacagc    222000
     cttattccaa gagcgctaca gaaagaagaa attcagaagc tcaaggaaaa atacgagatc    222060
     tgggaaggaa aagtgcagga aatcgttgct atgctaaaat aactaaatat gttgatcttt    222120
     ttccaaaaac tctatgtttt tgtctactcc tccactaatt attttctcct tgttagccgt    222180
     agtctttaga acattggctg gtcctgctgt ttcaagctgg tagtctggtc ctcccttcat    222240
     tctagatttt ataaaaatac acttctcact cccgactaaa tagtgactgt cgctatagct    222300
     ccccaatgac agggcgttta gccccaatcc gatttcatag gaaccatctt tgcattcaaa    222360
     tactttcttc ccagtcgaaa caaataacga acctccacat gtacacatag aagtaacact    222420
     tgaaggaaaa gcagcgatag cagtgctgtt gcttctctca tcccagagac gtacgctccc    222480
     atccatagaa caactgtaga taaacccgtt gtcgaacatg acatgagtaa ctggaagact    222540
     atgtcctttc atgacagata catcgtttct ggctctaatg tcccaaactc gcacagtaca    222600
     atcggaagat ccactgaaga tccttctatc gtatgtatct agacatagaa cagaagacat    222660
     gtgcccgtaa tactctctta taaattccct gtcgacaaga tcataacact taatcaatcc    222720
     atcgagtaag gcgcaaaaag tatacggatg aatcttgctg aacttgatct cctcacagac    222780
     acttttcaga ggaatagtgg ctaaaagctg ctttgtccct atgtccacga ttcttgttgt    222840
     tccgtccata gacgaagatg caaggagagc atcataagga tctatatcta atgattttat    222900
     ccaactgtta tgaattttta atattgctgt gagtttatat ttcataacaa ggagattaac    222960
     aaaaggccgt tttttcttca gttttgtaac aagtattgta ttctattcaa tggaaaaagg    223020
     acagagaatg gatataagtt tataccacaa agaaaccgca ataagtccgg tgctttcttt    223080
     gatttctcca ctatctgttt ctttataatt ccaaaattct tttttgtagc agagaacttt    223140
     gtccaaaaga ctgttcaggt atcgatagtc aggtttctct aggaattcca gacgtcggac    223200
     atattcgaag aattttataa gatgctcctt tccgcttatc ccatcgcata actcatgaat    223260
     ggatagactt tcttttacct tttgagtttt cgttttctgt ctttttgaca tggaaattcc    223320
     aacttcaacc catggcaatt ctgacttata gagaaggatc aaaagataaa acaaactttc    223380
     aatatcgtct cttctggatt gctccactcc tttatgagtg tttatcgaca tataccagag    223440
     agttcccgaa atacttcttc cccttagctc agggatgtga tctccattgt cctcgaggta    223500
     gggcatagac atgccaaaat ctatgagata tatcttatta ttgtgatcaa acatgatgtt    223560
     ctcaggcttg atatccctat atagtcttcc tctcccgtgt atcaactcga tgatgctaag    223620
     aagcttcttt ccaaggattg tggctgattt ccttgtgaag aattttggat ttctttctag    223680
     gacgtccttc aatgaatatc taaagagagg gaggacaaga aaagccaggc ccttataaaa    223740
     accatagtcc acaagatgcg ggattccatc acaaccctga agctccctat aggcctgtat    223800
     ttcgtcgacc atggctctcc ttcgggttct cgctgtattg ttttctattt ttagtgcata    223860
     agttttatag tccacttttt ttcttacctt atacactgtt ccaaaacctc ctcttccaac    223920
     ttcgtagtgt atgtcgtagc ccattacttc acccctcata ttctgataca gagtattatt    223980
     ttcagatgtc tttttattcc ttatttttgt tgaaaacacg ctgccttggt tgcagaagat    224040
     actggaatgg agaacatttc aaaaatatcc ctaggcttgc catctcggta tgtatgcacg    224100
     gttggagaaa ttgaaacaag atcctgattt ctcaagatat ttgtttttat gaaaaatgaa    224160
     acccacaaac ctcgtaatgg gtgaagctgg ttctgatagt gctgcaatta aaaggataaa    224220
     aaaagaatat gcattgcttg aaaatgataa gagcgatgag aaaaagaagg attcaacatc    224280
     caagtacatc aagatcattc cctttgtttc aggggacttg tttacctggg aagcatacct    224340
     tacggctcca gaagaaagtg tctacaaagg agggattttc aagcttctta taacattttc    224400
     aaacgaatat cctttcaagc ctcccaagat aacattccag acacctatct accatccaaa    224460
     tataaattct tcaggaatga tttgcataga cattctcgga aaagaatggt ctcctgcact    224520
     tacgttgaat agtgtattgt tatctcttct cacccttctt gatgatccaa atgccgatga    224580
     tcccttgatg cccgaggttg cagatatata taaaacgaat aaagaagaat accgactgag    224640
     atgtcaggaa tctgcccgaa aggccatgga gaaccgaaaa taaatacttt tgaaatttgc    224700
     cttaccgtct ttcatcgaag attgggagta tggagtgtat gaatggaaat tagatttcgt    224760
     tttcgatccc taatgccggg gtttaaggat ggaaatgttg tatcaatgga gctggagaac    224820
     tttcaaacat ttaggaagat atctcttaag ttctgtccgt cttttaattt tatagcggga    224880
     cccaacggat ctggaaagag tagtatagcg aatgcaatgg tccttgcgtt tgggggaaca    224940
     cctcggataa taggtagagg aaaaagcata ggagagtatg tgaagtttgg agagaatgaa    225000
     gcaagaataa aagtggttgt atggattgag gggagagaaa ccaagattag tagacatata    225060
     tccaaggata atcaaagcaa atattttatt gatggaaagg catgcagaaa aatggagtac    225120
     gaagaactta taggaagact taaggagaac ataggaaatt tatgtcaatt tcttccccaa    225180
     gagaaggttt cagagtttac aaggctttcc ccagaagatc ttttagtaga attactgcgg    225240
     gcagtggggg aggaagagat tgtggagaaa ttgggaaggt tagaggagtt agaaacagga    225300
     agaaacaagt tgatagatat gcttgactca tgcgtccgaa aaaaagaatg cgtgaaaaga    225360
     gcaatagaag tgctagaaaa agacgttgaa aaggccagtg aaaagaaaag aaaggaggaa    225420
     aggataagaa tgatgtatga aaagcaggac tggattcgct ataagtttta tacggatgaa    225480
     tatgccagca ttaagaaaga tataagttca ttgaagaagc aagttgaaga gaaaaaagaa    225540
     gagagtttga agattgaaaa taaaataatg gagctaagat cgtcagaaat ttacagtgaa    225600
     agcgataggt tatgcaacat tcttggagag tacgatgaaa atttagttca tctggttgaa    225660
     agacttcgaa gtgttcagca ggaaactgaa atactgaagg tagacgaaga atcgctcaaa    225720
     aacaaaaagg agaaaagaac agtaaatgca gaaaggctgg aaaaggagat tttaggtctt    225780
     caagatgaaa tttccaaggt ggaagttcct ccacagcctc caaaactgga cgaggctaga    225840
     attggggttc tagaagagaa aatgtccaac ctaatgagaa taagagggaa aatccagcac    225900
     gagtcttctg agctgaagaa actggtggat gaccttagtc taaaaaagaa gaagttccac    225960
     gagatggatg aaatgaggct tcaaatgctt agaagatatc atgatgacac atacaaggct    226020
     gtatgctggc ttcgagaaaa caaacatcta ttcaaggatg aaataataga gccaccattt    226080
     gttcaactaa ggataaagga tgctagatac tctcttgaag ttgaaaactt tctagggttc    226140
     cagtcgctgt caccgtttat ttgcaagtca ggaaaggact ttgaaacctt tgttcgaatt    226200
     atgaaggatg aaaagaagtg gatgattaat gccattgaag ctatcaagat gaatgaagga    226260
     cttcataaag gagaagaaag tgttcctagg gagacattga aagagttagg ctttgaagga    226320
     gtgctaagtg attttataga atgtagagag gaaattatga attacttgat agtggctggg    226380
     cattttgatc agatccctgt ttcaaaggaa aatgttgatg agggcctagt attcagaaaa    226440
     acgaatgtaa aaaagatggc agcaggagga agatacattg aaatcaagaa gagtagatat    226500
     ggttcagagc atgccattat ttacaatcct ctaaagccac ggaatttgtt ctcggagagc    226560
     ctgtctctcc aagagctgga gactattgaa gaagaattgt caaaaaagaa ctcgacaaga    226620
     cgagagaacg aagaaaagct aagggagatt ttgaaagatg gggaagtcat tgacaaggaa    226680
     cttcagggac tttataaaga aagaagttgg tacaattctc aaatgatgga aataaaaaga    226740
     aaggagacac aaattcgggt cttaaaggga tcaatagaca gaaaagggct tgagctaaaa    226800
     atgcttttgg atgcaaaggg cctggacgag gaagaggacc gaataaagga ggctagaaga    226860
     gtgttagaag ttaaatggaa aaaggaatgt gataagctta gcgaatatct ttcagagaag    226920
     gaatatttcg atgtgtttcg tactgcagcc aagctgttta gagagattac gaacattaag    226980
     aaggatattg aacttttctc ggaatccaag aagacgctag aggaaataag tgaagaatta    227040
     gaaaagaaaa taatcgaaaa aaagaaagag aactttaaac ttaaaaaagc aataggggag    227100
     aagaaggaac ggctcgaaaa gatagagaaa acagaggaat atgataaagc tctgagccta    227160
     cttccaagta caatggatga gcttgatgag gaaataatta aggaaaaggc ccagctaagg    227220
     ttttataata ttgatcataa agctctggga gaatttgaga tcagagaaca ggatgtaaaa    227280
     gatcttgagg aaaatatctc cgagtattct aaggagttgg aacgtactga aaaagaaggg    227340
     acaaatataa ggagcattct tgttagcagg attgaggaaa tggtatccag aatagatgaa    227400
     cagttcaaaa atttatttag aaaggccgga ggagatggga agattgtatt tgttcacgaa    227460
     ggacttgatg cttgcaagtg gaggctcaac ataatggtca aattccgtga aagtgacgat    227520
     tttgaagtct taaactccca cagacagagt gggggtgaaa ggtcggtttc catcatcttg    227580
     tttttgctag ccattcagaa ttatagacct tccccatttc gtcttgtaga tgaaataaac    227640
     caaggaatgg acaaggagaa tgaaaaatta gtccatgaca ttttggttgc acttagtaaa    227700
     gaaggtaaag agcaattttt tatgattaca ccaaaaatag cacccaacct gagctatagt    227760
     cgaaatatga aggtgattgt gctttattct tccccaggct gcggagacca agaagacttt    227820
     gtaaaataca ggttaaaagt acttacatag gagattggta tggtaatgga gtttatatca    227880
     ataaagagta aataaaaaca tgtttatctg ggcttaacac ttatagtttg gttatgtgct    227940
     ttttaagtat gccgttaatt tcctcaacca ttcccttata ctcctttcca ttccatggcc    228000
     caacaacctt aaggccatca ccgtcaaata taaatgattg atcttcgacc tgcaacatta    228060
     cagaaggcct cttcttcacg tctttaggag tcctcctgga gactatccct tcatttttct    228120
     taaggatcac tgctttaccc gtgtagtttc tttcaagccc ctcaataaga gatagaaatg    228180
     gcaacccttt cacttccgtc ggaattaggt caaatgcctc tctcagcctt tgcctcatct    228240
     tctcaagagt ggctctcttt atttcggtta gctctgcggt gacttttttt cgaatatctt    228300
     gcagatgttc ttctttcatg aagggattca tggaaggtat ctaataaaca tctctaggca    228360
     gaacattcta atattgatag cagattgttt tcaccaccct caaaaagaag gttatggaaa    228420
     aggcacccat ccaagcctac atacgtataa agcctgggaa aagtattctg aaatacacag    228480
     accggactgt tttggtatcg aaagaatgtg gagagactgt aaaatatgag tttgacggag    228540
     tttttgggcc tagctccact caagaccagg tatttgagag gttcagatgt attgttccaa    228600
     aacttataaa ggggcataac caaacattat tctgctatgg tagcacagga gcaggaaaaa    228660
     cacacaccat ggttggccat agtaaatccc atggactgat gtacaacctg gtgaaggatg    228720
     tactaacaca tggaggattt ctcgtttcct atatggaaat atacaatgag aaaatttacg    228780
     acttattgga tcccaaggag ctagttctaa gggagtgtaa tggaacaata gtgattccag    228840
     gcctcttcac caagcgtgtt gaaagtatag aggaatttga agagatgttt aggcgaggaa    228900
     ccaaaaacag aactacggca gaaacaaggc tcaataagag tagtagtaga agccatggaa    228960
     tattaagaat aggagttgga gagcacaagc tcaatctaat tgacctagca gggtcggaaa    229020
     ataataggaa aacgggaaac gaaggaatta ggcttacaga atcaaatagc atcaatagaa    229080
     gcctttttgt tctaggaaaa gtcgtaaatg ccattcttaa aggggagaaa agaatacctt    229140
     atagagacag caagctgaca agactactgc aagactccct tgggggaaat agtctctgtt    229200
     atataattgc caatgttgtc ggagatctgt ccagtctggg agactcgata aacactctta    229260
     gctttgcatc gaaatctaga agtattgtaa acgtacttga aactatacct agaaataaga    229320
     gcttgaagaa taaagggaaa ggctcttcca atgctgctga aaggagacct ttatctttaa    229380
     agacaaatat gaagttcaac attcaaagag agaatgatat gattgtgcga aagagggaaa    229440
     aagagaatag ctctaatcaa gaatctttac tttttgggct ttttccaaga gaagccccgg    229500
     gagaaaacgg gaagaaaaga aaaaaggccc agtctaccga taaaaaacag gaggaagata    229560
     gcaggaaatg catttctaaa acagataaaa gcaaacatcc aaaaagttca ggacaaacta    229620
     ccaatgggag ctcattgatt ctaaaaactc ttcttgaaaa gcccgatatt gtattatctc    229680
     cacgcacgaa agaaaaaagc tatagggcat ttctaaaaag agctcaggag cttgaactag    229740
     cccaaaagta tcgattggct cttgaggatt acaaaactat gcaaaagttc tgtgataatg    229800
     acttcatcag acagaaaata gaaaagatag ggattcttct taagaaatct cgaaaaaaac    229860
     ctgaagttcc aaaggaagat gtcttggaaa ttcttaatag gggaaatttc ttcgacataa    229920
     aaaagctacc gaaagttgga gataagagag ctcaagcaat tgtagatttt gtaagcgggg    229980
     ggaatttctt tgaaacactg agcgacttga aactgctgtt cagcgaaaag attgtaaatt    230040
     ctattcttct ttctatagat ggcagataac cttattattg gaaaccatac ttcagaattt    230100
     tatgggcatc acctctcata tcgatttctt aagattccag tcaatataaa tggtctttta    230160
     agtttattct atttttggag actacctttc gcgtttggaa tcaaagtgac gccatcatgg    230220
     ggaatccttt ggttagctcc ttccttgaga gaacttctag tttcgtcctc tcttcctctc    230280
     ttttccgccc gattcttgag gaagtcaaag tcgtcaagcg aaaatccatc aggaaggtct    230340
     tcaaggaatg aagatggtgc tatgttatag tctttactcc gcttaggaga agctgcatct    230400
     aggtttactg aaggcttttc tattattgca gtgctgaata aatcattaca taggccatct    230460
     gttcgatgga gatcatactc cagctgttga tctcctgatg aaaacaattt atccttaatg    230520
     ttgaatgcgg gaaaagcctg ttccaaaaat ccatttttct gtatttcctc gaattgcttg    230580
     tcatatatat ttggagatga ttttggaaca gatggtgcag taggtgtttt tttctgcatt    230640
     tgctggtcga aaaggatatc ctgctgtggc atcgtccttc cctggctgta catcatcccc    230700
     attggcagga ctttattttc tatccccctt aaatatcgcg ggtccacatc tcctcccatt    230760
     cttttgctat tctgccttgt atggcttaca aatccaacca ttccatgagg caacatgcta    230820
     tttcttgtga gattattaat atacttatta tacgtaaata ggtttgtttc ccgtctcaaa    230880
     tccctttcta atgcatcaca aaacaaagcg tcgtgtggga cactatacca gtaaaaaacc    230940
     ttctgcttct tttgagttct tatgcaaccg ttcttgtata gaaactccaa aaactcgctt    231000
     ctaggaccct caagcgttgc atctatcccc ggtttcaagt ttctcagatc agaaaacact    231060
     ccctcctcaa atttttttag acttgtaagg catcttccag cattttggaa cctccaaact    231120
     agtattttca ctatgtctgt ccctgtaatg aagaaatgca tgttccataa tacacaatga    231180
     atataatctc cattcttcag ctgaaacttc ttgattcttt caccgtcccg aaactccttt    231240
     ggggcattgg atagaaactc aaacagttcc ttatcacttt gggcattcat ctttatttgt    231300
     ttattaccat ttgtttttat atccaagaca caaaacaaag aattgtttat cttgtttcat    231360
     atcaatatct ccttatgtca ctgtcctacg ccttctttct gcctcatctt ccatttctcc    231420
     cgttttctaa caacgttata attaaaacct ctaaaatcaa gggttatatt gaaaataagc    231480
     ccttaatact aacaatgcca aaatgcttaa agcaaaatct caatcattaa attttctgaa    231540
     aaggatactt ctactaggcg ttggatataa aagatggcct ttagcctaat ccattggcgt    231600
     taagggatca tcatattctc cttaagagtt tccataatcg gttataatta tcccgccttt    231660
     gctaattgtt taaaaaggac atagctcctt tcagtttcct ttaaccaacc aacaaaaaat    231720
     gcccgtaaat ttgaggagta tatacttgaa tttttagcag taaagtatga gagctctcaa    231780
     atgtacatgt attctttcga tcaagactat tttgtgcata cgagggggct ttgcgctttt    231840
     tgagtttgag gatccgcctg aggacaatct agagagattt aatggtatga ccagcatgaa    231900
     gattttagaa tttataaaag aacagatgga agatatagag caagctgttg atgatatcat    231960
     aaataaaagt gaggaaagga atgaagagga ggaagacgaa gatgaagagg tagatgaaat    232020
     gatggaagac gaagatggtt ttgaaagctc aaaacaaaaa tccatacttt gtgaaaattg    232080
     ttcatgggct acacaaaccc tagaaccttg cgatatttgt aaagagaaaa gaacactaaa    232140
     agaacttgca tacggactag tttgtatagg tgaaacttta gtaagcgggg aagttcaagt    232200
     gtgggaagtc aatgaaaaaa ttcaattttt gatagagtca attcttgtaa aagccattga    232260
     agaagaaaaa caagaagata ccgtgtctat aatgaacata agaacttcac aagcagcggt    232320
     agttcaagcc atagtttttc ttgagtcatt agttgggtct cttgatattt acagttaaaa    232380
     ttaaagggat acatactatg tgtaagtaga tgtatgtatc ctccaaacta cccctttccg    232440
     aatcgaacga tgaaaacaaa aatcaaatct cttgtaatag aaaatcttaa atacaaagtg    232500
     tctaaagacc aggtaataaa aatcctcaag agtgaaaaca tatctttaaa agcatataat    232560
     agcttccttt tcaagatatt gttagaactt aggaatcagt tcgaagttat tggacctaca    232620
     aaaaagttca acgttggtac tttcttggat aaagaattcc ttcagggaga cttattgtta    232680
     gaaaatagaa ggaaaaggga agaagctcaa agaaacgaca ctttgttcga gaaagaaaat    232740
     atcccaacaa aatattatgc caatacaatg catctgtcat atagattact cggtaaaatg    232800
     ataacaaaag acgaggttct agaacggttt aaagaatgtt ctaccatatt ggggttgaac    232860
     agagatattg gagaaaaatg cgcagagcac ttagaggaag ggctgcagac gtacattcta    232920
     agaaccgtga gtaagtgcaa tggaagaacg accgtcccaa atcttaaaac cagtttggaa    232980
     aaatatctac gtttatttaa cggattagat atgttttaga tataatctcc tgtataatac    233040
     ttgaaagtgt tttttcttca aaattacaaa ttccttcgca aaaacagccc atcaatatac    233100
     cttcattgtt actaaatata tgtattagtc cacaagacgc ttcttcctca attcttgttg    233160
     gatccatcac aaaatggcca ttgtcaaaca aagcaactgt tttcgaggtt gggatgctta    233220
     ttttttgttt ttccgtttct ttcagattac ctactatagg aatatcaaga ttttcgagca    233280
     aagcaccaag actgataaaa aataaatcaa aaatgtttcc atcattactt agtatgctga    233340
     actctattct tatgcctatt ttatatggag ctagcaaatc caaaattata gaggaaatgg    233400
     tatttggaat tgcaatttta gaaaattcta tagactcagc agagaattcg tttccatcaa    233460
     agttttcttt gagtatcccg gaagcttcca gggtttcggc agtctccttg aactgtacag    233520
     atacttctat ctcagatagc ccacgtctaa tcttgatgct tccatcactt tgtgctatgt    233580
     ctgtatggac tacgtttgtc cttcttgctt ctccattctt cctcagatcc gcccggagtc    233640
     cgtttgctat cccatttctc acaagcgcca gctcgtccag cccaaaggct tccatgggct    233700
     ttcttgccag ggcttatttc ttcccagact ccctcctaca atctagcttc tcttgatttt    233760
     cgactctgtc tttgcaaacg acttgtctat tctcttccca accatccctc tgctcttgct    233820
     cttccttcca ctaatcatcc gaggaagtgt ttttataact gtaatggcaa tcacaaaaac    233880
     cagaaggaca atggagaatg tgtggagaac tgcaattaca ctacttcctt caaccccggg    233940
     gaaaaaagcc attttgaaag gaagtgtttt ggatgtattt aatagttttt gatgtgtctg    234000
     gcagaggcct attggtcact tctgtgcatg ggcgaccact catcccgcag aggtgccttc    234060
     atccgccgcc aggttgtctg ggatgtaatc ccttggtgca gaagccctgg aaatgggaca    234120
     cctgtggaag acagccttgg actgggcagg ggtgcttgga cagaatctca ggaaggagtt    234180
     tgatggcaac gccaggctca aggatgcatg ctcgcggatt gcaagggagt ggagcgagtg    234240
     gagagaaggg gtggagaaga ccggtgtgtt ctggctcgga cagagggctg gggagatatc    234300
     ggggagagta atgaggcttt cggatgcctc gatgggactt gcactggagg cagcagggat    234360
     tgggagagtg tggcggggac agagggagtt ccagaagaga ctgaacagga tgttcaggat    234420
     tccgcagtac tacggaggga tccggaagag tgagggggaa agcggcagag acaggagggc    234480
     cgggggactg gtccagttca ggcccagcct catgggaatg ggatggagag tttactcttg    234540
     gatcaggcgg ggatttggag tggggtggaa tgacctggac atagaagaga tcgagaatga    234600
     gcagctgagc aggatatttg aagggatgga aggacagggg gagtctgggc catggacgga    234660
     ggagggggcg gcagacattc acagcctgtg gaaggagata gggggttctg ggatgtctgt    234720
     tgtagacatc aggaatgtct cgacggtggg gagtattggg agacggaggc ttgagtctgg    234780
     atttgaagtg gagattgcag gacagaaggg ggggaaatgg accagacatg tgtttgtgat    234840
     gcaggcggtg tttgagcgcg gggcagacgg gagatggagt ctcggcagac tcagatggac    234900
     aagggtagga taggacaaga tggaagaatg cagtttattc attataggca aatatgactt    234960
     tcgggaattt acgctctttg gctctctgtc ttgctgtttt cctcctgagc tggtgctttg    235020
     tgagggcctg tctctttgcc ctgttgagcc tgggcctgag gatgtttggg agcttgtgga    235080
     caggaatccc cttgtactcg tcgaccagct tctcaagaat cttctcgcgg cggatggtga    235140
     gcagacgagc cagattcttc ctggttgtct tgatgtcgtc ctctccgaca tctccactgt    235200
     tcttcttctg gcggagggct gccaggtcgg ccttgatctc cctggccttc tcctcgagct    235260
     gctcaacact cagctgcctg agctcggatg cctcgatctt cattagggct tctggaatgc    235320
     aaagatttga agcaaaatct gcaggggaca aaaacggaca gggagggcgg caaggaacag    235380
     gcgtggtcag agggtcgggg acatggcgac aaagagaatg ttctcgcccc tcagaaacag    235440
     gacgcggcct gcagagttct ggacatcgtg gctttgcagc atcaggttga tgtgctcgtc    235500
     aaacccctcc agagtgcctg tatagacatc gccggtcttt gtttttatct cgaccctctc    235560
     gtttaagtac atcttgagaa agcagaacgg atccagcatc agaagtgcag ggcacggtaa    235620
     aattttctta tggacggcag agcacacggg cggagcagag gcaggattta tggccggggc    235680
     aggcagccct tgatgagata tttggagatg agctgcatat cgaaaacaaa caaactgttc    235740
     cagaagctcc aggacatcaa tccgcagctc aacatcgagg tggaggcata ctcctgcaag    235800
     tcgagcagga agcagagggg acagagggat gtggagaagc ctctccggta cctgcagtct    235860
     gcgctggggc tgcggtttcc agactacgac ttccatgggg agccgtggag gtcgtttgaa    235920
     aggaagacgc tggaggaggt gcttcgggag gtggcatatt cgatcagcac aacacacaag    235980
     aacagcgagg atgtaaagga gtttgtgggg tttctggaga tgattctgga caggtcgatc    236040
     aacacggggt cgtgcttgat attttcgtac aagaaccgga tggggccttt tgaggactgc    236100
     ttctggtact tttcgttcct gctgtttagc aagaggcaga agagagtggt gatgctcaat    236160
     gcatttatga gcagaagcga tgtgtaaata cctgcgggag caggacatta aagttcttaa    236220
     ttgagattga gtgttgtgtg gttt                                           236244
//

If you have problems or comments...

PBIL Back to PBIL home page