(data stored in ACNUC8465 zone)

HOGENOMDNA: ENINT1_2

ID   ENINT1_2; SV 1; linear; genomic DNA; STD; FUN; 175776 BP.
XX
AC   CP001943;
XX
PR   Project:42703;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Encephalitozoon intestinalis ATCC 50506 chromosome II, complete sequence.
XX
KW   .
XX
OS   Encephalitozoon intestinalis ATCC 50506
OC   Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-175776
RA   Corradi N., Pombert J.F., Farinelli L., Didier E.S., Keeling P.J.;
RT   "The complete sequence of the smallest known nuclear genome from the
RT   microsporidian Encephalitozoon intestinalis";
RL   Nat Commun 1(6):10-10(2010).
XX
RN   [2]
RP   1-175776
RA   Corradi N., Pombert J.-F., Farinelli L., Didier E., Keeling P.J.;
RT   ;
RL   Submitted (22-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Botany, University of British Columbia, 3529-6270 University Boulevard,
RL   Vancouver, British Columbia V6T 1Z4, Canada
XX
DR   StrainInfo; 819376; 0.
XX
CC   Linear chromosome is missing portions of the telomeric regions.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..175776
FT                   /organism="Encephalitozoon intestinalis ATCC 50506"
FT                   /chromosome="II"
FT                   /host="Homo sapiens"
FT                   /strain="ATCC 50506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="nasal tissue"
FT                   /db_xref="taxon:876142"
FT                   /culture_collection="ATCC:50506"
FT   gene            <590..>1357
FT                   /locus_tag="Eint_020010"
FT   mRNA            <590..>1357
FT                   /locus_tag="Eint_020010"
FT                   /product="hypothetical protein"
FT   CDS_pept        590..1357
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020010"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU10_1850, ECU02_1570, ECU03_0040"
FT                   /db_xref="InterPro:IPR019081"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5L7"
FT                   /protein_id="ADM11002.1"
FT                   /translation="MNIQKTPKDLFDNKNEEKITKKLHPEYGVYFGALVSILIPAIMIC
FT                   LFEEDTIKKNPFFISLMVGFSFLYSMILNVYTFMKIRKCDWESLETYYYISKFFLLLFS
FT                   IISALSLISIPMGGNFPRNDQKLYTFGFFPCIVSTAYLLFFNLTPKSSPFMGPVTDIFI
FT                   ILLFLTYSIGIWLCVALENSNFSFLIYLGVLFLALIPLKLLKDQYNPCRKDDKASTLQK
FT                   QILFILILITAATIYGLLLFFDLHSLPFFNFND"
FT   gene            complement(<1844..>3895)
FT                   /locus_tag="Eint_020020"
FT   mRNA            complement(<1844..>3895)
FT                   /locus_tag="Eint_020020"
FT                   /product="DnaK-like protein"
FT   CDS_pept        complement(1844..3895)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020020"
FT                   /product="DnaK-like protein"
FT                   /note="similar to ECU02_0100"
FT                   /db_xref="GOA:E0S5L8"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5L8"
FT                   /protein_id="ADM11003.1"
FT                   /translation="MQVRGLLLSLATIFCTGTENADLRESVAVGIDLGTTYSCISVYSP
FT                   SLKDTRFVLSPSGEETYPSVVFFKKLPEGDGKKSKYEAVAGWAGLQMYNSEGNANTYFY
FT                   AFKRGIGIEDLANIDRKVEDIKRNASVPIFVENVGGKKRVAYKIQEPNQSGYESVTPEE
FT                   LSSHVLRMLKDQILKDYKIQGLTITYPAYFDPNQVAATIKAAEMAGLPTPLTWKEPSAA
FT                   AFAHTYDLIRKGITTKEEVDDMNICVFDLGGGTFDVSIVESSGGFMMVPCYEGNNFLGG
FT                   ENVNDNLTKHFAAYIKSTTGFDVMENQNVKLRLRNLVEEMKKDLCDQVRKSPGRKANPL
FT                   ITKNFIYDGEKSVTLELTNEKFNELNEAFYSKIKSIMNSLLSGDGKDNKGYDKNLINRV
FT                   LLVGGSTRIPKVIDIVEEIFGADKIHYEGINADTIVARGAALYTANELNMLSESEQIVT
FT                   ADSVPLSLGICTEEDHFEAIISKGALLPATGTKEFTTAQDNQTKVRIRVALGGLESFKD
FT                   NVHIGDIELGLPGNQPRGVPRIAVTLEINTHGKIYVKAVDLQTDKTADAYFSSAVANMT
FT                   PEEIERFEERVHSEENQELVKKREVVKKLEYALEQAESPKFVEVIPENIKKDALEYVQK
FT                   TRLWLEKHKEIAPRIHIEEKLQEFDNGIKEFLSSAKSGEEKEIGREEL"
FT   gene            complement(<4021..>5058)
FT                   /locus_tag="Eint_020030"
FT   mRNA            complement(<4021..>5058)
FT                   /locus_tag="Eint_020030"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(4021..5058)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0110"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5L9"
FT                   /protein_id="ADM11004.1"
FT                   /translation="MSTCVYIERKQIVLMDLSTIQEARISNILRTTCKLMERLFQMYKC
FT                   GRISREEYMQKLEKLKEVIKLNIDEIEKNAKTIVARKEPVNVLNVFIMEHFEHMGYFDT
FT                   AELMARKFSIGGYSDSDFYKRIYEIRNQVETGSFEDALAFCREHRMELRSIKWEEAISL
FT                   ENDLKVEKFIEMCHAQEFDKALEFINKEFKRVPEQIKSYLPVLVSNSNFRKYPFSRHTK
FT                   TAEQFLRCALKLFRRGPKSRLMQRIEYGMMAYKTYRCIDTENDNCPACCKAFRLREDVP
FT                   FNKHEISILLCRGSGEEMDDSNQPYVFENGFIYGAKYIESSEHICINSKAADNSLRYPR
FT                   LCFIL"
FT   gene            complement(<5144..>6859)
FT                   /locus_tag="Eint_020040"
FT   mRNA            complement(<5144..>6859)
FT                   /locus_tag="Eint_020040"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(5144..6859)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020040"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0120"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M0"
FT                   /protein_id="ADM11005.1"
FT                   /translation="MALMILNGDNRKIFINGEVVYKVGENSIEEYCKKDLVLLRRRKFF
FT                   KIKVAREFDRKYYFLTRKKIFIYENLFEDPAHEVEVPSEKTFDFYVHHGQLFYLVQEMD
FT                   RYLGINEEQEMLFDFEAGTYFWDGVDFYICSNKSLIRFDIVKRRSSEVLRDVNIKYLAV
FT                   KNGMIAYTDDANVLNFLKGKSSLSYHYHARPITGIIITTLESLLVVCSSRKLVRIETKR
FT                   DEKTFLTTFEGDLVDFVQDESNVYILTVFCLLVYDLKVGSTKKQIFSLPNFEYCKSLNG
FT                   FENREEEIPGKEIFEHNIKKTKVKMPYVFQKEDFLFSSKNSIVAVRRDYIFIYDLEKEE
FT                   MQRIAYLEGFDFFYSSGFIIGLEHRREKGRRTAKVYKIESDGLLLIGKYNSVETLATPA
FT                   DMVFSKGKLFLYLDGSLIEVIGPGITKSLINQNIRQIEETKNGIFLLDECGIFRVESEE
FT                   WILREEKITSFRISGDTLFVSLPRDGVLSFEMKDGAAEENLISDSNVMDVFVEDQVILT
FT                   FSRVKDASVLKRYRKDGNSWKKNGEALVDKRPRRIFNKNIYLSITNKLHKVDFS"
FT   gene            complement(<6925..>7794)
FT                   /locus_tag="Eint_020050"
FT   mRNA            complement(<6925..>7794)
FT                   /locus_tag="Eint_020050"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(6925..7794)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020050"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0130"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M1"
FT                   /protein_id="ADM11006.1"
FT                   /translation="MDLVVYLENALENTEKTLQVASLSKEVEDRFKDYRDLIFYQRNID
FT                   SQVEEKEKRIFMELEICKVLRKFHEWILEQSFGYIEAVYAKKKGILESEVGKPIKNIEE
FT                   EHYKKGVSALLSCLYNNTDMAAKLLSFQRSRKYSDHTKNVERKVGCSINRLGLNILKGA
FT                   ERGVEFHSKVMREREDVMLKYEDLKIKNLLGLLKQRFIEHEEAIKEEAISKILLVLSQG
FT                   SVENDIRFVKLIDETLERTEIYESPEIARMSVQFVIAKKYVEDMISLKEQPFFQRYLEQ
FT                   NGRKYEIR"
FT   gene            complement(<7909..>8568)
FT                   /locus_tag="Eint_020060"
FT   mRNA            complement(<7909..>8568)
FT                   /locus_tag="Eint_020060"
FT                   /product="Ran GTPase activating protein"
FT   CDS_pept        complement(7909..8568)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020060"
FT                   /product="Ran GTPase activating protein"
FT                   /note="similar to ECU02_0140"
FT                   /db_xref="GOA:E0S5M2"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M2"
FT                   /protein_id="ADM11007.1"
FT                   /translation="MAEVEKKEEQMGIEAVSGKKEEELQSDTKEETSLGDSKEKIETKK
FT                   TQQSPFLTNTVPRKDNSKGGEEKDKIDVTEVVEKQRKHLEENQSDDVLFKARCKLYYFS
FT                   EETKALEERAEGTMVIGMHTKSNLVKITVFRDQIGRLGCNHFINPRFKAQPHGKVSNGW
FT                   MWMSTEDTVETDAQRKKTQLFVVKFFSEEDFQKFGEEYDLGRSHNEKSLKTKANKG"
FT   gene            complement(<8635..>9351)
FT                   /locus_tag="Eint_020070"
FT   mRNA            complement(<8635..>9351)
FT                   /locus_tag="Eint_020070"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(8635..9351)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020070"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0150"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M3"
FT                   /protein_id="ADM11008.1"
FT                   /translation="MPQVSFRFGNKYILSKECMFGNKHFLILLMGLAICSQGIGIRRVP
FT                   VEVYISEAGRRKFLDKGRSIEDIVGSVAEELEQKMNEHVYADRASTDKRKFHFDWSVSG
FT                   MTSPEIDLDKCGKDTSRFQYDLVQAARDKPGASIILLYTCESEGYSEDFILAGQKTPLV
FT                   IQRKYPECSNDVATFTETEPMKIESIIANALFITAGSPLNDMVEFEEVDNGRDGFKRDI
FT                   RLKTTDFSLFSGGICH"
FT   gene            <9553..>10851
FT                   /locus_tag="Eint_020080"
FT   mRNA            <9553..>10851
FT                   /locus_tag="Eint_020080"
FT                   /product="hypothetical protein"
FT   CDS_pept        9553..10851
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0160"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M4"
FT                   /protein_id="ADM11009.1"
FT                   /translation="MKILLLSPLVLAHVINLVILYEKTGLKEVKEMYHYVVERLLDKFN
FT                   EHLQRRGIRISLMDFLAYDDYLVKPGYQDISIMGGEESLDARIEALNGIPTNVILVASA
FT                   SPEEEREKFIPNSPCTSRFISNMVSNDIVDDELLTKIIYAVLDWMRGLFKVEVPSPVKE
FT                   RSPEVFDKFAKDVTTPEFIENLKQCTKETRDKFEKFIRAMNWDEEKMLSLRMMSEKTDH
FT                   SQNEGVEISSPLKWVLSKSEKKTKDTETDHQCSEENKSKKEHSESSSEDEDSSSKNDKK
FT                   KPTKSHKPKEVPSKRIKKILSRKEESDDFTDLEETDKKERDKEYEKSQGNGSLRYLDKN
FT                   TNLHNMRRLKEDEETLMEEKIREELQKIISHEPHNTKKKFEDSIFTGIPPYSDEEARNG
FT                   PSRILFSSRATPVKGTSRLNRSLSYGRIPYRGG"
FT   gene            <11041..>11688
FT                   /locus_tag="Eint_020090"
FT   mRNA            <11041..>11688
FT                   /locus_tag="Eint_020090"
FT                   /product="hypothetical protein"
FT   CDS_pept        11041..11688
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020090"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M5"
FT                   /protein_id="ADM11010.1"
FT                   /translation="MKSRLLVFACFVFLVYAREPLKIGFLEGIFGKKSSDKETGKGNGG
FT                   GGGPLPPNPDEEEAIRKLRLQALMLGTEVEDLGKIINQQSRELEQRREEEGEKLKNSSQ
FT                   GVIQASENIKSINEESKKGRRKIRRLQKRIKPHTSAIEKIINDEEGGEDRDDDDNDDDD
FT                   DDDDDDDDDDDKKKKKSKKKSKKKNKKKDGKNKPKSGGLRGLLGLGKKGQKD"
FT   gene            <11879..>12274
FT                   /locus_tag="Eint_020100"
FT   mRNA            <11879..>12274
FT                   /locus_tag="Eint_020100"
FT                   /product="hypothetical protein"
FT   CDS_pept        11879..12274
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0180"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M6"
FT                   /protein_id="ADM11011.1"
FT                   /translation="MNLSHENLLEKESVKNAVSRLSGMIVNKGSNLLNGYSKSLYLSKA
FT                   KEEESEEESSKDDSSSDSEEEKDDSEKEEDNESDDDDEDEDEDSSSGSSGGKKDLGKAA
FT                   LEGALTGLGDTPQGKMVNNVRKLFPFG"
FT   gene            <12455..>12877
FT                   /locus_tag="Eint_020110"
FT   mRNA            <12455..>12877
FT                   /locus_tag="Eint_020110"
FT                   /product="hypothetical protein"
FT   CDS_pept        12455..12877
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020110"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0190"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M7"
FT                   /protein_id="ADM11012.1"
FT                   /translation="MKKGIIALCALAVSDAKSLHFPHEKESSKSRKEISRMEASSLISS
FT                   LDKGGYLLPMSSYAKGKDNNSESDSSEGKKEKEKKEKKKKKKKKKKKKKKEKEKEKEEE
FT                   EGEGEKRKKDDSKEDDDEEEEEEKKKKKHKKKKDDD"
FT   gene            complement(<13011..>14798)
FT                   /locus_tag="Eint_020120"
FT   mRNA            complement(<13011..>14798)
FT                   /locus_tag="Eint_020120"
FT                   /product="plasmid maintenance protein"
FT   CDS_pept        complement(13011..14798)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020120"
FT                   /product="plasmid maintenance protein"
FT                   /note="similar to ECU02_0200"
FT                   /db_xref="InterPro:IPR007651"
FT                   /db_xref="InterPro:IPR013209"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M8"
FT                   /protein_id="ADM11013.1"
FT                   /translation="MGIVHKLITSVSGLYNNINPITLSGVNDVIVVEGRDGILRCTEFQ
FT                   LRFGRLYFYGVNNQTVHLFINGKMCDIVMSITSQGELFFEKDTEDDLGMDYDIILEYNK
FT                   KLSTMFDSDDEMILSKRLEQLSLGNASDLSTLNFDFLAKFKEKNFNIEDIEFKKYLRSE
FT                   RAENLKKRMYGQFLHQREYKDSYHDFEKKFVKFGNLINSTEHFDFLIGRYRSVLHLIVG
FT                   LHLYPPFNDKTCDGNTKGCVGASISFSLCYNKKIQESLDHTFNSFLVQEIRNIENLVVR
FT                   VQGCKKCSFRFYLPYDIFCKIFFEIQGSRINKAKRIMKILENEHNKHLGWNIFGTKKII
FT                   KRDVSFSLKLDSEELKMLNLKEGKNQAVFKISGLNKHLEGNIYLWKDDAKIIVSDIDGT
FT                   ITKSDVWGHLYGMIGKDWTHHGVASLYTKIVRNGYKIVYLTARSLGQSFSTKSYLKNVC
FT                   QDGYKLPDGPVILSPDGVFAALYRELIIRRPEDFKIACLKTIQGLFCDSNPFVAGFGNK
FT                   ITDVITYKAMEIPLSRIFTINHKGELYVELVKTLSGTYRTMNDFVDSMFPYLSAKTIPF
FT                   IDHSFSDFSWWSIQNKSHP"
FT   gene            <14961..>15551
FT                   /locus_tag="Eint_020130"
FT   mRNA            <14961..>15551
FT                   /locus_tag="Eint_020130"
FT                   /product="hypothetical protein"
FT   CDS_pept        14961..15551
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0210"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5M9"
FT                   /protein_id="ADM11014.1"
FT                   /translation="MEEDGPRLAKMRQAYKRAIQEILKEKEKIKEILIDPNTSAEDSFF
FT                   LNSSKATNTSRGNPERDTEAISKAIENVFQDLKSRLSSIFKKKLEVNDIENKLNRLDRD
FT                   VLENRTSFRDVTSKEYIKEIFESYLVDTKVKYIDYIEETKKEALERIKILKGELEKATE
FT                   ELRLLRERNVLFDNAYSDMITKFTEAVKNGNNR"
FT   gene            complement(<16026..>16433)
FT                   /locus_tag="Eint_020140"
FT   mRNA            complement(<16026..>16433)
FT                   /locus_tag="Eint_020140"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(16026..16433)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020140"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0220"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N0"
FT                   /protein_id="ADM11015.1"
FT                   /translation="MKNKPGLLPKWLFIYTMSKTIYIFIKYKNHLSISRHLDSGSMHTY
FT                   FALVLGATRLIASRKITMVEFYSSIAASFLAEGLFFVCLGFCGIYPIHRVLVETFLSLF
FT                   TLAWMVFLYPYYLLEDSEPPSKSKEKSVKHQ"
FT   gene            <16479..>17159
FT                   /locus_tag="Eint_020150"
FT   mRNA            <16479..>17159
FT                   /locus_tag="Eint_020150"
FT                   /product="isopentenyl-diphosphate-delta-isomerase II"
FT   CDS_pept        16479..17159
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020150"
FT                   /product="isopentenyl-diphosphate-delta-isomerase II"
FT                   /note="similar to ECU02_0230"
FT                   /db_xref="GOA:E0S5N1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N1"
FT                   /protein_id="ADM11016.1"
FT                   /translation="MDNYNRNVLLVNEEDKIVGIGKALKTHFGRHLMLHRAFSVFLFNS
FT                   RNELLVQRRADEKLLFPGRWTNSVCSHPFVNDLSFTDPILDVKVHAIKRIEHELGIRGI
FT                   SIDNLKFVSRVVYKAAPTEKYGKVLLGNPTTQKIVRFSDPESIHDEPYSSSDFYEWEVD
FT                   YVILCVSDASPCPNPKEVSETKYVSKEEFQKMIAEDFVSPWLDEISKLIDVFDIVKLCF
FT                   PTDF"
FT   gene            complement(<17453..>18682)
FT                   /locus_tag="Eint_020160"
FT   mRNA            complement(<17453..>18682)
FT                   /locus_tag="Eint_020160"
FT                   /product="WD40 repeat-containing protein"
FT   CDS_pept        complement(17453..18682)
FT                   /codon_start=1
FT                   /gene_family="HOG000210082" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020160"
FT                   /product="WD40 repeat-containing protein"
FT                   /note="similar to ECU02_0240"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007287"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N2"
FT                   /protein_id="ADM11017.1"
FT                   /translation="MKINTIYHKPEEICKERKKDVQYVSFSKDETYHPFMREREFVRAL
FT                   NATKIERMLSKPFVAALSYHKEGIHVLTRHPRRSLFASGSFDNQVVLWDMEERSLIERF
FT                   ECHCSIKGLGMDTEGNVYAGQGKQVKKLGSSQAYSCNSEVLGLDIMETLNVGTSGGIEI
FT                   FDIEREFSKQKISTKYPLCISTSPVIKNIIGVGEQGGLSLFDSRVGKIAYSVSVGNKTN
FT                   DISFSPMDGHIFASADEDFCIYLHDIRYLDEPKGIYRGHGNAVVSVSFNPLGTEIASGS
FT                   FDKTIRIFGINERKSRDTYYNRRMHNVFGVEYSHDSQFIVSGSDEGSIRLWKSHASKKL
FT                   GPLSRKEKDAFRYSEVLKEKYKEVHEISRISRHRFLPKPLKNTLKRIHESYEGAERRRK
FT                   AREESNQDNL"
FT   gene            <18731..>19474
FT                   /locus_tag="Eint_020170"
FT   mRNA            <18731..>19474
FT                   /locus_tag="Eint_020170"
FT                   /product="putative polyadenylate-binding-like RNA-binding
FT                   protein"
FT   CDS_pept        18731..19474
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020170"
FT                   /product="putative polyadenylate-binding-like RNA-binding
FT                   protein"
FT                   /note="similar to ECU02_0250"
FT                   /db_xref="GOA:E0S5N3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N3"
FT                   /protein_id="ADM11018.1"
FT                   /translation="MTCKLFVSNFPESYSEESIGLIFSPFGEIKSIKILREPRLFSIVE
FT                   FQELQDAKAAIDSLNGRKLHSQGLLLHVEMAFERRKRVVVSGIPPDSSKEELQRFFEYY
FT                   GSVENITHSDAMRTVFIDFSSHEDAESFLELNQKISFGKERDKLSIKPFTKKECKDNTS
FT                   SPERSLFIYNLPAKITKTDLDGLFARFGEVKSLGVLSGGKAFVNYERELSALKAIRHMD
FT                   GKNVGGKKIRIILKSMKKGLFRGPI"
FT   gene            complement(<19561..>20583)
FT                   /locus_tag="Eint_020180"
FT   mRNA            complement(<19561..>20583)
FT                   /locus_tag="Eint_020180"
FT                   /product="GATA zinc finger transcription factor 3"
FT   CDS_pept        complement(19561..20583)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020180"
FT                   /product="GATA zinc finger transcription factor 3"
FT                   /note="similar to ECU02_0260"
FT                   /db_xref="GOA:E0S5N4"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N4"
FT                   /protein_id="ADM11019.1"
FT                   /translation="MGCVNKESGGQKQIEDTWTKDFRDEEQKKSFHKDDMNVEMEDIKG
FT                   YDKKAFDVEELRHGGEDPCNSSLQSLNETNNYTTNAQISQNLDRFNDRKGKYQELISEY
FT                   GSMEMPKIAKELKRKAKQRICSNCATTSTPSWRRGDQGKSLLCNACGLYQKLHGRTRPY
FT                   TITAGGRTKALKGGHERIVCVSCNISFFTSESKNTPGYLCDGCLSYAKSRRGHPRSNEE
FT                   RDCQSEFNEKILSNRYSRFYTREIPDQYNVPYHYVEKGEIDNGFRSYSSASIVYPQSYG
FT                   YYYLNEKHHTPPRFGEYEAPFPKKGLDSGFKSAYPGEMIGESDNGMDSCDPNVNTPAGI
FT                   "
FT   gene            <20850..>21947
FT                   /locus_tag="Eint_020190"
FT   mRNA            <20850..>21947
FT                   /locus_tag="Eint_020190"
FT                   /product="hypothetical protein"
FT   CDS_pept        20850..21947
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020190"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0270"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N5"
FT                   /protein_id="ADM11020.1"
FT                   /translation="MGNKKDKEMVRCELENYVAVEIKNTSPNARQVDAIQKMISLPERN
FT                   FDELVSDIVNEMRRRSNALSTTPETPMQRKLSRIHEDGFKSLILDLLLVMNQRSPEKGC
FT                   SSENVHGLIDNLDKLISELKEDMMNEDKMVQDIYSSRNISEKLIMFIEYTRNVFGRNEE
FT                   DVKIHEYMTKEVREYFDSQATDGPDLMAGVDVFLKKCDKSKYSNHPEYKYHRDNIQKLE
FT                   SMELEQEVKRNLIKSEVSQIYSIFVAENTSLKSAGEKQLELKVHGLVDILSKIKYEAEE
FT                   RRSVDAYDYLEEVINSSKDILELIESMKLKRNTHLDLLRAKIAALEQIHNRNGNEEPLF
FT                   AMFSTIEAVKKALMDISNNQNQGNA"
FT   gene            complement(<22026..>22436)
FT                   /locus_tag="Eint_020200"
FT   mRNA            complement(<22026..>22436)
FT                   /locus_tag="Eint_020200"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(22026..22436)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020200"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0280"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N6"
FT                   /protein_id="ADM11021.1"
FT                   /translation="MIYIYFFLAEIFCNGSILMSEVNSKTDTFRFNNMILNIEKSGAFE
FT                   KNTNKEFNRPGYVVRGEERKFQIEFFTSMSNLEVSKVSPFKIKVLYNSKNRSANDTYLE
FT                   ISVKNLPIKNFKIFDFYELGKARLSSKLDIKI"
FT   gene            <22587..>23504
FT                   /locus_tag="Eint_020210"
FT   mRNA            <22587..>23504
FT                   /locus_tag="Eint_020210"
FT                   /product="DNA replication factor C small subunit"
FT   CDS_pept        22587..23504
FT                   /codon_start=1
FT                   /gene_family="HOG000224152" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020210"
FT                   /product="DNA replication factor C small subunit"
FT                   /note="similar to ECU02_0290"
FT                   /db_xref="GOA:E0S5N7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N7"
FT                   /protein_id="ADM11022.1"
FT                   /translation="MQQPWTEKYRPESLQQVVGNREIVAALKSISSTNKIPNMLFYGPP
FT                   GTGKTTSIRAIANNLPRSCVLELNASDERGIATVRETIKEFASTYSKTTKLVILDEADM
FT                   MSRDAQNALRRIIEDFSANARFCLIANHSRKIIPPILSRCTKFRFGPIEDTESRIKEIC
FT                   KKENIKYSEEGIKGIAEISEGDMRKAVNDVQGISVSLGPISLENVRKFNGVAPIDVYEE
FT                   LFENLKTMSMADLRVKCEELKYEHGMDSDDLLKNLSKMVRKSNMKEKMRILKEMGDIEY
FT                   RRSIGCSEKVQTDAIISVFLLNRG"
FT   gene            complement(<23558..>24565)
FT                   /locus_tag="Eint_020220"
FT   mRNA            complement(<23558..>24565)
FT                   /locus_tag="Eint_020220"
FT                   /product="DnaJ-like N-terminal domain-containing protein"
FT   CDS_pept        complement(23558..24565)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020220"
FT                   /product="DnaJ-like N-terminal domain-containing protein"
FT                   /note="similar to ECU02_0300"
FT                   /db_xref="GOA:E0S5N8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N8"
FT                   /protein_id="ADM11023.1"
FT                   /translation="MSLYDVLKVPKNATKESVEKSYRFLVRTYFQNKSEISPDKFAEIN
FT                   KAYTILKDRYKRDFYDIFGEVSVQLLLHNKDSYIVTRMFDRLNICFYLVTFAIYLGTLL
FT                   ALPPMIAHGEYNSIAMSLPFGVSAITLTIPMIRSLSALYWIYGMGAELKSMIFRSMEII
FT                   GATLHLFNYASYVDGLINTSFSGALFLGIEGLSTVNTIYYHSNKYKLFFETKKNIMMGK
FT                   LIRAILFGLVMVPAIPVFLKPFLLLMQILWGICGKKYSLKINACMLLLPLLYIATLSLV
FT                   LAGFRSILIYLPLWIFGSIIMIVLALIASNIVNNIPKSKYDVREAEALPYYDIL"
FT   gene            <24638..>24952
FT                   /locus_tag="Eint_020230"
FT   mRNA            <24638..>24952
FT                   /locus_tag="Eint_020230"
FT                   /product="U1-like Zn-finger-containing protein"
FT   CDS_pept        24638..24952
FT                   /codon_start=1
FT                   /gene_family="HOG000216641" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020230"
FT                   /product="U1-like Zn-finger-containing protein"
FT                   /note="similar to ECU02_0310"
FT                   /db_xref="GOA:E0S5N9"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5N9"
FT                   /protein_id="ADM11024.1"
FT                   /translation="MPRSDTKKSKRRKNRNRLKTKRAQEFGPKGIDQVKEQIEGQKEID
FT                   YDPELPGHGRFYCYECDRHFISEKVLIEHRRSGTHKKRVRDMREIPHSQKDAEWAVGLI
FT                   "
FT   gene            complement(<24997..>26502)
FT                   /locus_tag="Eint_020240"
FT   mRNA            complement(<24997..>26502)
FT                   /locus_tag="Eint_020240"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(24997..26502)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020240"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0320"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P0"
FT                   /protein_id="ADM11025.1"
FT                   /translation="MQEDEARGVLFILNESLVNEGGLSGEHEESLEKIISLTDEDPSLL
FT                   SLLDDWKFIERNFPYLIRNSKDRQKAFGLAIKILQLPNSRLPVLFMTRKGGFLLSEILY
FT                   ESMESPQYVISFCCEAIKKSSLFPGVLYDCGFFILLNSLVSSETARLYSLIFEYKVYEA
FT                   RGKYEEDRGEGIMHEIKRRHFDSEVVFKDKMHFTFRKPSSLHKVGQPVLKNIFDDIYNT
FT                   TFFDLLDLGLDKNLHLMNYCEWDYLFLCGSSGLKELVNSGSYLAIRLYRKMLESLGKSS
FT                   KAILYLDKIEDSDLMIHVAKLLECKDTNIVMECGLVLYNYYYLFDWNLDKKQFNENKIR
FT                   KIFSLLEYSYVDCSCFQECAYSQSDCSVGGLREDEWMGKCFQDCNTAKILRLLSNIYSF
FT                   VDKRYFYKPSFLVLMKTWRDVFERHRCWNSAFFTTFFEDMVLFLRSNSYNIARIIFPFK
FT                   RTRRKASNDVDEEGDKENSINLSILEGDGDIGWLEIEGLDELK"
FT   gene            complement(<26593..>29511)
FT                   /locus_tag="Eint_020250"
FT   mRNA            complement(<26593..>29511)
FT                   /locus_tag="Eint_020250"
FT                   /product="P-ATPase-V"
FT   CDS_pept        complement(26593..29511)
FT                   /codon_start=1
FT                   /gene_family="HOG000199432" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020250"
FT                   /product="P-ATPase-V"
FT                   /note="similar to ECU02_0330"
FT                   /db_xref="GOA:E0S5P1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P1"
FT                   /protein_id="ADM11026.1"
FT                   /translation="MYNIYKEKPFYKRAYVAPLYFLPVLALKSNYPQVVIVFTLLLSGT
FT                   MFLSTFWSDRVHILFSMDLNTEGDYIQYLGSLCKLSDGAFEFEKSGYLLTGEKIVRLRA
FT                   DTKRPFEYYEKWQERKEEFVESGLLKHFKKNRFDIVPPSFFQLFLQHAVSPLFVFQVFS
FT                   GLLWCLDEYVYQAIFSLVMLVVLESGLVFQRMVTARHFKKMSHAKVNVEVLYDSRSCRK
FT                   SEDKTVSSEDLFPGDVIRIKSTMSVPCDLLLVKGSCAVNEAMLSGESVPLAKEDISERN
FT                   PKDTFDRSKDKKHILYAGTEIVMIKDSPLVCFVLHTGFETEKGGLVRKMMCTEEVTVND
FT                   REAFIFIFALLVFAIIASFYAYKEGKKMGKSNYKLLLEVILILTNVVPTELPMELSMAV
FT                   NSCVRALIQKGVYCLEPFRIPYAGKVNVCCFDKTGTLTETVMEVAGIKHETENSTDVLS
FT                   SCHSLLLLEGKVTGDPLETSTYEYLKNKKSLGSKCFEYQVLKTYSFCSELKRMTVVVEK
FT                   EGKRFVGMKGAPEVVKEYLSSVPDFYDDYKEYAADGYRVLALGFKPTSKQDKYVRKDME
FT                   SGLSFAGFVLFDCKLKKDVRETIEALHISGHKVIMITGDNVLTARNVSKKIGISTKAVE
FT                   GAEIDKVLESDEFPSISIFARADPIHKEKIIEKYNKMGKYTLMCGDGTNDVGALKSAHV
FT                   GIALMEAPVIVRKEKKEKTKEENIMESLSKDIGEEKINLGDASVAAPFTAKTGSLDSVL
FT                   DIIRQGRSALVTTIQMYKILALNSLVSAFSLSVLDCMGVRYGDVQLTVSGLLIGFAFMF
FT                   LTQSQPLKEISKKRPLTNIINSYIISSVVLQVIVHIASFFIMIRRIRDVETPVYNEKFS
FT                   PSLMNSALFFLSTTQQISTFLVNYIGRPFRESLVENKKLLGCLTILLLFIHQLVMGNND
FT                   ELRAKMEIVDMGNVKVFVYSVLVMDIVLCYLVEKTCFYMFML"
FT   gene            <29575..>30195
FT                   /locus_tag="Eint_020260"
FT   mRNA            <29575..>30195
FT                   /locus_tag="Eint_020260"
FT                   /product="20S proteasome subunit"
FT   CDS_pept        29575..30195
FT                   /codon_start=1
FT                   /gene_family="HOG000090523" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020260"
FT                   /product="20S proteasome subunit"
FT                   /note="similar to ECU02_0340"
FT                   /db_xref="GOA:E0S5P2"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P2"
FT                   /protein_id="ADM11027.1"
FT                   /translation="MSADIETFYGGSILAIASDEAVAIMNDKRLGMSSITVSKDFTRIH
FT                   KIGPRLYVGLPVFVPDTQVLLRSIRKNYNLFKLEEQREMEPEELTSMISFLLYSKREAP
FT                   YITSPIVAGLRSDGKPYISGMDSIGSITSPRDFVAAGTSEENLMGICEALYRPGMDEEN
FT                   LFVTCTQAFLNSIDRDALSGWGADCYIISRNKVTKRPIKGRCD"
FT   gene            <30265..>31107
FT                   /locus_tag="Eint_020270"
FT   mRNA            <30265..>31107
FT                   /locus_tag="Eint_020270"
FT                   /product="hypothetical protein"
FT   CDS_pept        30265..31107
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020270"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0350"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P3"
FT                   /protein_id="ADM11028.1"
FT                   /translation="MPRLGRILMYALIFIFRSYDVPSLCYNYYDPESCYQQEFLKPSPI
FT                   PTVYQVVPRKYFVYVSGVCDFIVSRLINSEKYFIYSSLLPADAISMENLLLVMLEKGYR
FT                   DIAGFFLANLSIFYVPILTASNLYVLSYLYPAYKKDYENAHKPSLSITWFFHLNIFSQY
FT                   SRYFYDMFYVLMIYLFSIVPEEQKMEIILLFKPSNYKSYLLYMAESPLFHFYTLIFVLE
FT                   NYVQLLFRIYGIGNPNFLNWSYLAFTCLFIFERRWIMLMKEPYKNKDQEKASGCSHQL"
FT   gene            complement(<31104..>31481)
FT                   /locus_tag="Eint_020280"
FT   mRNA            complement(<31104..>31481)
FT                   /locus_tag="Eint_020280"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(31104..31481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020280"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P4"
FT                   /protein_id="ADM11029.1"
FT                   /translation="MILCCRYEFSGKFEKFTLEKDRSPKICVQQDKRRQPKNLRRSLKA
FT                   RKKPLQPQMSRITPMRTPTAPAIPGLVLMIVPMKILDTPVLTMTCLKMMTILMTWMRTA
FT                   VSMRSPARNKVLLKTATLLLF"
FT   gene            complement(<31523..>32350)
FT                   /locus_tag="Eint_020290"
FT   mRNA            complement(<31523..>32350)
FT                   /locus_tag="Eint_020290"
FT                   /product="transcription factor"
FT                   /note="involved in TATA site selection and in elongation by
FT                   RNA polymerase II"
FT   CDS_pept        complement(31523..32350)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020290"
FT                   /product="transcription factor"
FT                   /note="involved in TATA site selection and in elongation by
FT                   RNA polymerase II; similar to ECU02_0360"
FT                   /db_xref="GOA:E0S5P5"
FT                   /db_xref="InterPro:IPR004343"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P5"
FT                   /protein_id="ADM11030.1"
FT                   /translation="MRDGYKSSGHVNFDREELYESEEDRKALLEMPETKREEILYRRHV
FT                   ELQKFKEKKELEEKTQGLKRKVPSADKKSTSDIDDFSEFSLCIVNRDMIARNVFKPFFD
FT                   EFVGHFTRARINGLYLVVKIVGVSKGEVYSLRIDRKEVKTNRYLEISTGTRTYKNFRIE
FT                   NISNSPLLREEYEDVWRSFKIGPMSKVKEGYEKLVKTMNRALSDEEISKMVTCKDEVYP
FT                   KRRGVTHLKIELIQKRDRAIEVKDKKMAIEYQKMIEEIEDRERTREEDVNERH"
FT   gene            <32421..>33443
FT                   /locus_tag="Eint_020300"
FT   mRNA            <32421..>33443
FT                   /locus_tag="Eint_020300"
FT                   /product="hypothetical protein"
FT   CDS_pept        32421..33443
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020300"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0370"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P6"
FT                   /protein_id="ADM11031.1"
FT                   /translation="MVLLAKKKTYICLHVLNTIILTAISAIHEKRSSLRNLQDKIEVRK
FT                   SIIDQKVYTKLFTKIAEGNYIVVQRDSKLLKYLGNTNPLSDLYLIGKYGIPKHISLEDI
FT                   PYLETEARYFFIEIKDIPIHRIFVKQNLHSFMYIKGFNLGPDKDEIDQMVKISQECLRA
FT                   FDRIGNIEMAAKDMIVKIRKVNPFELFINHSEGFTIMKSIFNHRNEFLEDLKVHFVKFM
FT                   SSIFFGMKTSSFCDAYVKSIISYLERENILAIAPSIKEYPELIHRLFPYKIISTSPNIL
FT                   HEELIVGGISLDGILQDKYLRELFNLGKIKEITRGGSRFIFTGHISIDNQKGKYNVSFV
FT                   "
FT   gene            complement(<33468..>34190)
FT                   /locus_tag="Eint_020310"
FT   mRNA            complement(<33468..>34190)
FT                   /locus_tag="Eint_020310"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(33468..34190)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020310"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0380"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P7"
FT                   /protein_id="ADM11032.1"
FT                   /translation="MNIKELIVRVLENRDIEAVGEMQYTEGDGEDLHELSTSDLLNCTS
FT                   PYIRGVVNDKVGNKYEGLKLFKEYCEDCEYLKLVEEETIELCRTSGRDNKIKLWRKIRE
FT                   FRYDFIDWEDREWIMRLLEYFYIMSMKNIEHLNREIMLLQEKKDKESYKKKGIECIKVD
FT                   SQGRISDFLARRNSPTMTLDEFAEKIMLGMEKGPSTSSREEEPEDSSSNNLSREELLKR
FT                   DEERDEKEINRGNTTRMG"
FT   gene            complement(<34273..>35853)
FT                   /locus_tag="Eint_020320"
FT   mRNA            complement(<34273..>35853)
FT                   /locus_tag="Eint_020320"
FT                   /product="M2 dsRNA satellite propagation-like protein"
FT   CDS_pept        complement(34273..35853)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020320"
FT                   /product="M2 dsRNA satellite propagation-like protein"
FT                   /note="similar to ECU02_0390"
FT                   /db_xref="GOA:E0S5P8"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P8"
FT                   /protein_id="ADM11033.1"
FT                   /translation="MPIRGLEEVRKHPGQNFFLKVPQKAFKKMRICIDGNWFLRKYVDV
FT                   PSICKGLVLGTEDAIKEPLLRLLEFRDENEVDLIWVWDGMGFNRQQGALSGNSDALLNE
FT                   GLREYKQENYRKAGKLWRNFITQKNEMDIANKILEENGVVVITAPYSATAQCAYFMSAE
FT                   ACSYVFGKSDVLLFDGVDKIILDMSDGSGKPCLDVFHKSRFLEFFNLSPKMFAALGLLL
FT                   GCDFCPTMPKCATDFSFNAVFSLIKESDDLLKMIKNTCDEGSGKKYTDQFLRGLMLVTY
FT                   LPVMKILGCVQPYSEDHVPRNLEKLVGAKLAPGFYESLFMNRISRDILQIMGKIKNVDK
FT                   DPQFIKLVESSLSRVRNEGQKEKESGKGLGSEESFGHVIHPDMTLTKDIDPSVGILLLM
FT                   SIEVGELEAPFVPKILCFHRQVSNEEKLNINGPTLRYYVSAIRLLNCAKEIKEVYEVVL
FT                   NKNLSELFSQGLSLFSASFHEEFGFSGDVGESNYKFLLNVRDFLRANERLFSMIPDIVK
FT                   EIESTLNEK"
FT   gene            complement(<35953..>36567)
FT                   /locus_tag="Eint_020330"
FT   mRNA            complement(<35953..>36567)
FT                   /locus_tag="Eint_020330"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(35953..36567)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020330"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0400"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5P9"
FT                   /protein_id="ADM11034.1"
FT                   /translation="MYTTIVESVQKTSSFFRLLFSPSQAEMKIFKPNKKGFFECLAAAV
FT                   VYMLQSSNPDSLSIAEVDISGKPHKCVFIDHGSFGRLSKGNWVVIVDVRGDGFYSHVAR
FT                   KISNLCDVAVLRVSSWKDAVVAVKLPLNIPKETIYLKHSMNRYISGREVAIDNAVDIYL
FT                   LSKLLWMRKHIRKIILSRFCMYMSFVEIMFFVIGKLLSLGW"
FT   gene            <36641..>37279
FT                   /locus_tag="Eint_020340"
FT   mRNA            <36641..>37279
FT                   /locus_tag="Eint_020340"
FT                   /product="Rho Ras-like GTP-binding protein"
FT   CDS_pept        36641..37279
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020340"
FT                   /product="Rho Ras-like GTP-binding protein"
FT                   /note="similar to ECU02_0410"
FT                   /db_xref="GOA:E0S5Q0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q0"
FT                   /protein_id="ADM11035.1"
FT                   /translation="MVEGATADVSKQLTIIGSATCGKTSILTRHVKRTFGTEISPTVFN
FT                   SVSNTYKHKNNVVELRLWDTAGQDEYARFRHLALPSADYIMIVYAIDDRSSYAEVKNSL
FT                   IGQVKEKAPQAKYFLVGAKVDLREDSKRLEELARNGNSPITTSEGLELSQSIGALGYFE
FT                   CSAKNNIGIDEIFEKISSYALKVYLRENKSFMGRILTSLWNFLCCRKIN"
FT   gene            <37310..>37861
FT                   /locus_tag="Eint_020350"
FT   mRNA            <37310..>37861
FT                   /locus_tag="Eint_020350"
FT                   /product="hypothetical protein"
FT   CDS_pept        37310..37861
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020350"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0420"
FT                   /db_xref="GOA:E0S5Q1"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q1"
FT                   /protein_id="ADM11036.1"
FT                   /translation="MKLEKVDANWTRTEDEVLKAGVMKYGINKWSKVSSMLPSKTPSQC
FT                   RLRWLEYVSPLVNDLVWSSEEDEKLILMAKTFLPQWSLIGQTMGRSGQQCYERYNELVF
FT                   GKISVFKYGELSGPCEGKDEEILKMASARMSECKSRKGLKKKALLDKKEKTLSRSCEAK
FT                   EGTIGPHKQRVCRKNDGTLQ"
FT   gene            <38155..>39660
FT                   /locus_tag="Eint_020360"
FT   mRNA            <38155..>39660
FT                   /locus_tag="Eint_020360"
FT                   /product="Sec1-like syntaxin-binding protein"
FT   CDS_pept        38155..39660
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020360"
FT                   /product="Sec1-like syntaxin-binding protein"
FT                   /note="similar to ECU02_0430"
FT                   /db_xref="GOA:E0S5Q2"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q2"
FT                   /protein_id="ADM11037.1"
FT                   /translation="MLECIVLKMDILDLLKKKIIEDVFEVYPDAEWSVLVYDSYGASIL
FT                   KNFFVKSEFISHNIVTSQRIEEQRERVDFPVIYFVRGEESIVKMINRDFENRLYPSYAV
FT                   CALEECEGLQPPIKVKKVDVDFLPFEQRVFKATAKQLYSVAKTLNTVFNVSYSGSVCRG
FT                   LAEIVEKTMGSEERKGELIILDRSIDLFTPFLHFFTFRTLLEDLSVENMEEFEKKYMRD
FT                   KVWESVKNAHLGEVNSILRNQAQILSKVAQRLDTKVDNKDLMKMVLEAPAAAKTKESLS
FT                   KILGLAQKCYDQFDYLSRFNEIEQLLATGYDKSGSKWKMKVEDVFEYLRSSGIERSDKI
FT                   RILLLLKANGYQLQDNEVNLLKGMGFEDSEIEISFENHESFVPLRGSGNHKYEVSRYEP
FT                   VLGNVLRSFIGKQKGHLQINRLTSSRSHLKSLRKTHLLSVKKDISYQKLYCVYITGGIT
FT                   FEEIRVAYEISESLGVEIIVGSEDIITPKSYVEYLKSKCMSKS"
FT   gene            <39694..>40233
FT                   /locus_tag="Eint_020370"
FT   mRNA            <39694..>40233
FT                   /locus_tag="Eint_020370"
FT                   /product="glutathione peroxidase"
FT   CDS_pept        39694..40233
FT                   /codon_start=1
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020370"
FT                   /product="glutathione peroxidase"
FT                   /note="similar to ECU02_0440"
FT                   /db_xref="GOA:E0S5Q3"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q3"
FT                   /protein_id="ADM11038.1"
FT                   /translation="MDQNLESQTFYNLSARGWNGEEVNFSVFRGCVLIIVNVASSCKLA
FT                   EGNYKSFVGLLEKFYKKNLRILLFPCNQYLGQEPKPIERIHREVSEKYSDKFEVMDKVE
FT                   VFGENAHPVFKHLTSTKNGKGTFGNFIKWNFTKFLVDRSGHVVKRFGPSNIIKEDEECL
FT                   LNIIGDEGEEQSPLMG"
FT   gene            <40258..>40599
FT                   /locus_tag="Eint_020380"
FT   mRNA            <40258..>40599
FT                   /locus_tag="Eint_020380"
FT                   /product="transcription initiation factor IIA subunit
FT                   gamma"
FT   CDS_pept        40258..40599
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020380"
FT                   /product="transcription initiation factor IIA subunit
FT                   gamma"
FT                   /note="similar to ECU02_0450"
FT                   /db_xref="GOA:E0S5Q4"
FT                   /db_xref="InterPro:IPR003194"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR015871"
FT                   /db_xref="InterPro:IPR015872"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q4"
FT                   /protein_id="ADM11039.1"
FT                   /translation="MYEFYRQLMVGKALEKIIDEKVNSNMLSPNQGKYILEAFDLSVPV
FT                   VFNKSVTNSMSFKGKVDFYNHVDGVWRFQTKDFVMSLNNEYFSGGDVNIVACDADINMD
FT                   AGRRRRRRG"
FT   gene            <40703..>42565
FT                   /locus_tag="Eint_020390"
FT   mRNA            <40703..>42565
FT                   /locus_tag="Eint_020390"
FT                   /product="nucleoporin autopeptidase"
FT   CDS_pept        40703..42565
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020390"
FT                   /product="nucleoporin autopeptidase"
FT                   /note="similar to ECU02_0460"
FT                   /db_xref="GOA:E0S5Q5"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q5"
FT                   /protein_id="ADM11040.1"
FT                   /translation="MEKKALKMDQNNNMNKFFNSSFFAQTPQKDNKPGQFSGIQQPSIF
FT                   GQTQSGFSGAQNPFLQGSGGMKSNTFGTSTPFGGTSTFGGATSNSGGFGQPFSTQQPST
FT                   SLTRFGTGGTLGTGNNIFGGTANTIGTNPTQFGGSGNTSTFGTQQQVNNNTFGSGVPNS
FT                   LQPFSMGASTATQPSIWGQQTTSYNPFGSSQNSSFSNDRSNALGKGFPGLGGGNSGTRD
FT                   HPYMQRKIREDNGGEVTLMHINGNEGYTQKSVDELRAEDYILGRKPPTGSSLAEPKSIP
FT                   GFGSSFGGPVPSSIDSKPQSSNIFGATPSNNSFQPFISTGNSKVLQGPTNPGFGNTVAQ
FT                   QPFASQAISQSTPSQPFGTAAQALPSTNSNPFLQTPQQPQSLFGSAGTSPQTPASGGLS
FT                   FMQPPTAPVQQPFGGGMASLGTCGQQNTQQTKIDPSDPFLLKDIKFEKTEKEHLPLSKV
FT                   LPKPMFKEDLKPQKISLKFRPPKPPAKEKIYTIPPIEDIKHMKEVHNLIIGFEDKGRIE
FT                   YLDTVNGSDVTMANIQSKIYFSKESVVVNDPVGVGLNRRARVYVEGVFPYSRSLGDYVR
FT                   GEQKQFPLKGIQERFLYGLKNDTVKKFVGYEYERGTYVYDVNHF"
FT   gene            <42654..>44021
FT                   /locus_tag="Eint_020400"
FT   mRNA            <42654..>44021
FT                   /locus_tag="Eint_020400"
FT                   /product="hypothetical protein"
FT   CDS_pept        42654..44021
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020400"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0470"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q6"
FT                   /protein_id="ADM11041.1"
FT                   /translation="MQVSYIEKETIDELRISTSIGDKIFFIRGMELVSKSIYAYDSEKI
FT                   HKTFEDRVDYICYFNEMILALCGNILYKHRVLGEEVILCGTCQLLEPPIKICVSGGPEE
FT                   KEGYAVCFLYRNKRIEVFSDDIERVVVRCKGDVAKEDEIIDFAIEDGVSWFLSQSGRIY
FT                   RTHSFVISRVVLLNRPVRMIPEPSYFDGTINKILAKRGRLYVCYEEGFEVYDIGKDVLV
FT                   LNYTYKTRDFELYAWENVYCLESNLLIVDEMPRVIASVRVHKMFGDIGISRDRILFIKR
FT                   VEECKRADVKLLKEEDADKRTKEMFRIVENDIKIPEIELSENGREVSEKGFLIVQKMIN
FT                   EFESKILDVYRRIYFELVTLNESFGEKITGLNAENDLILRKVEVLDRRKNDLVERLQKL
FT                   SEKMEDVVSRIQIDGSKTRRLAKMVDKAIDEISYKKYEKYSRILKLQREVLNRKMV"
FT   gene            <44167..>46524
FT                   /locus_tag="Eint_020410"
FT   mRNA            <44167..>46524
FT                   /locus_tag="Eint_020410"
FT                   /product="proteasome regulatory subunit 2"
FT   CDS_pept        44167..46524
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020410"
FT                   /product="proteasome regulatory subunit 2"
FT                   /note="similar to ECU02_0480"
FT                   /db_xref="GOA:E0S5Q7"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q7"
FT                   /protein_id="ADM11042.1"
FT                   /translation="MQTIRILPNIKSLLKDGKVSEAIDVINMHVDVVAPYIKDDLQYIK
FT                   SDDPKTSLCLSKIYFVLGDYQKAIEYALLSGDLLVDDGSFYYTSIVYHMMDSADMSKDS
FT                   RARDFVLRAISSETVDGSLIGYLFSVKEYALLKEALVKYIDGGNDYKRLLDLLISLGEE
FT                   KGCLKEIYGMITEIGPRGKPFLFYVIDAYFYLEEIEKVKELIERLTKEDILLCYEVAFY
FT                   TEDNYSPEIEVSNQKVMSILSGEFKKKILGEFLLERNLTSFKFLESIARTRTHYLGLAN
FT                   SLMNLGTSNDTFYRSNADIFSQSNEWAKFCEVSSIGMIHLFNSNPYEILKNYLPSEVSQ
FT                   KEGGALMALGLIKAGTFSEEDTEYLLYFLDTQDTLTPELAYGVCLGLGLINMGSTNSEI
FT                   LGKLKELSKVDRTLLVEASVYGIGMLGLNSWNVEILEDLRAIAGETEFERVKRAVGISF
FT                   SLVLMFSEEMFYDEDAETDGDFKNYINEFLSEKDSIMRASGVLSLGSSFVGTGRLSVIS
FT                   TLLPYINDGDDDVKRAAVIAIGLVCCDDRDLLVGTLEPLSENHNFFVRAAVAVVLGLFL
FT                   SGTGDEVCTNILEALMYDSNNLVRQSACIGIGFITMQCNPTLIPNYKRIIERLNKLVVD
FT                   KKESGAVELGAVFGRGLSEAGGRNIIFSIRNMSGITSADRIAGAILFLHYWYWYPLISM
FT                   VSLCALPTAVFCFNEDLEEEEIEIPTSNRYDNLLIRLPDIKKTRRFKQRPKEDKEVVTE
FT                   SPSVLTSGSRCTIKQREECGLDSPAILFVKKK"
FT   gene            complement(<46610..>46948)
FT                   /locus_tag="Eint_020420"
FT   mRNA            complement(<46610..>46948)
FT                   /locus_tag="Eint_020420"
FT                   /product="hypothetical Zn-ribbon-containing protein"
FT   CDS_pept        complement(46610..46948)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020420"
FT                   /product="hypothetical Zn-ribbon-containing protein"
FT                   /note="similar to ECU02_0490"
FT                   /db_xref="InterPro:IPR007785"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q8"
FT                   /protein_id="ADM11043.1"
FT                   /translation="MEDKEELRKLLRSTIRKNTDPRVKISDEYLTDEDKAETKTLRTPA
FT                   KKRACKDCTCGLKEKQEVEVRSACGNCYKGDAFRCSGCPSLGLPPYEPGEVVSFSTDLD
FT                   EGLQGQDG"
FT   gene            complement(<46968..>47552)
FT                   /locus_tag="Eint_020430"
FT   mRNA            complement(<46968..>47552)
FT                   /locus_tag="Eint_020430"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(46968..47552)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020430"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0500"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Q9"
FT                   /protein_id="ADM11044.1"
FT                   /translation="MEISQFLKKILKKSTLSLEDIAHLLEEVGIPFEVSGCRILFYKNM
FT                   EKALEAHYLETYGINIPSRTYSINEIHGLALFLYIKKYGSPEVDSDLERFFEGLFFSNT
FT                   GEVDVGQLKEENERLVRENEELKERINEMNNLWIDRGFEEGELGSVDQEVLSKMEKDLS
FT                   ALREQVDFEHPLILEAWYRLGEEHIKSRDFN"
FT   gene            <47630..>49378
FT                   /locus_tag="Eint_020440"
FT   mRNA            <47630..>49378
FT                   /locus_tag="Eint_020440"
FT                   /product="Mps1-like Thr/Tyr dual specificity protein
FT                   kinase"
FT   CDS_pept        47630..49378
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020440"
FT                   /product="Mps1-like Thr/Tyr dual specificity protein
FT                   kinase"
FT                   /note="similar to ECU02_0510"
FT                   /db_xref="GOA:E0S5R0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R0"
FT                   /protein_id="ADM11045.1"
FT                   /translation="MEGIFNSKDLYEYLEEQKHSGISKTRRISLYYKATSKSVGDDEYS
FT                   LRIWLDYIQLLMDGTKDTTEARETFKMIKMRFCKFYNYWEAYIRFEIETGNENLGKILQ
FT                   HSIDFVKVKEFPEKKNVLDYLECVISYVRNQQDLSVFCRSPEKSLDADGRFTSLFETQM
FT                   GDRGGKILKKDQKEPRYEYEGGRGLFPRNDDIYSTPGECKENLSNRSKTDSSSQTLLSS
FT                   LDTKTGNHGSSFFGTIPVRFEKEDYSQGITAEINAALGKAGSEESSSSPRSGTIRAREK
FT                   ISVKGKDIEILKQIGKGGSSKVYKILLGNSVYALKRVELVGDEKMLNSYINEINLLYKF
FT                   KGAPEIVEIIDHEVNEDYLHILLEYGETDLSQIIKRGNLSINFIKDVWEQMLLIVKRVH
FT                   MERIIHCDLKPANFLFVKGRVKLIDFGISKVIRNDTTSILSEEQCGTVNYMSPEAVTQN
FT                   KSKVARSSDIWSLGCILYEMVHSKPPLHEYPNLIQKIQKLQEYSEFKYSSENKLAVMVM
FT                   KECLVRDPKKRPTIDNLLNHRFLTGEIHLEPLRELVTKILRISGKDKADPAYVDKITEQ
FT                   LWNDHG"
FT   gene            complement(<49462..>50916)
FT                   /locus_tag="Eint_020450"
FT   mRNA            complement(<49462..>50916)
FT                   /locus_tag="Eint_020450"
FT                   /product="T complex protein 1 delta subunit"
FT   CDS_pept        complement(49462..50916)
FT                   /codon_start=1
FT                   /gene_family="HOG000226735" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020450"
FT                   /product="T complex protein 1 delta subunit"
FT                   /note="similar to ECU02_0520"
FT                   /db_xref="GOA:E0S5R1"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012717"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R1"
FT                   /protein_id="ADM11046.1"
FT                   /translation="MATERLNQVRTSIFQASQSLLQTLSTSLGPRGLDKMIVKDKKTVV
FT                   TNDGATILKYLNQHPIHGILSNMSAAQDEECGDGTTSVVILAGCLLESVSNLVERNVHP
FT                   SVICDNLEISKKIGLKYIDKVKMECDRRDFINNVSTALCSKIASSTGEMAEAAIKGMEY
FT                   VNGDKRKIRVVKRTGGGLDDVKAYKSILLECDFKEIPKKAKLGVAQFCLSAPKTNMDSK
FT                   ILVNDPALMEKIIQDERKYILEMCKKIKKSGCTLLVIQKSILRESLSDLASHFLKQLNI
FT                   LVVNSVDRKDVDYICSTIGIQPVSEIDLLNPGSLVDVDIGEVEGMLEIKEHGCTILLRG
FT                   CDDMVVEEAERSLNDALCVVKCLEELPFLVPGGGSVEMGISLMLSESTEGNVYVLREIA
FT                   KAFEGVPYFLARNAGLYPVEIVSELRSELKQNDCAGISVRSGHAGDMVKEDSVVQPAKV
FT                   SISIVTLAIETVSMILKIDDILPTRR"
FT   gene            complement(50967..51048)
FT                   /locus_tag="Eint_020460"
FT   tRNA            complement(50967..51048)
FT                   /locus_tag="Eint_020460"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA Type: Ser, Anti Codon: CGA, Cove Score: 53.48"
FT   gene            complement(<51104..>51388)
FT                   /locus_tag="Eint_020470"
FT   mRNA            complement(<51104..>51388)
FT                   /locus_tag="Eint_020470"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(51104..51388)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020470"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0530"
FT                   /db_xref="GOA:E0S5R2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R2"
FT                   /protein_id="ADM11047.1"
FT                   /translation="MEQIETQILFVRNLPKDISKDKIIELFGDYGRVIQIRIGVEKSTA
FT                   GSAFVVYDRVSGARKAIKRMNGYYLDNMYLNVGYWQPFDKFRLMMKRKQ"
FT   gene            51507..51577
FT                   /locus_tag="Eint_020480"
FT   tRNA            51507..51577
FT                   /locus_tag="Eint_020480"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA Type: Thr, Anti Codon: CGT, Cove Score: 65.16"
FT   gene            complement(<51614..>52624)
FT                   /locus_tag="Eint_020490"
FT   mRNA            complement(<51614..>52624)
FT                   /locus_tag="Eint_020490"
FT                   /product="clathrin coat assembly protein"
FT   CDS_pept        complement(51614..52624)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020490"
FT                   /product="clathrin coat assembly protein"
FT                   /note="similar to ECU02_0540"
FT                   /db_xref="GOA:E0S5R3"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R3"
FT                   /protein_id="ADM11048.1"
FT                   /translation="MIEEIFIVGEGDRVLYGDPSRYKKEARYPVDDVGGARMVQVGMND
FT                   VKIGILHSLGCDFSVLEYIQRLCKKLEKKLGEINEKNVLENYFSLLRIINKQESVVLFD
FT                   GGKKLIPSITSNNVYLDVSEDLSAIIEKEKTILNRIDGRCYLNASFGEERTVEFDVCSL
FT                   KPCTIAYKNYQQVSEGLEGIRVSAKVQGSKLEAVRYWSSDAKDPLVMISKIDGGYILSC
FT                   PSPTRFDRLEVCFPIPKMASKVVKSHRSGKSIYDEENDLLRWTFTKQVIRRERIDYRVD
FT                   LFEEYEDLRPIMVNFYIKEWKDSKVRVERAECVENPGVCFWIRYSMASGRYEIRR"
FT   gene            complement(<52689..>54230)
FT                   /locus_tag="Eint_020500"
FT   mRNA            complement(<52689..>54230)
FT                   /locus_tag="Eint_020500"
FT                   /product="Spk1-like Ser/Thr protein kinase"
FT   CDS_pept        complement(52689..54230)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020500"
FT                   /product="Spk1-like Ser/Thr protein kinase"
FT                   /note="similar to ECU02_0550"
FT                   /db_xref="GOA:E0S5R4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R4"
FT                   /protein_id="ADM11049.1"
FT                   /translation="MKKYKLHRVIGEGASSTVYGGVSAIGEEVAVKVASRRGRSGGMVY
FT                   REMKMLSSFHHENIVKVVDKFESANHVYIVEELCDLNLVSFLNEYEVDEDVALKILRMI
FT                   LCGLRHIHSMGVIHRDLKLGNILLKGNTVKICDFGLSCYAEENSNEFCGTMDYLAPEVI
FT                   EGRKYSQGVDIWSAGIVFYVLLTKKKFYESLSSLECSKELKDLLGKLLEKDANKRISAS
FT                   EALMHESFSRFIPRCEDFRDLPNFEKNTRYGVMKKTRDLVELGDARIVARKKERHGSGR
FT                   RHGEEKCLCGEEFIYSVFIGNEETEPVFVTNGGLKALSLLTGHVKMMRERIPKIIIDNG
FT                   GNKFYYMFSGGFVYVTREFTLKTRGKGYEVIYLAGEKKYSEKIPDFLYETIMGMKARCE
FT                   AIDREVCWFLRESPVLVDCSSHQQFSMSYISQVSEMSIRNRTLYDYIENTGWCIRNGLS
FT                   FLFLMNDGERFEVLCEDLMVRYKERVFPIDNRLPQNLKHYLKRICSFFRGIRDGL"
FT   gene            complement(<54341..>56149)
FT                   /locus_tag="Eint_020510"
FT   mRNA            complement(<54341..>56149)
FT                   /locus_tag="Eint_020510"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(54341..56149)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020510"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0560"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R5"
FT                   /protein_id="ADM11050.1"
FT                   /translation="MLRALFGYEKHFQMVDDVYKGRSGSEEKLSKLITYLKSRTSTIPS
FT                   TLDYLKIRAGEEVYSTHRLKTGSKVLRLIIDQLRGVSICYESRIIRIFVGVIREILQLK
FT                   RKGDFEYSDHQEFLDVFTYFFKTVPIRAYESERYIRKILFIATQAAKDVKNSDGIAEGL
FT                   SLDDEAEYNEKNVLETTNVWKDEGRQAGDFRMHGDEQGGEISNARFEYFFLEIIHTLMG
FT                   MEDILRIDYDEKYKWLVGSLMKHGEVNSSKRMEIFKAVAGKANIISGNSLIYYVLKNAS
FT                   WMGKSCVGTLTEYLGPDLYPQIILQANMNILERGKRVHRDKKIGRSKAVGECEFLVREA
FT                   LGVLNEYEVLHLNQKEIVVSFFSILEMFFSRDDSKLPFIIPYVRKYFEKCKPISDVFYR
FT                   FLKKILQDKEVSGYTEDLRTTIFDEIQRYFVVHSDWIPNPKFMTLLLGAGTGESAGFCC
FT                   KILYLAKDYFMGRALKPFVKERVMRRLRVLFCETENRDIQYLLMDLVGDGVSKDSHYKI
FT                   LCLFGAKKILNEELVKEMYKGRYLNVSEVLFGEFGCEALEPYDLDTEKRMEEIESEKKK
FT                   AQDCELDVKFRRHTRIALVDYEKHFR"
FT   gene            <56489..>57901
FT                   /locus_tag="Eint_020520"
FT   mRNA            <56489..>57901
FT                   /locus_tag="Eint_020520"
FT                   /product="hypothetical protein"
FT   CDS_pept        56489..57901
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0570"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R6"
FT                   /protein_id="ADM11051.1"
FT                   /translation="MTLIKRIISRNKSCYILQANEQTFLFDYPSSIYGTHFSFPSFAKA
FT                   PKPLKLIFPKFVDNIDHILITRSDSLGVLFLEKDIPIYITEPVFEQILIKYKSLLKIPA
FT                   YYEDEEDEGVSVEDADVERFRRNARFVRFNERCYFDNVLITPHPAGTFIGWTNYLIDIG
FT                   DKRTIYYLTSLASKTRLSLEAGGISSDYLIINTDFPPPSHDIEEFSTYINDLGSDVAIV
FT                   PLEMTTMLIEVLLHTLFVTQAKGTIPIYVVSSEFGRLHTTISIENEWLSKPFSSAKEPF
FT                   PIRSYRRFYAVDTIDELSEISGPAVVFCDPLEFSLYSHPIFDNQKIISINNSVPFADAN
FT                   YNLKLELDPEEISSIHTGTIIHNPNPGEYLYIEAMPGHYCLAVDARSIQVYTNEIYLNG
FT                   KLKFSDKHGFGKKMVFSQKKCKLSDLFSANRFFFSEGSYYFPQKGLKVTIDNKKAKIKK
FT                   IIGLNKAKRTSK"
FT   gene            complement(<57936..>58679)
FT                   /locus_tag="Eint_020530"
FT   mRNA            complement(<57936..>58679)
FT                   /locus_tag="Eint_020530"
FT                   /product="hydroxyacylglutathione hydrolase"
FT   CDS_pept        complement(57936..58679)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020530"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /note="similar to ECU02_0580"
FT                   /db_xref="GOA:E0S5R7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R7"
FT                   /protein_id="ADM11052.1"
FT                   /translation="MGIEVVSIVIGDNYMHLFYEGDSAFCIDACNPRVLLKALGVDFKK
FT                   KIYSESEILGMEEDLEKRRKLVYLFTTHRHQDHSHGIPYIAENSPETKRISGFEGSICK
FT                   CGDRFKFGEVEIECLYTPCHTVDSFCYYIGGEFLATGDTLFFLGCGKFFEGTPEQMVQA
FT                   IKKIMERVDQNAILLYGHDYNKQNIQFTEEFYCIPPEIKRKRFLRLRDEMEYNPFFNLG
FT                   KILTEDSESERMRELRRRKDYFNRM"
FT   gene            complement(<58752..>61097)
FT                   /locus_tag="Eint_020540"
FT   mRNA            complement(<58752..>61097)
FT                   /locus_tag="Eint_020540"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(58752..61097)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020540"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0590"
FT                   /db_xref="GOA:E0S5R8"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R8"
FT                   /protein_id="ADM11053.1"
FT                   /translation="MEIELEVRRVESQKRITSTKIRHVFSSELVYLDDFTITIPVYGFK
FT                   DKEYEYTGSIFSRTKDLLGKIGGKGVLGVLYEDRMEVLKGLDRPILRCLYKDGDLIRIC
FT                   SLRRLVVVEPRSSVANVTFTRMVLQDQSKFAALKKLRMVNCNIKKIPDLSMMKLTHLDL
FT                   SHNNISGVVYVCGQFNTVNLSHNKITRVIRMKASNLDISYNEITRFFQESTYQNLNLSH
FT                   NPLEHYNAEARVLNLSHTMLKSLESQITKKLIVDGTKEIRLGTFENLVFLSVNFCSLRL
FT                   LSFNARKLRVLKARNNFIEEVPFFPFLEYLDISGNLIHGIASKGVRFLDASKNQIMVFN
FT                   LAKWKNLEHLNLSYNPLVSLENYGEMELKFLNLKGTNVIKDFRGNRIEKNVHKCLEKKK
FT                   EIERFIVHPKGINGRLLVISMGDFEAGVFEILETIQVRIQETSNSYEYFQKFCSLLRKM
FT                   IFARGARIGYALCMVTPKHVILNGRGIEVVFSNFAEIKILEGPDVVEVYDNIGNWHFIP
FT                   LFCSFKGSIARFDILDTVRNDLGLVLDFIGHQCPLSAVMAISNTSKLPKNSKASVELIS
FT                   RIDLPSKISYETVIRSILRKKGNENGVQGSENYNFARKSSTRQFYGTLLLNPNPIFAFC
FT                   KLIPKDTSYRYVIGNVMNIMRMMSNVFSGTRIEFFSRIWIVAFHDRVEACLWGIRIQEM
FT                   LRCLGIDVGIGITCGTFYTRIMNNHVRFYGPVLNKASRIANLGIGVFCCHCVWTKHSKI
FT                   MYISQGRRIFRGFKEPHLIYTPQLSEKT"
FT   gene            <61326..>61892
FT                   /locus_tag="Eint_020550"
FT   mRNA            <61326..>61892
FT                   /locus_tag="Eint_020550"
FT                   /product="hypothetical protein"
FT   CDS_pept        61326..61892
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020550"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0600"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5R9"
FT                   /protein_id="ADM11054.1"
FT                   /translation="MDKFHSLAIKALLTFILTTGVFVNEGSFKMPLWIGLLPAVLFNPA
FT                   VAVYFYVKRMEYKKRFLRKTYNPGNRALLGFAFGEVLSIMPFYCISEYWKTMLLNITLV
FT                   AILSILPMVDSSGRRTIQLERNEEFFKIGFLRVEHVEGGDVCLNKGEVVQILDHSGGST
FT                   TVRKSDGRVFTIEDSYIDDGIDIVL"
FT   gene            complement(<61997..>62494)
FT                   /locus_tag="Eint_020560"
FT   mRNA            complement(<61997..>62494)
FT                   /locus_tag="Eint_020560"
FT                   /product="60S ribosomal protein L11"
FT   CDS_pept        complement(61997..62494)
FT                   /codon_start=1
FT                   /gene_family="HOG000231312" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020560"
FT                   /product="60S ribosomal protein L11"
FT                   /note="similar to ECU02_0610"
FT                   /db_xref="GOA:E0S5S0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S0"
FT                   /protein_id="ADM11055.1"
FT                   /translation="MREISIKKLSIHICARESGAKLDRAAKVLEQLTGQKPVASKARMT
FT                   IRNFGIRRNEKIAVHVNVSGKKAYELLNTALKVKEYELKESCFSNNGCFGFGIEEHIDL
FT                   GLKYDPNIGIFGMDFFVVLSRPGDRVSKRRRCRSKVGNKQRVYAEDAKKWFVENFEGIL
FT                   VE"
FT   gene            complement(<62635..>62928)
FT                   /locus_tag="Eint_020570"
FT   mRNA            complement(<62635..>62928)
FT                   /locus_tag="Eint_020570"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(62635..62928)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020570"
FT                   /product="hypothetical protein"
FT                   /note="similar to EBI_26858"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S1"
FT                   /protein_id="ADM11056.1"
FT                   /translation="MHFLVKKPGWLVFDPNEYGDEEVRTFQVRHKESCSNTKLVKFEDG
FT                   SWYLKNGSQMFSLKPVASKREVGVGAKDGNVVYIREILDKKWFIKMDKSSER"
FT   gene            <63083..>65239
FT                   /locus_tag="Eint_020580"
FT   mRNA            <63083..>65239
FT                   /locus_tag="Eint_020580"
FT                   /product="CAS/CSE chromosome segregation protein"
FT   CDS_pept        63083..65239
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020580"
FT                   /product="CAS/CSE chromosome segregation protein"
FT                   /note="similar to ECU02_0630"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S2"
FT                   /protein_id="ADM11057.1"
FT                   /translation="MEHLLNDILQNPQGPSVKHVEERLDGIDGQREFVELLKSGNGIAF
FT                   TYMKTRCKEWTENPKRIEMIHRIHDVLFSLIFTSSEQNFGILCFFFETLYLCGNGWSSL
FT                   VEDLCANPNGRSVRVLNHMFNKYRVCSRSNALYGEIIRNIELCQDIFRKAYFESLSEDE
FT                   NILGMFHSLVFQDIHPFFENNADRFLGSFCKLLRKQVLEKDVCEIFNLFVTKYPECVDM
FT                   TRILGVVLTTITGFDYLKYTVLLNIVKRKSHPVLSKFSDALSNAVKMGAFVSENEIMEM
FT                   NEDVLLYSRNLLKGYDVNRGIIIEMIGHLRKVFGEGWGSMLIEGTVATPIEEERLIFLC
FT                   MALGIRLEEAVRKCSGIVQDSKSIGYLGVVSFRYLLSIGHYTVIDPGYINRGNPGSFLA
FT                   MVYLSRCIDNSGALESLESYSTRYGEGNPEACRKIGGPENCAKIMSHLMKFLRDNIEDE
FT                   FSSQLVQKVVRICPSSVSPEVVRFIDEFVWKNVRNINSPQAYGYLLDVQGLVFLKTGDN
FT                   TWILNLVQVVLSEEIFEIYSSSLFLLAIVVLHSSGDFSPVVEIIRQESLWKTKELLLSM
FT                   VCLTVSLFKTGNCSKEQVDYIVEYLLGVSIHHAYVLLTNTVVSGDYLKWIKGENIEEEF
FT                   VLACALKKRGLISEEMYKEIYTRSLQYFEKNFVSKRNARRVLRGLGYGMESFGRSEAYG
FT                   VMERNKHSIGYENIPFSVAVAFEL"
FT   gene            <65368..>66546
FT                   /locus_tag="Eint_020590"
FT   mRNA            <65368..>66546
FT                   /locus_tag="Eint_020590"
FT                   /product="WD40 domain-containing putative transcriptional
FT                   repressor for RNA polymerase II"
FT   CDS_pept        65368..66546
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020590"
FT                   /product="WD40 domain-containing putative transcriptional
FT                   repressor for RNA polymerase II"
FT                   /note="similar to ECU02_0640"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S3"
FT                   /protein_id="ADM11058.1"
FT                   /translation="MFQPGIEAYLDAIKQQYDTVMAENRSLRKENIRLVEANGQYARKI
FT                   QYYTSILNRQKHMSLETEGSFIRPPKYLKRGSDWSVDGDKLCIVSVRDKIMVGGKITNA
FT                   VISKCGKFVAFGCGYKVFIVMEKTIWFLDTSSEKMERYEEGMFEGETQEYRICPMDFTC
FT                   DSLYLYAADGKGAVRIWSLKSKAQEGLLRPCDPVALKITNNLVFTIEWDKTMNVYDSNN
FT                   KVLTLSSEEEFSGPMAVSPDGSFVYAVVGRTKILVFDIKTEMVHLANTNEDRILAIATS
FT                   PEHAIMSIGGHGRNAYLYRIKKEKPLPRVQDSIDQRGTVFSLGFIGNHLLVGQPEGVMI
FT                   WDLSEKRSMRIQLQESNVIGISTCKDSFATVDNNGVLRVWRYYNSVEWDNSS"
FT   gene            complement(<66665..>68113)
FT                   /locus_tag="Eint_020600"
FT   mRNA            complement(<66665..>68113)
FT                   /locus_tag="Eint_020600"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(66665..68113)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020600"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0650"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S4"
FT                   /protein_id="ADM11059.1"
FT                   /translation="MGKDSLNSYLSPAAEEPEGKFRDARGLSMGSMDEKLRRINEEFKA
FT                   RACVGSGFVFNRNVKLESPANYFGKSKDFSNENGAADGIPKNNSGDVNSTKMRDGFIGG
FT                   VIPWKVNSSGAMNRSPAHKDISKGSMVGMDLYKKSSIDFSSYGMNKGSVEDSINRGSKV
FT                   GYVRSIASSSIFNREAPSNSGSFGNRRNRTSPSPFGKKEAQEEDLSVSKSVFSNPLSNA
FT                   SSLSLSSKTSYQGPSFLYTRTGKSPTFAPIDVMYVKSMSKPENTIEKPEGNLKGASHSW
FT                   SETRNSQMASNLYAPGRKLTIYPQIRISNTVLCYEGSAETTKYYITVESDIKWIICKTI
FT                   KDISTLFPGIRCATLANAMSPQDRRARDRAIEIALNSEMTDKQLQPFILSDISSTHLLR
FT                   SSYLLMDKDGWKAYLFKFVGKALICYEKSRVYKIFLLSNCNVLPIGQVGFCLERSGEGV
FT                   ELYTTCEKERDAWVSDIKEYISRL"
FT   gene            complement(<68199..>70397)
FT                   /locus_tag="Eint_020610"
FT   mRNA            complement(<68199..>70397)
FT                   /locus_tag="Eint_020610"
FT                   /product="muskelin N-terminus domain-containing protein"
FT   CDS_pept        complement(68199..70397)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020610"
FT                   /product="muskelin N-terminus domain-containing protein"
FT                   /note="similar to ECU02_0660"
FT                   /db_xref="GOA:E0S5S5"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010565"
FT                   /db_xref="InterPro:IPR011498"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S5"
FT                   /protein_id="ADM11060.1"
FT                   /translation="MLNDRRSYTVIPYEIHSYSTYASVYMPSNIKKNDPMDPNSRWSTS
FT                   TNDHLQYIILKIPPSLVVTITFGKYNKMHVSNVKKMRISVSGDGVEYKEVLCGGLKNDS
FT                   EMETFNLLVKDETYYIAQYVKIEPLAAWGVNFSYSLWFVELRGIADVEKFARYNEMVIF
FT                   GKSMRNCLKFLRDCGFRDVYEILEKRSSDKIEDEIVKHIRHLLESHKYEDTEEVLDRLD
FT                   PCVFQGFIDSSPYSLVWTEIPRAEVWPCERGGHQMVEMDGSLYLYGGWNGVEELEDFWR
FT                   YRGGEWSEIKMNTVSPGKRSCHRMVSYGSKLYLMGKYICLSSRKVFSGKSDIWVFDGNW
FT                   RVINSDEEGGPGNIYDHQMVVVGDKLYVFGGRSTEKEDTYSGLYMFSLDERSLGYGMEV
FT                   LGKCGRTNEVGKPISETDGRYRTCGQFGGKEKRSPGMAEISPSFGTGISQENMLDESNS
FT                   RHEPSTSSSSLFRSRWMVIRSDTMQPSSTPSLKSRLEHSMVFIPPDYIEGSIYNNSLVV
FT                   IGGQKNKSSMREMVFYRLDTDTVFQSVPFPISGEGRVVQRGLLYLNEIVVLFCHGKEKE
FT                   GRFENIDVYTFSLIKKKWTEVVVKSRTEAGVDIKPAPRSAHQFVEMDGWFYLFGGNISE
FT                   KVDRRVNDMWVFRLEKKTNKEIRHLSKFLVRKHKYLYLLGIDEEKAIDYLRTSVLNMVV
FT                   DDDTRELFEELCHEVYRRKIFVDPVEDICRLLTTAKEY"
FT   gene            <70547..>72055
FT                   /locus_tag="Eint_020620"
FT   mRNA            <70547..>72055
FT                   /locus_tag="Eint_020620"
FT                   /product="DEAD box ATP-dependent RNA helicase"
FT   CDS_pept        70547..72055
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020620"
FT                   /product="DEAD box ATP-dependent RNA helicase"
FT                   /note="similar to ECU02_0670"
FT                   /db_xref="GOA:E0S5S6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S6"
FT                   /protein_id="ADM11061.1"
FT                   /translation="MKLELHMVDEGGRNESVGFDRGKASKRLLWVGSDSEVRGRSSLRK
FT                   EKGGIARGPEKSNQHSGNDKNETVSQDSKEEEKAIATEDGDSKVRTSEKVKTLNSFKDL
FT                   SSPSLVKVLGREYTAPTVIQKYCIPSMVDGRNLLCRAPTGMGKTMCFLIPIIERYQQMN
FT                   KPQACIISPTRELCEQIRTEASKLVVGSKIRVVSIYGKKQDLPSYAGVDIIVATPGRLI
FT                   DLLHKDKVDLSEVRMFVLDEADKLLDMGFEMPIREIHKFVPKNTQTCLFSATYSPKLTR
FT                   MINYFLPDDKVSIEIPSETLKNIRQDIVEVRNKKKMLLNILRSSEINLKGSWRMEVQPD
FT                   KVLVFVERKSECGEVEKTLKKNGILCVTLHGDKEQSDRNEALKGFRNGRFPVMVATSVA
FT                   ARGIDIKDVKLVINYDIPKDIKEYIHRIGRTGREGKSGRSISFYDGGMSADFKKALIEV
FT                   LKESKNPIPSFLSDTAEDFDARLQRLKVSADKEMSDDEEVGLWG"
FT   gene            <72134..>72988
FT                   /locus_tag="Eint_020630"
FT   mRNA            <72134..>72988
FT                   /locus_tag="Eint_020630"
FT                   /product="DNA replication factor C small subunit"
FT   CDS_pept        72134..72988
FT                   /codon_start=1
FT                   /gene_family="HOG000224154" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020630"
FT                   /product="DNA replication factor C small subunit"
FT                   /note="similar to ECU02_0680"
FT                   /db_xref="GOA:E0S5S7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S7"
FT                   /protein_id="ADM11062.1"
FT                   /translation="MLWTEKYRPKSVDTFEGPEHLKSILRNSSERGHPNLLLYGPPGTG
FT                   KTTFAHLLATRKLELNASDERGISVIREKIKVYASTLEKDKTVILDECENLTSDAQHCL
FT                   RRVIEDSVNTRFIFITNYPSKIIGPLRSRLVGVKFTLADNRVLEGIGGNEGLGYDKELY
FT                   RRLFKLCGNDLRKAINVLQGIAPLSSFCIEEAVGSIPQKTVDEFWKVGRAEVMDYSKMF
FT                   LRDGYSALQLVRQLAGCWKGSDAQSAKFHLLLSSLEEKAVLGCSDELVLYNLLGGKVEI
FT                   FSQ"
FT   gene            complement(<73029..>73451)
FT                   /locus_tag="Eint_020640"
FT   mRNA            complement(<73029..>73451)
FT                   /locus_tag="Eint_020640"
FT                   /product="HscB-like chaperone"
FT   CDS_pept        complement(73029..73451)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020640"
FT                   /product="HscB-like chaperone"
FT                   /note="similar to ECU02_0690"
FT                   /db_xref="GOA:E0S5S8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S8"
FT                   /protein_id="ADM11063.1"
FT                   /translation="MGSPSRYFDIFGLKPSFAIDQNVLKERYYKMSRKFHPDKASPSGE
FT                   DISMEEINKAYDTLKNDLSRARYLNNPGNIDVGKEFLIDVLDYEQAISNAKNNEDRNRI
FT                   KEDLEKKIDQCKRNPSGEYLARWGYYARLMKMLNKR"
FT   gene            <73521..>74783
FT                   /locus_tag="Eint_020650"
FT   mRNA            <73521..>74783
FT                   /locus_tag="Eint_020650"
FT                   /product="Nucleic-acid-binding protein"
FT   CDS_pept        73521..74783
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020650"
FT                   /product="Nucleic-acid-binding protein"
FT                   /note="similar to ECU02_0700"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5S9"
FT                   /protein_id="ADM11064.1"
FT                   /translation="MGKSKGDDRKKEGRKSSRHKLPGKEGKTGSKKIVLRKKPCPIQGI
FT                   ELQDATKIEKDLLMHGTIKDKIDVLTLLVERNPSPENYKALLAFCENQRNDVHYYVLKN
FT                   IQDLLISKREVENPYIKQRIIKSFDVNLRNQYIKKKVARLVHKLLEEGVLFVNLVHLFI
FT                   NKLGDKRDMSDYVIDKLNLLVPGNEEMILDGIEDFYFKNDQFRSRHVVLKFLANIDWEN
FT                   KVKAFEVFDTILRDFNENIPEEHRNILLEDLIVGLGKNMTDKNVCRTDIIRKSVHTEKM
FT                   IFYGAKALSNSKDPEILVFFKNAIKSHRMRGSKLLPEFLNMIHETASMHRDIEFYRFLL
FT                   ETSLLYTPEYIISILIICSEARKEGLGGFDNIYSLRVLALHYHDVVRKLSLQLIGNEMI
FT                   LPFDPFDRMSLLNAEMMCGDL"
FT   gene            complement(<75189..>77159)
FT                   /locus_tag="Eint_020660"
FT   mRNA            complement(<75189..>77159)
FT                   /locus_tag="Eint_020660"
FT                   /product="WD40 domain-containing putative histone
FT                   transcription regulator"
FT   CDS_pept        complement(75189..77159)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020660"
FT                   /product="WD40 domain-containing putative histone
FT                   transcription regulator"
FT                   /note="similar to ECU02_0710"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T0"
FT                   /protein_id="ADM11065.1"
FT                   /translation="MKISRTDIGHGTKRPKPIFSIDVSGTLMATASLDGEIKLWNEKHE
FT                   HVRTVKKHQGTVLCVRFSVDGKLLASGGDDGMVFVYRIDGDVVASACEHESDVSNVLWT
FT                   DRFLVSVGYDGYVVFYDLKSFEVVKKMKPHEGQIKGVSADRSFRYMCTQGDDGIVLYEE
FT                   FEEVGKIDASEGVILESFFSRTSWTPDGEFFASGLSFNRNYNTVEVFSKDLKNECSFIG
FT                   HAAPCEVVAFNPRLYKEDRRYYVAAVSSQDLSLSLWCSLYSKPFLLVKNLTELPVLDMC
FT                   WNESGTKLFVCSYGGEVVQINVEEGEFGKVYEEEEDVSGEVFFSMENKDMFERAKKEPA
FT                   ESNSKDGLAKSSKKVVRPVLISSDTPEEKDKIEGVEVETNHSYLAIFNYSCKKLAKMAT
FT                   RSQMPKSFGDFKVEVGKDRTHVSVKRGPKEFYRIHGSIDMLCINKKYLCLYTGKIQLYH
FT                   LNTGILAMPFVCAGDVVAIDVLGSKLMYLQADGSFTILLINKCKVTFKGVIPRTDGLLS
FT                   LRLDRKYFLVAAFPSEEYFLGKKSGVWFLRTPVYNSIWTEDTDLTLDHDETLAHLENEF
FT                   LISHFGGDKRRLMRVVKDITRAACKIRKMGDFIEFKLKNVIRILLGSGERTKAIRVLEK
FT                   MNTNYALQPFVFKMLKEIGKI"
FT   gene            complement(<77243..>77629)
FT                   /locus_tag="Eint_020670"
FT   mRNA            complement(<77243..>77629)
FT                   /locus_tag="Eint_020670"
FT                   /product="histone H2A"
FT   CDS_pept        complement(77243..77629)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020670"
FT                   /product="histone H2A"
FT                   /note="similar to ECU02_0720"
FT                   /db_xref="GOA:E0S5T1"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T1"
FT                   /protein_id="ADM11066.1"
FT                   /translation="MAMVQGKGGKADPRVMGKDEEHQKSIVKLSQIKKIMKDRTRMRIS
FT                   KDALIGVSACVMYLISEITDGAKNVANTDGKKKVIPKHINHAICNDTELHFVGHDWLIK
FT                   NGGMKSYISPGDFSVSSKKGGSRD"
FT   gene            complement(<77720..>79237)
FT                   /locus_tag="Eint_020680"
FT   mRNA            complement(<77720..>79237)
FT                   /locus_tag="Eint_020680"
FT                   /product="poly (A) polymerase type 1"
FT   CDS_pept        complement(77720..79237)
FT                   /codon_start=1
FT                   /gene_family="HOG000204376" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020680"
FT                   /product="poly (A) polymerase type 1"
FT                   /note="similar to ECU02_0730"
FT                   /db_xref="GOA:E0S5T2"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007010"
FT                   /db_xref="InterPro:IPR007012"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR014492"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T2"
FT                   /protein_id="ADM11067.1"
FT                   /translation="MEISERNYKYGVTGPLSMKESTEKEMKLSEEMDMYLQERGFFEDD
FT                   KEGQTRERVLGKLNFMVREFVARMGKGRGSGDGEKAYGGKIFTFGSYRLGVHGKGTDID
FT                   ALCIVPRHVTRNDFFTHFYEELKGDPNIKEVTKIEDAFVPIIKFEFQGIPIDLVFARLN
FT                   VPVVKDGINLLNDTLLKSMDEKCILSLNGSRVTDEMLNLVPNVNTFHSALRCIKYWAKR
FT                   RCVYGNPYGYFGGVAFSLCVARVCQLYPNASSFSIVCKFFELFSSWKWPTPVVLRPVVD
FT                   LNYNLKVWDPKVYPSDKYHRMPVITPAYPSMCATHNVSNSTQHVISMEFARAHEILSSP
FT                   EKNDFRKIFDLSDFFSRYKLFAEILAMSTEEEGFPKWEGYVESKVRILASKFEAVDDIL
FT                   YAIPFPKAFRVAEENIGKIKYGMQDLKKCTAFFIAIDVIPVKGKKVVVEQQVKEFVDFM
FT                   NEYEGKERSMRIEINSLKKKDVQNFLRVFYGKENLTSDETGKRRRVE"
FT   gene            complement(<79350..>79583)
FT                   /locus_tag="Eint_020690"
FT   mRNA            complement(<79350..>79583)
FT                   /locus_tag="Eint_020690"
FT                   /product="ubiquitin"
FT   CDS_pept        complement(79350..79583)
FT                   /codon_start=1
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020690"
FT                   /product="ubiquitin"
FT                   /note="similar to ECU02_0740i"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T3"
FT                   /protein_id="ADM11068.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGY"
FT   gene            <79855..>80475
FT                   /locus_tag="Eint_020700"
FT   mRNA            <79855..>80475
FT                   /locus_tag="Eint_020700"
FT                   /product="60S ribosomal protein L7A"
FT                   /note="L8 in yeast"
FT   CDS_pept        79855..80475
FT                   /codon_start=1
FT                   /gene_family="HOG000216644" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020700"
FT                   /product="60S ribosomal protein L7A"
FT                   /note="L8 in yeast; similar to ECU02_0750i"
FT                   /db_xref="GOA:E0S5T4"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T4"
FT                   /protein_id="ADM11069.1"
FT                   /translation="MVLGKVKKIPAMAPKLTKEQKMERELLIKKKISKLANAIRIPPAI
FT                   NQFKTFLSEDDTKKFVDLFMKYRPENKKEKIARLSSEDPKKGPKPILVKFGLKHVTSLI
FT                   ESKKAKLVLISASVDPIEVVIFLPTLCRKMGVSYAIVENSTILGRLVNLKSTSCVCLCD
FT                   ARPEDEAAFKEIQGIANAIFLDNYETHLRTWGGGPKKQTSEEQ"
FT   gene            complement(<80514..>81041)
FT                   /locus_tag="Eint_020710"
FT   mRNA            complement(<80514..>81041)
FT                   /locus_tag="Eint_020710"
FT                   /product="S26 Type I signal peptidase"
FT   CDS_pept        complement(80514..81041)
FT                   /codon_start=1
FT                   /gene_family="HOG000111516" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020710"
FT                   /product="S26 Type I signal peptidase"
FT                   /note="similar to ECU02_0760"
FT                   /db_xref="GOA:E0S5T5"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T5"
FT                   /protein_id="ADM11070.1"
FT                   /translation="MLEYLISEKDIRMLKRMSIRQKLVQFVNAAYSVMGTYMIWKMFSI
FT                   LLNNDSPIVVVLSESMSPGFEKGDILWLANKDFSVGDMTVFKFGREIPCVHRCIKQFGE
FT                   RYLTKGDNNLDDDVSLYPRGRNYLTRGEIKSIVVGYIPFFGWINLWINTIPGVKFAILA
FT                   AVGMSVLFTREE"
FT   gene            complement(<81136..>81521)
FT                   /locus_tag="Eint_020720"
FT   mRNA            complement(join(<81136..81495,81519..>81521))
FT                   /locus_tag="Eint_020720"
FT                   /product="40S ribosomal protein S17"
FT   CDS_pept        complement(join(81136..81495,81519..81521))
FT                   /codon_start=1
FT                   /gene_family="HOG000227166" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020720"
FT                   /product="40S ribosomal protein S17"
FT                   /note="similar to ECU02_0770"
FT                   /db_xref="GOA:E0S5T6"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T6"
FT                   /protein_id="ADM11071.1"
FT                   /translation="MGCVRNKIVKRAARTIAEKYFQRLDNTFDHNLLVVQDVAVVQSKK
FT                   LKNEIAGYLTSLYKKILKGTYNKVYIKSHEEERERKENVIPKESILDVDSVEVDNVTME
FT                   MIKRYGYEGNFKIYGV"
FT   exon            complement(<81136..81495)
FT                   /locus_tag="Eint_020720"
FT                   /number=2
FT   exon            complement(81519..>81521)
FT                   /locus_tag="Eint_020720"
FT                   /number=1
FT   gene            complement(<81571..>82254)
FT                   /locus_tag="Eint_020730"
FT   mRNA            complement(<81571..>82254)
FT                   /locus_tag="Eint_020730"
FT                   /product="transcription initiation factor TFIIF subunit
FT                   beta"
FT   CDS_pept        complement(81571..82254)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020730"
FT                   /product="transcription initiation factor TFIIF subunit
FT                   beta"
FT                   /note="similar to ECU02_0780"
FT                   /db_xref="GOA:E0S5T7"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T7"
FT                   /protein_id="ADM11072.1"
FT                   /translation="MELNTNNKNTKIWLAKVPLFLAERILSLGGETTIGELDITKATST
FT                   EPAVLSLKLSKEFCEGGFPSSFEVKVKPRDNSMYVIRAYENNADVEGVINNECYITPEI
FT                   NGEYLRYKKEAGFKSDAKKSDVQVIDYLKEGKRGEKFGSLRELEYLARKRKKMLMDKKR
FT                   ERLGKNEVIDMVFKAFEKYPSWTVKDLADFCGQPVAFIQEIVSDICVLNKKDLKNAYEL
FT                   RPEYR"
FT   gene            <82752..>83369
FT                   /locus_tag="Eint_020740"
FT   mRNA            <82752..>83369
FT                   /locus_tag="Eint_020740"
FT                   /product="60S ribosomal protein L9"
FT   CDS_pept        82752..83369
FT                   /codon_start=1
FT                   /gene_family="HOG000039905" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020740"
FT                   /product="60S ribosomal protein L9"
FT                   /note="similar to ECU02_0800"
FT                   /db_xref="GOA:E0S5T8"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T8"
FT                   /protein_id="ADM11073.1"
FT                   /translation="MIPFIANFWRRLLKYQLKILSLMKILVTRTVKIPEGCIVKQEGKV
FT                   FTFEGPKGRIVEDCTRHPLTFDIYEGNVRIRLWNGKRKAAALAITVESLLKNAVKAVTV
FT                   GFAYTLKAAYNHFSINMEVKEDGKVLLVKNFLGEKNIKVFRMRGVARVRLDERKDTIVI
FT                   EGPSLPDVSQSAGTISNECKAKNRDSRVFLDGIFVTERGIMA"
FT   gene            complement(<83449..>83916)
FT                   /locus_tag="Eint_020750"
FT   mRNA            complement(<83449..>83916)
FT                   /locus_tag="Eint_020750"
FT                   /product="60S ribosomal protein L24"
FT   CDS_pept        complement(83449..83916)
FT                   /codon_start=1
FT                   /gene_family="HOG000184344" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020750"
FT                   /product="60S ribosomal protein L24"
FT                   /note="similar to ECU02_0810"
FT                   /db_xref="GOA:E0S5T9"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5T9"
FT                   /protein_id="ADM11074.1"
FT                   /translation="MRIEKCWFCSSNIYQGHGTVYVRNDAKVFRFCRSKCRKLFERRVN
FT                   PRKVKWTKISRKMANKELCNDPILEFEHRLNEPRIYDRKEVQKTLSSIPKILDIRKRRE
FT                   DFFIKDRILTGQEANKESDLEYIERHATLLESEVSFESHTTKAKKKEAQAN"
FT   gene            complement(<83969..>85297)
FT                   /locus_tag="Eint_020760"
FT   mRNA            complement(<83969..>85297)
FT                   /locus_tag="Eint_020760"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(83969..85297)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020760"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0820"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U0"
FT                   /protein_id="ADM11075.1"
FT                   /translation="MLDIGNPIGIINKFKSYRSVRIFIPDIPSSVCAAKIITEILHKEL
FT                   IRFEMDFQPEKVEHHSDQDLNVFIDLDPRECKNFLSLCGQENSSLQGSWFVCTCKPNWI
FT                   HSCMLAYSLAKAMNYVTTDVLWAMIVCFGFHRIFTKDLTPVDDLENESNFSDSICAGCR
FT                   ELHADLVFEIQRAGVLTDTDGLYYVERPCISFLNFTSLFSALQNDIPFVVSNKIYYKKN
FT                   KSAEAQRICEYLARKGISREASYELYGNLGYSTKALIESHFRKRKCFVKKIGYGIEVSP
FT                   IENFFLICHHLLKGARVDAFLCLSSREVLGMKESIKIHHELIWIYRDSLANIRKLGNIL
FT                   LFRINISETLKGMAIGVLVHLFEHYFDMYIRRRYSPSFRQMIIFQGYLEDRFIVTTDDP
FT                   PISSELFHRRERLGGYVVMNRNELFEIIAKVKTKTGEVSSIAV"
FT   gene            <85420..>85767
FT                   /locus_tag="Eint_020770"
FT   mRNA            <85420..>85767
FT                   /locus_tag="Eint_020770"
FT                   /product="hypothetical protein"
FT   CDS_pept        85420..85767
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020770"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0830"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U1"
FT                   /protein_id="ADM11076.1"
FT                   /translation="MNRYFCREILLLEEITTELLGSKEMDEETTHKAKLLLTIKDKLNE
FT                   KMMEMEEYYMKRIEFYRENDGTRAKELEKQTEECNEKYLGLLIRAKELGHQIERLEIKG
FT                   LRNKSCAGNEL"
FT   gene            <85985..>87151
FT                   /locus_tag="Eint_020780"
FT   mRNA            <85985..>87151
FT                   /locus_tag="Eint_020780"
FT                   /product="hypothetical protein"
FT   CDS_pept        85985..87151
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020780"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0840"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U2"
FT                   /protein_id="ADM11077.1"
FT                   /translation="MAGERAEYGGIAGGQELIYHFQEDSDDLGVEKEYEENEPNSLRLR
FT                   NFVEDELYQSDGQMQYRGEDEMRLRYGRKKKEKRKKKKNDENKRPSNRKIVNLPASPPY
FT                   VRFVDGEERLCFKYVTKVSESARDAMPKTDLEDNEFCVRFDLDSVDISKLNEKFKADNC
FT                   VYPRANLPYEMYTGNRWGFETECNRLAWQFVSLNPVLLYGKKGLIQRAVDSYRTINKQS
FT                   RNKRIVKEDRFPSDIEKRKHVSGAPSTITIQWTNRGILKKCKIQVNIENINYGKIDDEF
FT                   KSRFSVFMDDFDDKSFGKSKWESHNVDNELAVKIAFLNVENTSFWNAIKALDKTTVLKK
FT                   AIEAYKQKRDEYASSDDDTEMSDVIASALGSSLGNSKSCNVENFYFDN"
FT   gene            <87271..>88767
FT                   /locus_tag="Eint_020790"
FT   mRNA            <87271..>88767
FT                   /locus_tag="Eint_020790"
FT                   /product="protein disulfide isomerase"
FT   CDS_pept        87271..88767
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020790"
FT                   /product="protein disulfide isomerase"
FT                   /note="similar to ECU02_0850"
FT                   /db_xref="GOA:E0S5U3"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U3"
FT                   /protein_id="ADM11078.1"
FT                   /translation="MLLVYLLGCLAEIVEQCKPINEGYVLSKYFAQWCPACQNMGPLIE
FT                   EISNKIDRHEANLKIRSVDCDECSCPNVKSYPTLEMSKDGETLGKLEGPQDYDEIIEFI
FT                   VNHTGIERSVFEGHAAQKEAEVRRLNKNDFLSGFDGPHIVLFYSREDDKYREIFKEIAK
FT                   IYNGKLNVGEIDSAESAEFVNRYDIRSYPSISGIYNGLVVPFIEKGKEPSMPNLIEFCD
FT                   KLIEQSFANLTLAKFGELASKLEPGEPIYVVFHKNLALANAYFQRMAHMYKFRASIYRS
FT                   DDQALFEKASIFPKELGSGSDTTSSPNHEDVVILSVYKNGVFYRYSDTFGDETKITDWI
FT                   FHTHYRYLTRIDNHNFYSIFHGLKPVMILLTRGEELVNKMNEFSADRHLGVPYTDMIFA
FT                   TMEIDEYPLFVPTLLPRLSTPALIVFEPWRNLFRHKKAKLTEDNFISTAMDTYTLYQNN
FT                   RLPLYPPKSHNVLKYCLLGGLVLGVGLYYSSKAGFAKKNK"
FT   gene            <88827..>90095
FT                   /locus_tag="Eint_020800"
FT   mRNA            <88827..>90095
FT                   /locus_tag="Eint_020800"
FT                   /product="serine palmitoyltransferase subunit 1"
FT   CDS_pept        88827..90095
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020800"
FT                   /product="serine palmitoyltransferase subunit 1"
FT                   /note="similar to ECU02_0860"
FT                   /db_xref="GOA:E0S5U4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U4"
FT                   /protein_id="ADM11079.1"
FT                   /translation="MKLIYILGDLLISYWKDILKVVIETLVIYLVVRFRYRSNKDVIIF
FT                   PQNVIDKLVAEFDPDDLVKDVPSDVMLPSVYKEGMVDLANFDVFGLAMENKKEIVEAIR
FT                   KYGVGTCGPRGFYGTLDIHLDLERTISRELGAEASIVYPNSFIAVNSIIACFCKQQDIV
FT                   FYHEDCNEAILRGIGLSKSKNIEFASISDLEIKLEYFTRPKVRNFVIIEGLSKNTGKIV
FT                   DIKKILELRDKYKFRIILDESYAIPLLNKRGVCGANGVSIKEIDITIGSLSGGLCCGGA
FT                   FSLGTYHAVDYQKLSGSSYCFSASLPGALAKAAILNIQREFDYEGLRNRVELFHATFES
FT                   KTYEIMSSPLSPIVIVVKKREVRRPMSREALLKEVLDIRSELLKNGIIVGFNHNPYPSL
FT                   RICLKAKIPRDDVTRLAVMLNKW"
FT   gene            <90424..>92313
FT                   /locus_tag="Eint_020810"
FT   mRNA            <90424..>92313
FT                   /locus_tag="Eint_020810"
FT                   /product="hypothetical protein"
FT   CDS_pept        90424..92313
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020810"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0870"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U5"
FT                   /protein_id="ADM11080.1"
FT                   /translation="MGICRNKDFVIVSEKNEILMMDIMTLSVFHRRECGVNSPVACSNE
FT                   YVFIGDGCGVMALGLLDLKEREVCRMKTPVTAIFHLDGFIYCGSEEGTIYVYGGGRKED
FT                   GDVGEGKDSMDFLGSELSNEMFSMDDGGFKLVKTMKHPGPVTQICSDGTEVFVADMRNK
FT                   VTVYPSKKTYDIKNPKLAYKNYIFASERNMLYCKTRNAFATYLTTEKPISGYTFSMNGG
FT                   VLFAQCRDTVDVVDFNTKKVVKKVEVAGKFVYDDVRDRLVWFDGKRLVAVENVLEREYK
FT                   GMDGIMFREDGLVEKKIKIDEEMDENIVEKYREDGLWKKPPKRKYFRASSEGENGLGEG
FT                   GEEKKEVVDPDEWVEEAKTKGKDSLGRSKLEAEPGSLLCYNTEGYMTCIGDEERGRIEI
FT                   NYHDVSRRRIEVDGIQGCTIGSFCQDNIIVGNGKKIFYIGPSSRWEKEVEASIVSVSEK
FT                   MVVSFSGELRVFGLDGSEMLNCLIPDVSAICCRSDIIVVFSREIIVIDLFKSTERFFLP
FT                   SPVDFACFDEGEKVFYRINGKMYQLYKGLSVRVCEAPKQPLAVFKGNVISLGPSRRLFP
FT                   SPHVEYTQFDVFDPCRSKEPMGSTEDEEVLCSEDYENKNVEVSKSKRYNPLKK"
FT   gene            92384..92455
FT                   /locus_tag="Eint_020820"
FT   tRNA            92384..92455
FT                   /locus_tag="Eint_020820"
FT                   /product="tRNA-Pro"
FT                   /note="tRNA Type: Pro, Anti Codon: AGG, Cove Score: 57.82"
FT   gene            complement(<92521..>93074)
FT                   /locus_tag="Eint_020830"
FT   mRNA            complement(join(<92521..93038,93071..>93074))
FT                   /locus_tag="Eint_020830"
FT                   /product="40S ribosomal protein S8"
FT   CDS_pept        complement(join(92521..93038,93071..93074))
FT                   /codon_start=1
FT                   /gene_family="HOG000211544" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020830"
FT                   /product="40S ribosomal protein S8"
FT                   /note="similar to ECU02_0880"
FT                   /db_xref="GOA:E0S5U6"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U6"
FT                   /protein_id="ADM11081.1"
FT                   /translation="MGINHRGDHKRRKTGAKAVISRKKRNNRAGSQPSATKIGERRVIP
FT                   VRVRGGNKKYKALRLDVGYFRFPSTGKTRASKLLQVVYHPSSNDLVRTNTLTKSSVVKI
FT                   EAEPFKEDIETIGSSTDPELHENFEKGHLYGIITSRPGQAGAALGHVLQGSELKFYTEK
FT                   FNKKSKETRK"
FT   exon            complement(<92521..93038)
FT                   /locus_tag="Eint_020830"
FT                   /number=2
FT   exon            complement(93071..>93074)
FT                   /locus_tag="Eint_020830"
FT                   /number=1
FT   gene            <93227..>93730
FT                   /locus_tag="Eint_020840"
FT   mRNA            <93227..>93730
FT                   /locus_tag="Eint_020840"
FT                   /product="hypothetical protein"
FT   CDS_pept        93227..93730
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020840"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0890"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U7"
FT                   /protein_id="ADM11082.1"
FT                   /translation="MVSMSSFNILSLRSPMIKAVRDAKNTVVIKAIFSVIKKNIPSKDK
FT                   YFLSNHFSLFLTPEVSETDSSDFKNKDFFYGKARWIQKVEGISDVIVCWAPKIFACYAC
FT                   EYWFYTICCSFFSNSDQRISKGGFHCFYCRGVHYKDLPDPFPGGFLGQSTEGSSKTRNS
FT                   SLPG"
FT   gene            complement(<93912..>94253)
FT                   /locus_tag="Eint_020850"
FT   mRNA            complement(<93912..>94253)
FT                   /locus_tag="Eint_020850"
FT                   /product="60S ribosomal protein L35A"
FT   CDS_pept        complement(93912..94253)
FT                   /codon_start=1
FT                   /gene_family="HOG000195636" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020850"
FT                   /product="60S ribosomal protein L35A"
FT                   /note="similar to ECU02_0900"
FT                   /db_xref="GOA:E0S5U8"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U8"
FT                   /protein_id="ADM11083.1"
FT                   /translation="MSKPIMSEEVLSRTTIPATFVSFKRGLRRLHPRYALLKINNVGSK
FT                   IEAEKYVGNGVVCFKTSTEGEKYPVHGVVTRIHGNSGAVRAKFTRNLNPKQLGTHVFVK
FT                   LYKVEADEI"
FT   gene            complement(<94286..>94618)
FT                   /locus_tag="Eint_020860"
FT   mRNA            complement(<94286..>94618)
FT                   /locus_tag="Eint_020860"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(94286..94618)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020860"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0910"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5U9"
FT                   /protein_id="ADM11084.1"
FT                   /translation="MKRNYIQELSTKHLVCDYERIKREYLRYKAKNIDTLEYVDDAMLA
FT                   VYEHAFFFNFTKTKFSKKDLPKEVKPRILKAALEEVKKKYVPNKSTEEKGLVCNLYSIT
FT                   NTLSFQ"
FT   gene            <94676..>95272
FT                   /locus_tag="Eint_020870"
FT   mRNA            <94676..>95272
FT                   /locus_tag="Eint_020870"
FT                   /product="hypothetical MAD domain-containing protein"
FT   CDS_pept        94676..95272
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020870"
FT                   /product="hypothetical MAD domain-containing protein"
FT                   /note="similar to ECU02_0920"
FT                   /db_xref="InterPro:IPR008672"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V0"
FT                   /protein_id="ADM11085.1"
FT                   /translation="MEELYRKFSETLRENTSLRHQIVDLESALSSKEQELLMAKESSGL
FT                   GQYLRRIESLERENKRLKDMVERAGQDNCEGENINPNAIMSEEKTENGTHRSETKDPSG
FT                   ELRQYLKTIREYVTGLTGYKMEFRDGEIIFHSLYAFDSEDVFIFRYKSGNMELVNNDFA
FT                   ASWATEVQNYLIAGKSIPAFLAAVTLELFNKKTFG"
FT   gene            complement(<95324..>96805)
FT                   /locus_tag="Eint_020880"
FT   mRNA            complement(<95324..>96805)
FT                   /locus_tag="Eint_020880"
FT                   /product="pre-mRNA 3'-end processing cleavage and
FT                   polyadenylation factor"
FT   CDS_pept        complement(95324..96805)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020880"
FT                   /product="pre-mRNA 3'-end processing cleavage and
FT                   polyadenylation factor"
FT                   /note="similar to ECU02_0930"
FT                   /db_xref="GOA:E0S5V1"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V1"
FT                   /protein_id="ADM11086.1"
FT                   /translation="MDVEEKTGIEMGSPSAIMEHARDLYTSKDYRSLESLFGKCLKKSY
FT                   NLELWMLYIEYVRKVSQKKFKLYEVYEFTLGQFENYWDSYGLYKEYIEELGKIEDEQTR
FT                   IEKIRNGYMRALQTPMSSLSELWKDFENFELELNKITGKKIVSDTLPIFQSSFQRYQQM
FT                   QPLIRSWSVKNAAKLIDLEMENGMKLGGRTHESRMHFIYNYILDSFYYAEEAYFFYSEY
FT                   LIGIGQKEKAKKVIQRGIEMSDGMFLSLYYGLVMDEEEVYGDLKKKYFYQENEDGGKSS
FT                   GREADLLRINHLNYVLKKRGLESFRKLFIEVGNEGIGPHVFIYCAFVEYYATGSRTTPY
FT                   NIFSSGLLKHPDSTLLKEQFFLFLLRIGDEENARALFKRLEKTSRMWDSMIEYEFMIGS
FT                   MELFRELVDQKMSSIKDNAILPALPEREKDIQMEGILGRYHCFLNSFNFLDLKIKDNSR
FT                   LLDEFMESLPKISQQNNVLSNLKPDKIVDLLKCIQ"
FT   gene            complement(<96861..>97793)
FT                   /locus_tag="Eint_020890"
FT   mRNA            complement(<96861..>97793)
FT                   /locus_tag="Eint_020890"
FT                   /product="thioredoxin reductase"
FT   CDS_pept        complement(96861..97793)
FT                   /codon_start=1
FT                   /gene_family="HOG000072912" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020890"
FT                   /product="thioredoxin reductase"
FT                   /note="similar to ECU02_0940"
FT                   /db_xref="GOA:E0S5V2"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V2"
FT                   /protein_id="ADM11087.1"
FT                   /translation="MENIVIIGSGPAAYNAALYTMRGNPLLFEGGYIGNNGPGGQLTTT
FT                   TSVDNYPGFPGGIEGPELTQLMKEHAVSRGLRVVKETVSDVRKEDEWFVVSSEKGEKKA
FT                   RIVIVATGASARRLFVPGTGDDEFWQKGVSSCAVCDGFIYVNKVTCVIGGGDAAMEEGL
FT                   YLSNIAKKVYIIHRRNEFRARSDMIEKARNTENIEIMTPYVLERAEGTNKIKEIVVRNT
FT                   ETGETKTIPMDGVFFGIGHDPNTSFLKSVNVDLDSNGYIVVKDDACTSVPGLFAAGDVC
FT                   DRKYRQAVTAAASGAICGIKAMEFLDKNK"
FT   gene            complement(<97852..>98490)
FT                   /locus_tag="Eint_020900"
FT   mRNA            complement(<97852..>98490)
FT                   /locus_tag="Eint_020900"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(97852..98490)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020900"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0950"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V3"
FT                   /protein_id="ADM11088.1"
FT                   /translation="MGGDVYSLDKAVKSKKKKGVPQDVIEEAERIEEQNYERAKGVRMQ
FT                   LDESALKQKATTEELMRQGETLENAKRAAVGINVNARRGSEITEDIEREGRVFSCELPC
FT                   VRAIKRWFRRDRGGIDDIVNRGQEEENDVEQAPKHVEFEEGEEYIKGQNKTDREMVGVL
FT                   NTVRQIRVEADKQNKEAARHKSIVNDISMINERSSKVIRETDKELKKVE"
FT   gene            complement(<98575..>99177)
FT                   /locus_tag="Eint_020910"
FT   mRNA            complement(<98575..>99177)
FT                   /locus_tag="Eint_020910"
FT                   /product="putative membrane integral protein"
FT   CDS_pept        complement(98575..99177)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020910"
FT                   /product="putative membrane integral protein"
FT                   /note="similar to ECU02_0960"
FT                   /db_xref="GOA:E0S5V4"
FT                   /db_xref="InterPro:IPR000348"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V4"
FT                   /protein_id="ADM11089.1"
FT                   /translation="MIFVLYLGIIFAEIFSVRRKRNIEVEFDVIENKICKGYLKPINCK
FT                   NSSFKAVLASESGSVYLSNENLPVDTETHFSFNISEPKVLSMVLTPIVIDETQPHTFGE
FT                   IELNFSAQFDTFKKDVAKKVSVEPAMAAMTKLDNLLYELNNESEYLAHRMGSVDYEHRR
FT                   MFSFVTVFSVITLVIYFGVNSYELYSLKKFFQKKKMI"
FT   gene            complement(<99251..>99748)
FT                   /locus_tag="Eint_020920"
FT   mRNA            complement(<99251..>99748)
FT                   /locus_tag="Eint_020920"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(99251..99748)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020920"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0970"
FT                   /db_xref="GOA:E0S5V5"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V5"
FT                   /protein_id="ADM11090.1"
FT                   /translation="MSREDGQKVNHDVFGLMYTSFINKVIKDGPEGSRERLFTIGKRIG
FT                   ERMADDFFFTGKPEKPMGLGEVSKDISESFFPYYFSFHPTHNQGIISLGRLPLLQYTGK
FT                   EEECLEMICGILQSVYGYVSKDGIRFEAMKYKGEHCIVVRDGEHVEGPSAVRLREGEFR
FT                   EI"
FT   gene            <99780..>100232
FT                   /locus_tag="Eint_020930"
FT   mRNA            <99780..>100232
FT                   /locus_tag="Eint_020930"
FT                   /product="hypothetical protein"
FT   CDS_pept        99780..100232
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020930"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0980"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V6"
FT                   /protein_id="ADM11091.1"
FT                   /translation="MQSSSHRAGKDASQEGLESVEFLDHLADIQMHCTATSLPALYEVA
FT                   VKGMMSYAVRIPPAAQGTGRVELQEGSSEMNMVGLLTYFIDMMYGEGLVVSEVSVQLKD
FT                   GHLFCDYSVASGSECQSLCEIKAVTLCGLKIFEEENVFHLYCIFDV"
FT   gene            complement(<100302..>100961)
FT                   /locus_tag="Eint_020940"
FT   mRNA            complement(<100302..>100961)
FT                   /locus_tag="Eint_020940"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(100302..100961)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020940"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V7"
FT                   /protein_id="ADM11092.1"
FT                   /translation="MRLLMVSMTLTFSVFCSAEDSSTKSTDNIFKKFLEVAVKDEHHRL
FT                   LPTKGKHSPSHSKDLENPAPRKKTVIVVEEDSGKKNVVLNSNAEQKLPSILSEVEKKTT
FT                   PSRYHESKTVSDDAPKPEVQSELTFETPISASFLLKPLSPKKEISLTRAEIKEIGEELK
FT                   ALEKISKDLESLRSRFQTTLKRLQGPEKEEKETKPPTDLLNYNFIEVTETGQPEKK"
FT   gene            <101059..>101847
FT                   /locus_tag="Eint_020950"
FT   mRNA            <101059..>101847
FT                   /locus_tag="Eint_020950"
FT                   /product="hypothetical protein"
FT   CDS_pept        101059..101847
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020950"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1000"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V8"
FT                   /protein_id="ADM11093.1"
FT                   /translation="MDFVPPAKQRELRSALEKIESGIVVVHGPPGSSKTYSIERTAQGL
FT                   GLSIEYIEDVGMYKSMLPIRNAICLTDMDDYEYLSRHRKRLEKMKNLVIETRTLFSIGK
FT                   ILPNATIVNFGKISSRKIQKFYNLNEKEALKVGENLHAVGFCKYGIRSETVSIFHLLGK
FT                   LFHSKETDVPKAAEMINVYGRDRFIGYLIENCTSFMSIKDIHKLIDGISLEDIGEMHLE
FT                   HLIWVVLSSVKVGPRRFFSFRSWKGAVLSEHTCSNLCMNR"
FT   gene            <101910..>102590
FT                   /locus_tag="Eint_020960"
FT   mRNA            <101910..>102590
FT                   /locus_tag="Eint_020960"
FT                   /product="hypothetical protein"
FT   CDS_pept        101910..102590
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020960"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1010"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR019589"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5V9"
FT                   /protein_id="ADM11094.1"
FT                   /translation="MSFSKIKPKSYEGKMEEWLSAISMKVTDLNSLVLDYLVHEGLGDI
FT                   AAEFARDVGLPFTASSFLSHRTRIRDAIEEGDIKKAISRINDLNTEIIDGNIELYYFLM
FT                   EQKACEQAQAIRSEGESTEEQKVFILLEEVLEFIRSELSPIVEENPALGPHFEDLLEFV
FT                   VFNSRKEAVVERRRRLAEYINRNILEKYEVTENELKKVLDGIVKGERLLTEKYKFPTFN
FT                   ESFI"
FT   gene            <102931..>103152
FT                   /locus_tag="Eint_020970"
FT   mRNA            <102931..>103152
FT                   /locus_tag="Eint_020970"
FT                   /product="small nuclear ribonucleoprotein E"
FT   CDS_pept        102931..103152
FT                   /codon_start=1
FT                   /gene_family="HOG000223543" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020970"
FT                   /product="small nuclear ribonucleoprotein E"
FT                   /note="similar to ECU02_1020"
FT                   /db_xref="GOA:E0S5W0"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W0"
FT                   /protein_id="ADM11095.1"
FT                   /translation="MGGEPKSILPLEKIYAFLSRAADVEIWEKDIGVRHKGRIVGFDEY
FT                   MNIVMDSGAKRYLLKGDCISVVFGKDID"
FT   gene            <103386..>104903
FT                   /locus_tag="Eint_020980"
FT   mRNA            <103386..>104903
FT                   /locus_tag="Eint_020980"
FT                   /product="hypothetical protein"
FT   CDS_pept        103386..104903
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020980"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1030"
FT                   /db_xref="GOA:E0S5W1"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W1"
FT                   /protein_id="ADM11096.1"
FT                   /translation="MFVLHLVVTLCSSLERALLEEGDIEHATRLCGTREGPLDYFYSYF
FT                   VKKVFMGKEKEALLDIVESDNYGDARNIVLGIMSMESGKTNEKAKLAADLLWNVATKVS
FT                   RRYLKNPHVFLATEPFGKLERNFLSKKGVENIVTMVYSGDDISARLFLSLLDNRKIYIG
FT                   DYVDVIEFLAKNDHARAFGYLGEIYYHGIRMKKSLDEAMYFFSRGREMQDTVGACGVGK
FT                   VLMSDEYRDYKNAKSALLLANKLGQSGEAEYLMYLLMSRRPEYMHKASSHMDSALMYGY
FT                   LPAICRDGMNYYTSGQYMNACIRFHPIIEYSDIVYNLRRRAEASFVSRRYRQCVIALLM
FT                   CAELGSVSSMRNAVYVLQRHSVFERQKEMLFGLYMRLLSKEDKDAINRIGDAYFYGEGV
FT                   EKSYNDAFAFYMSAALTGDPEGYYNVSYMYEHGYGIKKSLLLAFKYILKISPGDDTYLL
FT                   LLYTHIRLFSKFVTYLLFNKYSISVWIGALVVRKMYISKRSTKDLKD"
FT   gene            complement(<105074..>105589)
FT                   /locus_tag="Eint_020990"
FT   mRNA            complement(<105074..>105589)
FT                   /locus_tag="Eint_020990"
FT                   /product="gluconate transport-inducing protein"
FT   CDS_pept        complement(105074..105589)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_020990"
FT                   /product="gluconate transport-inducing protein"
FT                   /note="similar to ECU02_1040"
FT                   /db_xref="InterPro:IPR018608"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W2"
FT                   /protein_id="ADM11097.1"
FT                   /translation="MADIESFHGRIENESDCLVLIDLARRGLIPRIQRRLTSRERKKIG
FT                   HGSIFVYCEEESRIKRWTDDMSWTPSRVQGVFLVYKQLLSSSPMMKRTYSATCGDRSFH
FT                   IVGYLQIHSHHTLLPSVSILYKGIDFPTDIKIKKKLSFLEERCLKNSPKTMESQETHED
FT                   FPFDIYWY"
FT   gene            complement(105688..105758)
FT                   /locus_tag="Eint_021000"
FT   tRNA            complement(105688..105758)
FT                   /locus_tag="Eint_021000"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA Type: Ala, Anti Codon: TGC, Cove Score: 55.01"
FT   gene            <105838..>106311
FT                   /locus_tag="Eint_021010"
FT   mRNA            <105838..>106311
FT                   /locus_tag="Eint_021010"
FT                   /product="Gal4 DNA-binding enhancer-like protein"
FT   CDS_pept        105838..106311
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021010"
FT                   /product="Gal4 DNA-binding enhancer-like protein"
FT                   /note="similar to ECU02_1050"
FT                   /db_xref="GOA:E0S5W3"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W3"
FT                   /protein_id="ADM11098.1"
FT                   /translation="MSRTLAPDELHIHKTIASKVDLEEMESVESVSVIAMNMRHSIVSP
FT                   AVYKIKGTDSLLIFGSIGNSIDLRELQKMYENSVKSSETEEHAGLYSSIGDNLQKEDEQ
FT                   KPEEVPVEVDNERLSEEDIKLISQQVKASRSEIIRALAESDYDVVNAMIKLTK"
FT   gene            complement(<106319..>107287)
FT                   /locus_tag="Eint_021020"
FT   mRNA            complement(<106319..>107287)
FT                   /locus_tag="Eint_021020"
FT                   /product="protein prenyltransferase subunit alpha"
FT   CDS_pept        complement(106319..107287)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021020"
FT                   /product="protein prenyltransferase subunit alpha"
FT                   /note="similar to ECU02_1060"
FT                   /db_xref="GOA:E0S5W4"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR008940"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W4"
FT                   /protein_id="ADM11099.1"
FT                   /translation="MIIHNIEEGEYIEDKEALEGLLNLRLQEESIEKHKAIVQVVADDY
FT                   YSWNKLKDYLLLNPSDFRSQLKVCENALQGNPKSYQPWYHRKFMMENFKEQREKYLGRE
FT                   DFLTKLLLDSDPRNFHCWSYRMFFLKTKTGRDVFNYSYLHHHPDSEDPLTIIYTDPMDP
FT                   TSWEYFYLWRERKRIRHGMYIRRFRNRLEILLDKPFCGELSFESGGTRKTMAFELHTRI
FT                   VVIDESIRTSERWKVVINGEEMRFIPEEESFRFVREILEEEPECYEALLVLLDYTEEEA
FT                   ERIAIIERIASLDPIRRGYYDTLKENFYCVYVPEIEGTPIE"
FT   gene            <107362..>108840
FT                   /locus_tag="Eint_021030"
FT   mRNA            <107362..>108840
FT                   /locus_tag="Eint_021030"
FT                   /product="hypothetical protein"
FT   CDS_pept        107362..108840
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1070"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W5"
FT                   /protein_id="ADM11100.1"
FT                   /translation="MDRIERFLGRRPVKGRRKVQSQGKEFLITKEDVKLIRSYKKNICM
FT                   DPDVDLYRPLNLSFSRKTMNEGMETRKKVVVPRAGGRPKKKERSIRKEVKKRDKNEIVD
FT                   IWEEEGLEELNSYEQDMVVKVGDAYTGAVEALRYGREDLEGSLRRIYLRLYEPRDGKNY
FT                   RLRDLIKELPKTETLRPFPEEIGLSFKFSKAIRVGISQDFKKFGVGEGRKLGIYEFKNF
FT                   VKLRHILFDSEIRKIMFARNGSICTLLADNTICVVDDIYGGDAESSKESFISKEFPAWS
FT                   RKEAEEGAERNAFVCTVINPEGKINDIEAHEDGKHIIAVCGKKIMVYNLKERIGREVLR
FT                   VRGATPLKAKFHRSLSTMIVSTTNSLIIYDLVSKEIVREAKEFSFVLDFFSVEESKVAV
FT                   VNNTNKIILYDWLKNNVQRTMLQEDVGMEVVQHGRLNLMCVAYPTEMVVFYNDVTNDLV
FT                   VPVKRIPGRYRDISFHPHLPWLYGVGGNRLDVFT"
FT   gene            <108922..>109380
FT                   /locus_tag="Eint_021040"
FT   mRNA            <108922..>109380
FT                   /locus_tag="Eint_021040"
FT                   /product="monoubiquitin/carboxy-extension fusion-like
FT                   protein"
FT   CDS_pept        108922..109380
FT                   /codon_start=1
FT                   /gene_family="HOG000233943" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021040"
FT                   /product="monoubiquitin/carboxy-extension fusion-like
FT                   protein"
FT                   /note="similar to ECU02_1080"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W6"
FT                   /protein_id="ADM11101.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPGDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGAKKKKKDFSTPKKVKAPHAKKGLSWLD
FT                   NFTVTEDKVKVNLVSCEACGVEIFCRKTASGLKCGKCNRVYSEGVTSN"
FT   gene            <109482..>111518
FT                   /locus_tag="Eint_021050"
FT   mRNA            <109482..>111518
FT                   /locus_tag="Eint_021050"
FT                   /product="Rad3/XPD ATP-dependent DNA-binding helicase"
FT   CDS_pept        109482..111518
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021050"
FT                   /product="Rad3/XPD ATP-dependent DNA-binding helicase"
FT                   /note="similar to ECU02_1090"
FT                   /db_xref="GOA:E0S5W7"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W7"
FT                   /protein_id="ADM11102.1"
FT                   /translation="MARIKISGVPIEMPFEPYPAQIVTMTKLISCLTTGTSGLVESPTG
FT                   TGKSLSIICAVLGYSEYLKRGAKSINVKRREGGSLKGEEAKEEKLKIIICSRTHKQLDQ
FT                   LIEQLRKTHYRPRISILASRSQYCISPKLGDVTDKNTGCNELVKSGSCAYFTGKDRLAK
FT                   RVGDRIFDIEELKGEGRRCGGCPYYASRILNEDAEVIFAPYNYLIDSRIRENTGISLEN
FT                   SVVIVDEAHNIEDVCRSSGSIELSSRTIEIIQNEILGAIRRSGMLGEIKLDFVNLMDFF
FT                   RKLREGAESTDGFDRTTFGGKLRIRKGKEIKDELEKMGITKEFVLKIKNSIYAIQKNED
FT                   AKDLLNMSTFHVLEGLDSVLSAIHFSGCDAYSFVFQKTNDENIRNSRLSKFSYNFWLLD
FT                   AGYTFRSFVGKVRSIVLLSGTLTPFSSFSSELGHDFTHSIVAPHLVTEKQVFASCVRKG
FT                   HLLKDLTGTYGVSDTPQYLDQLSRIIVDVSNKVKSHGGTLVFVPSYSFLENLQKRMGGE
FT                   SSGLLIEPKSGGGNEFEKVMKRYKNRIATKQRAIFMCVYRGKASEGIDFKDSFARAVIA
FT                   VGIPYPSLHDPQVELKKEFNDRYKSFNGRLWYEAQAFRAVNQALGRAIRHKDDWGIVML
FT                   LDSRYSEKRVQTHLSKWVTDNIRVHDSYDTCASELSGFLSLIK"
FT   gene            <111627..>113696
FT                   /locus_tag="Eint_021060"
FT   mRNA            <111627..>113696
FT                   /locus_tag="Eint_021060"
FT                   /product="Hsp90-like protein"
FT   CDS_pept        111627..113696
FT                   /codon_start=1
FT                   /gene_family="HOG000031988" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021060"
FT                   /product="Hsp90-like protein"
FT                   /note="similar to ECU02_1100"
FT                   /db_xref="GOA:E0S5W8"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR020576"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W8"
FT                   /protein_id="ADM11103.1"
FT                   /translation="MSSKQESLAEGTIKDKHPETHGFEVDVNQMMDTMIKSVYSSKELF
FT                   LRELVSNSSDACDKLKSLYYELNSKGCDLDPVTSLSIEIIPNKTNRTLTIKDNGIGMTK
FT                   PDLMNFIGTIASSGTKKFREEMKEKGNAADASNLIGQFGLGFYSSYLVADRVDVITKHP
FT                   EDEALVWTSTGRDVYTIEEYTGDSFSHGTSLVLYIKEGEEEFLDPKKISEIVKKYSLFV
FT                   FYPIYTYVEKEIEEPSEEKEEEKEEKATEETTEPKVEEAKEKRLKKVTQREQINAEKPL
FT                   WKRNIKEVPEEELKSFYKTISEDWDDFLAVDFWRVEGLLSIDLLMFIPKRARFDMFNRN
FT                   KKNNNIKLYCKNVFVTDDFGDSIPEWMSFVSGVIASDDIPMNISREMIQGTNVMKLVKK
FT                   ILPQKIFEMIGKLAMDAEKYKTFYKEFGNCIKMAIGEASEGQQDGYAKCLRYFTTKSGE
FT                   EMVSLDTYVERMAANQKQIYVITGLGKDQVKSNPALDAFQKYEVIYMYDVMDEVMLRGL
FT                   KKYKGHAIQRITSEGVELPEDEENNEEIVKSFEEFCKKAKDLLSNKVEKVTVNPRLVSA
FT                   PAVISTTKYSLSGTMENIMRSQPVTEANPFAAMTAVSKKIFEMNPHHKLVKNLKTLFDN
FT                   NEIEKMGKMLELFFETVLIHNGFMLSDPKTFCANVFEFLCSSEVKSEELVEEVQ"
FT   gene            <113770..>116280
FT                   /locus_tag="Eint_021070"
FT   mRNA            <113770..>116280
FT                   /locus_tag="Eint_021070"
FT                   /product="hypothetical protein"
FT   CDS_pept        113770..116280
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021070"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1110"
FT                   /db_xref="GOA:E0S5W9"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5W9"
FT                   /protein_id="ADM11104.1"
FT                   /translation="MEVKLCEDAWKVLSAIKQTIVSERMKDTPENVTEAAIETFLEMSR
FT                   RNDHSKVEELLQIILAHKNYITEKSSTELVRRILLSFKEKKVYLQGLRVIKHFVKSGRY
FT                   HMSHFKILVEDCFGRKSLKTRSVELAKRYLELEEFRKELLGYISKLEGTDLIRHINCFF
FT                   DSIADGIDVVEKLDSFVNPDVFEGMETGEARALYSECCDMLYKYTLMEMEVGIPDEKVF
FT                   EYIVKKLQILFEIPFPRGGKLLETLSLLAEKDLVVSLRSKQHLMRWDKNLKREVVKELC
FT                   ESNLKNDKIYEFIRSVRHVLVPEFMDLIRHMARNFVEGDDKYRFALGAVAGIIGIEDLF
FT                   LVLEDMEIEIRTWAPIIRCSSNGDISFFIKILRDVEERKGVESIDRTILLNCIPAFCNY
FT                   ATDRTGSIEGLLQIMKANLGNSNVFNSICTGLRKLMHSHENNIKNNLILRNPIPPGESE
FT                   RILHSIRKSEIALDILSVGIGKCSDELDQTLFKLLETDDFGLSSRIFQYILLYPQIESV
FT                   TVGKWNLSGISDVMKVARYFVPKMNSDFEIYSKLMEFCLSEDGGAQKRAYQLLYHMKKH
FT                   QKIDLCICDTLFSHETDEKTKDCSQKWRIALIYSVYTVGCKCFSERKKEYLNRMLPVLV
FT                   LGLKTGNAKARKVCQENLDELVSGFSSSEFDFYCRLMVAGTASENVVLRCGILEASVAL
FT                   IESHRERLSQEFIQSMYDGCLSTSRLGRETVPHVLKFLNILVSTYAVNPQGCLEVLELY
FT                   ADKFKRRYAEDVKSIVSRLIRRDVEIPKSLRLFLKERKRKGPRATLQITKKNNVMITQG
FT                   KQKQESIPFSGHRRTVKRNKRHKK"
FT   gene            complement(<116353..>118164)
FT                   /locus_tag="Eint_021080"
FT   mRNA            complement(<116353..>118164)
FT                   /locus_tag="Eint_021080"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(116353..118164)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1120"
FT                   /db_xref="GOA:E0S5X0"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X0"
FT                   /protein_id="ADM11105.1"
FT                   /translation="MNWEDELMALGVPYTERKRNSPLRKKLSIIKKLKNINSESVEAIK
FT                   SDLEKEDMSKFTSEIVTSILLSKVQSTDDIKSVVRVTSALTSCSDFMRLLMSELGKIIN
FT                   HGIEETEKYWLAAFFFDLQTLSRRTVDKEERRENLIRDLCNKISEKPRILFLGYIMENY
FT                   KDELSQAEVSNQAKRIDPQTSEDRGGRLDVVARSLGIKVCDEGYDLKKMADVENEEFHY
FT                   YTGRTASLECYDGGLDIKEIRDYIIMHSGDTEKLDALSKSIKNVNNQKEVVFMLMQLKL
FT                   NPNFISSIARILKNMGAVARKVVAVLFREIYQAKNPSHNDVISNCLLISEMCKFREVSS
FT                   DEMFGLLDYLFKTKNIEAYCMCLNGIGRYFLLNEATSHRIREFIERIRNYRASKVDFVH
FT                   VNNCLSRLFSPSQSILCADYTGFFRYFFRKEAFDGDSLLWSCLIKSKATLMSIFLHPWV
FT                   FEDIDFLASVVHKAEISMQVMNVIIPSIEIMYGYSKHKSISLARLYSSLMLLENKDTWA
FT                   YLVDRALQLKVGASFRCKIAMMLLQKMPIDMQRQYFSVLRDCVNKEESLDLKILFTNFC
FT                   ESIGMEAPTMDYDDSFDEELNFVRSYA"
FT   gene            <118224..>123647
FT                   /locus_tag="Eint_021090"
FT   mRNA            <118224..>123647
FT                   /locus_tag="Eint_021090"
FT                   /product="PI3/PI4 protein kinase"
FT   CDS_pept        118224..123647
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021090"
FT                   /product="PI3/PI4 protein kinase"
FT                   /note="similar to ECU02_1130"
FT                   /db_xref="GOA:E0S5X1"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X1"
FT                   /protein_id="ADM11106.1"
FT                   /translation="MNRNYLKNLYLQQLESERYSDVFRESLHSLVSVEIMNTVILLAVK
FT                   DDDEDALIDLLELFLQHLETNPIFYEKLGKSNLHLLLLERPLRMQSYTKLKLVYDKVRP
FT                   KRTPLSFEHTEFLAKNFYNYCLYKYAYNDYQFDLEMSVEGFGPVEMNLFKDLLRKICIE
FT                   NRENEHLANYVRTLPMDTNVFLAIVEPDFKVDASKLEPEDLFVVYPAQVQRCNLGLFTK
FT                   PFLCSLNSKEGLCRVCGRRVLEYHFEEIDHEEYLESIAGNIKEICFAVSHWEKARTPRV
FT                   LITVLRSLFKGCEDLECYKSLKYFPVKEESDMEDIVVKFLRYAASTLNIENIQVSLRML
FT                   PFTSHTPKVIFSYFVILFESLRKYPENGFLRSIVKNVVMRNKDKFMKIRAMIFEYYMKG
FT                   DEESVFDIPNREKEGRGLKDGKDFNTSISDRLERRLAPLSEFFSEECGSFVKNNMFYIY
FT                   PIIYSLWLPRCTQDLGFTQANNHFLVISLCLQGEESRIDEIGYEKDELYGMGVDVIVPL
FT                   LCNGYFKYDILERFFGDTRKYISIHLPKFLFALKKVYVERPFEFRVCVFKVLKCIIDAI
FT                   SNNVKMLFNYLFPFVEFFMRKHEDSCGMDCKMIFIEYYSSFFENDCFIRNMPRIFPYLD
FT                   VEKIVKWSNAKNEEDYLDIVLGLLNTKGHFSQEMATSKAVELLTRVFGSIDKDGVLDEE
FT                   SFVENILTRFFKSPTFRIKVGSIYRRLREVESDAAFLIGCISQEFLEPEIHPSVCDVPI
FT                   MGNTPEAIARVMIERYLLEIDPGKQDLHFFIIQETLKFIRGPLSDSIEEVVDQFRNTQY
FT                   LYEHVPTYSTEKLYEKTHTFKKFLERLYRHTLSEVERRNKKEYFNLLRYGDLLGIPFLE
FT                   FHCLSLCRLLLDSGDSRVAGIAQNISQDLEGGVDRKIARFVLKLHRFTEGKYVPDLVIL
FT                   RISIFLKDHYNAIQVLEKMIRKERRRDLFDLLQYNYYWIKDYDKVLGINSVFGRPTLIN
FT                   LFFGFCVDKNFAAARRCLEPEVILGNCTTESDDEEKGKDLIIQSLDMKDRLSEIIDECQ
FT                   DDEVMKFMNDCKRIEKDFSEWRNLESRNEVFKHFVKDCELVSKSKNLLKTLDLIAGRRE
FT                   MAGDDRMLLECHESLMAGIRSMVDGRDDISCDEMFESLFTLSKENVGESQDVGLEHREY
FT                   FDDFASVDMVRAERHHERIGYIDRSRFGKTSGYNSLDEFERDLKLGMIRSYMGDNDFNK
FT                   CIQEIGSMLLKREWSALYELAKLNVLQGKVGDAKTSLKKVLELFPRTSIFHKRALARYA
FT                   EIVDTKTGYDSALSVLKDSGKLFLLGAKKFESTEPVKAMEMYINSVVHDSQYSDEAIPR
FT                   IFHLFSEMTPPGDINASSALIKKFLESCLSLLPPYYNQILSRLSHPNRDVVDVVSNIVL
FT                   ELMENYPSKTFWRSLIMMNSQVPNTRKRMEGIISELTLDNKVVLSNIRKISEGLMEISK
FT                   SKKNELAMEEDFPGFIRMFPTNVMVPNTGILINGVKNEIKVFNSLQRPKRICFVGNDGK
FT                   NYYWLCKNQDDLRKDSRFMDLNLIINSILRKQSNKKYIRTYAVIPFSHESGIIEWIKGL
FT                   NSLKVICDSYYSKDGISISETACRFVQNKKIGPREWHKVISKFGPKFHLWFSDNFPHPY
FT                   SWLSARNNYTRTYAIMNIVGWFMGLGDRHAENILFDSNTGDTVHVDLNCIFGKGRELQV
FT                   PEKVPYRLTQNIVDAFGVLGLEGSYNASLCSTLDLFLKNKNILVSNLLSFVYDPLFEWR
FT                   RKSTTTPKRIIEDLCRKMDDLDVSSKCDVLNEEATKSENLCMMYIGWLPFI"
FT   gene            complement(<123732..>124319)
FT                   /locus_tag="Eint_021100"
FT   mRNA            complement(<123732..>124319)
FT                   /locus_tag="Eint_021100"
FT                   /product="Microsomal signal peptidase subunit SPC25-like
FT                   protein"
FT   CDS_pept        complement(123732..124319)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021100"
FT                   /product="Microsomal signal peptidase subunit SPC25-like
FT                   protein"
FT                   /note="similar to ECU02_1140"
FT                   /db_xref="GOA:E0S5X2"
FT                   /db_xref="InterPro:IPR009582"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X2"
FT                   /protein_id="ADM11107.1"
FT                   /translation="MQRTVDRNPFGVSPILVNTFVKYLPSMDNLKAKYNKNPLRGDIYN
FT                   LSELKIILDDVIRDFMENVGNSKQSKVSTDIKIAIGLISTVIASAVAYFSLTSEFEYHK
FT                   QVITILTLIYFVINILGEIYFRWTGSSMVFKDRVVSTSVSAPDPTYVIMVYNKNKLIPS
FT                   KYTKSMFDLFDSNGRLIHEEFLDDLQGLLKSK"
FT   gene            <124292..>126418
FT                   /locus_tag="Eint_021110"
FT   mRNA            <124292..>126418
FT                   /locus_tag="Eint_021110"
FT                   /product="DNA replication licensing factor Mcm4"
FT   CDS_pept        124292..126418
FT                   /codon_start=1
FT                   /gene_family="HOG000224127" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021110"
FT                   /product="DNA replication licensing factor Mcm4"
FT                   /note="similar to ECU02_1150"
FT                   /db_xref="GOA:E0S5X3"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR008047"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X3"
FT                   /protein_id="ADM11108.1"
FT                   /translation="MDSDQQSSAFSFYDASQENLLNFTPSQGDLSSTILPIVETERVKV
FT                   IWGTTINIQETSERFKEFIRKNRDYHDVLEQMDLTQEFVFDLNCEDLDPDLRSQLATYP
FT                   QEMLPILQGSLQEIYVENFPSFNGTIRIRPFGIGKALSIRNINPNDIDRIVQITGMVIR
FT                   SSSVIPEIVRAFFRCSKCMDECFVESIRNVIEEPSKCKCGGKYSQQLVHNSSEFEDKQI
FT                   SRIQELPEGIPDGTTPMAMTIVCRNEFVDGLVPGDRVKVIGILKATPVRLNPVMKKIKS
FT                   TFRTYLDLLSYEVMNKKVKERDPIYKIDELRKNPKVYEVLANSIAPSVCGMEDTKKALL
FT                   LQLFGGVRKELGSSRLRGDINILLAGDPGISKSQLLSFIHRTSERGMYTSGRGSSAVGL
FT                   TASVAKDPDSGQFILESGALVLSDNGVCCIDEFDKMSDSTRSVLHEVMEQQTVSVAKAG
FT                   IITTLNARCSILASCNPIESKYNPRKSIIENINLPPTLLSRFDVVCLLIDRSDEFQDRT
FT                   IGDHIVSLYSEERGKTECVDADLLKAYVKEARKIVPRLTAESMRLLTQAYVDLRQMDNG
FT                   KTITATTRQLESLIRLSEAHARMRFSSTVEAKDVKEAVRIIRESLLMYAIDPSTGKVDM
FT                   DMIITGRSTFRNKMLESLKDAILLMMRDRIEVSEIVRKTGANEKMVKEALEELAQEDKI
FT                   MTSGHESCYERIRD"
FT   gene            complement(<126476..>127087)
FT                   /locus_tag="Eint_021120"
FT   mRNA            complement(<126476..>127087)
FT                   /locus_tag="Eint_021120"
FT                   /product="splicing branch point binding protein"
FT   CDS_pept        complement(126476..127087)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021120"
FT                   /product="splicing branch point binding protein"
FT                   /note="similar to ECU02_1160"
FT                   /db_xref="GOA:E0S5X4"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X4"
FT                   /protein_id="ADM11109.1"
FT                   /translation="MELFRHPEKVPFPKDVKSKSELKKLLCSMRSEEIDRRLRNAVASN
FT                   NQQLVQWLKSRKQQILGLQIQGNVSISGNMYTNKIYIPVQEFPESNFVGLIIGPKGSTQ
FT                   RQLERITKARIYIRGSYKDKYAEPLHCYISADTQENLMNASAVIENLIEDSILFGSCKL
FT                   KSSQLQAMKGSKGDSGRRLTDWEKFYYWWYFHNKIQKEVD"
FT   gene            <127091..>127750
FT                   /locus_tag="Eint_021130"
FT   mRNA            <127091..>127750
FT                   /locus_tag="Eint_021130"
FT                   /product="hypothetical protein"
FT   CDS_pept        127091..127750
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1170"
FT                   /db_xref="GOA:E0S5X5"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X5"
FT                   /protein_id="ADM11110.1"
FT                   /translation="MVYQKNANFSSPMASIPKSNEVIFVKNYYSMLCNRPSVIHQYYMK
FT                   DSQLTISKEASKPEICTEDFGKYIKSKISSPVSKVFISHLSFQKIDNLKSAISVIGQFV
FT                   YNDSSQVRISHQFIVSRIDSVLYIKNEILTFLDEEIAYDLDHDAKKVVVVEYGKNEMLQ
FT                   AINAISEFGKIKSMKSEDDGKVVMTFDSIEDVENIKKNVPKIVSQGYKLEFDGLKV"
FT   gene            <127852..>128451
FT                   /locus_tag="Eint_021140"
FT   mRNA            <127852..>128451
FT                   /locus_tag="Eint_021140"
FT                   /product="hypothetical protein"
FT   CDS_pept        127852..128451
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021140"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1180"
FT                   /db_xref="GOA:E0S5X6"
FT                   /db_xref="InterPro:IPR003888"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X6"
FT                   /protein_id="ADM11111.1"
FT                   /translation="MEEEGKLAERFVKAYNRRVELYRQRYALEDSINAKLVDQCALKKA
FT                   IEMNKELDKKDQPRPPDQGTMFGTGMHRLSLVDIGRLPTENLDMFHTETAIYPVGYMCR
FT                   KKYKKHDAYKKKAKDRILYICSVDPQKGPIITADDGRKWYGPSMWKDFVESIEGGTEYK
FT                   SVEEFFGLGNSALARKIESLGDLSAFKKYIPLNKRS"
FT   gene            complement(<128521..>129054)
FT                   /locus_tag="Eint_021150"
FT   mRNA            complement(<128521..>129054)
FT                   /locus_tag="Eint_021150"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(128521..129054)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021150"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1190"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X7"
FT                   /protein_id="ADM11112.1"
FT                   /translation="MNEMTFSRRIDMLDNSIKELERGTHREDESKLPAMFQICDRLVEC
FT                   GQQPPRLVKRYNELKNRYKCISSPYKELDNEISACKMHMEALSRKSSIDEITRSVQEVV
FT                   AVSNYINYAINDARFPIDNVMEHLEEGEQYGMLVNEQLSITRRRKLWKAKIIQSILLLL
FT                   FSLVGVFVLLKIVF"
FT   gene            complement(<129158..>129550)
FT                   /locus_tag="Eint_021160"
FT   mRNA            complement(<129158..>129550)
FT                   /locus_tag="Eint_021160"
FT                   /product="homeobox domain-containing protein"
FT   CDS_pept        complement(129158..129550)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021160"
FT                   /product="homeobox domain-containing protein"
FT                   /note="similar to ECU02_1200"
FT                   /db_xref="GOA:E0S5X8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X8"
FT                   /protein_id="ADM11113.1"
FT                   /translation="MASEKTKNVRELEAALGLLKLSGFQMNRYCAGKQMRKTRLQTCVL
FT                   NRIFEISKFPSSKTIIDLALLINVHPKSIQKWFQNTRQAIRKKGHMKGILLLMEPEEHN
FT                   SMDIPLPILADIVEMEKRVMSRFGLE"
FT   gene            complement(<129930..>131858)
FT                   /locus_tag="Eint_021170"
FT   mRNA            complement(<129930..>131858)
FT                   /locus_tag="Eint_021170"
FT                   /product="glutamyl tRNA synthetase"
FT   CDS_pept        complement(129930..131858)
FT                   /codon_start=1
FT                   /gene_family="HOG000259234" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021170"
FT                   /product="glutamyl tRNA synthetase"
FT                   /note="similar to ECU02_1210"
FT                   /db_xref="GOA:E0S5X9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5X9"
FT                   /protein_id="ADM11114.1"
FT                   /translation="MNRKGEFKEELINYILLKKYGTKPEDPPVYSNALGKISKEIFPAG
FT                   LMDVLDSYTINPNREEGVNFLLSLNSFISCIDSDELRDILFGMININSTLTKLIKDKKE
FT                   MEKFPNVCEMYSEQFKANKNLLKEFNTSFKKEQGNLEIDGPSENVITRFPPEPNGRLHI
FT                   GHARAALLNWYFSSKGNGRLLVRFDDTNPEKEEERFEKGILKDLDLLGIREYTLSHTSD
FT                   YFEKIIDLAFFLIDEGKAYADNTPQEEMRDERGKGIESKCRNMSTEESKRIFEEMISGE
FT                   ASGYCLRAKIDMSNCNKAMRDPVIFRMNKSPHHRTGDKYKVYPTYDFSCPIVDSLEGVT
FT                   LSLRANEYRDRNPQYYWFIENLQLSNRPKIHDFSRLNFENTVLSKRKLKYYVDNGFVSG
FT                   WDDPRLATVAGIRRLGMNMEVLREYILMQGVSQKTCTISWDKVWAMNKKRVDPVAPRYF
FT                   CVQQRNVVEVSVKNTSEYMMSVPRHKKNGDIGTKEVFYSSLILLSQEDGQILQENEEFT
FT                   LMNWGNAIVRSKSVQDGIVTKMEIILNPEGDFKQTKNKISWVSKRGSVVVELIEYGSLM
FT                   TDGDDEDLAARFNTDSIQKEYWYAESAVVDIKEGDVIQFERNGFYYCDGFLVFNLLPFT
FT                   KQKRTAN"
FT   gene            <131954..>133723
FT                   /locus_tag="Eint_021180"
FT   mRNA            <131954..>133723
FT                   /locus_tag="Eint_021180"
FT                   /product="DNA ligase"
FT   CDS_pept        131954..133723
FT                   /codon_start=1
FT                   /gene_family="HOG000036006" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021180"
FT                   /product="DNA ligase"
FT                   /note="similar to ECU02_1220"
FT                   /db_xref="GOA:E0S5Y0"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y0"
FT                   /protein_id="ADM11115.1"
FT                   /translation="MSKILFVDFCTVLERINQTTKRLEIQSILTDYLKDVHKIDPPSLA
FT                   PVLYLFTATVYPEYFNKELGVGENTLINVVAELTGKSAKNVKKEYSKEGDLGTIAMKCR
FT                   VSQLFVLKTQLEVMDVFLGMRKVANEGGQKSSASKKRIILGMMVKCSPLESKYLIRLIE
FT                   GRLKVGLALKTVLISLANAFSSDKADEVKAAFNRQPDIGRLAECILEYGVEGLPTKFQV
FT                   SPGVPLKPMLANPSKDLTSAFKKVENKNFTCEYKYDGERIQIHKFGNRIETFSRNSEKT
FT                   TEKYPDLMDLYNISDRDFIIDGEIVAYDRKERKILPFQILTTRKRKRVESSKIDVQVCV
FT                   FGFDLIYFDGKTYIDEPFEERRKILHSSFKEMDGKFQFTEFKDCETPEESEMFFNESVE
FT                   KGFEGMMIKILGSDATYLPSQRSNKWIKIKKDYLEGMSDSLDLVVMGAYYGKGKRAGFY
FT                   GGFLLGVYNDEEEKFEALCKIGTGFDDNILSRLYEQLSSNLCSAPKNYSYKESVKPDVW
FT                   VEAKYVWEVKAAGLSLSPIYNAGGNRNEKGISLRFPRFLREREDKDVKEVTTSSQIYQM
FT                   YLDSKVENSEEFY"
FT   gene            <133782..>135899
FT                   /locus_tag="Eint_021190"
FT   mRNA            <133782..>135899
FT                   /locus_tag="Eint_021190"
FT                   /product="Sec24-like protein"
FT   CDS_pept        133782..135899
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021190"
FT                   /product="Sec24-like protein"
FT                   /note="similar to ECU02_1230"
FT                   /db_xref="GOA:E0S5Y1"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y1"
FT                   /protein_id="ADM11116.1"
FT                   /translation="MEHMKSGFESPQPNEEDLSPRSIIDECNYYRSTLTAIPEKQDLVR
FT                   TSGIPFVINVILENYEEEEVPLCSDDIIRCERCKSYLNPFVEIIPPGLKWKCNLCLTIN
FT                   DLATAFQVTSRGISRTSSLFDPKVNAMHNYSYYTRGELRSTVYELEAPPNYSLKTPSPP
FT                   LICFLIEVTFESMKYRSVDAVIRSILGGLNPRFFDPRSRMMFAFFDSCIYLLRKNGDFS
FT                   VISDATHIPFFLEEDFLLPLDHRFDVDGIERFFIENKSTRNNYGDALRIVQNILGTTGG
FT                   CIISFLATYPNVGPGCVDSNQHELRCKSVFYKEISVYLSKQGISVTQFLFPRLGIELPT
FT                   LSVLSKYTGGMVYYYPNFDGTDPTFATKLANDLASHLDLNIGLYGMCRVRTSKCVFIKE
FT                   YFGSLHHRSEDLISFSTFFPPHSFSFEIDISKEEGTRGVCFQVAILRTLRTGERRIRVV
FT                   NFCIEKVSRSLYSVVDPYAVAHAFALKAFFFESRTKGGGNEYLNKSMKDIVRLYKQLSN
FT                   TTTLLPATLEVLPMLILSLCKSIPLRPASYTPMDYKSYYIYLISNSYPKLVDTVIYPTL
FT                   LALHRLDSIQPLNLTLNCLETNGLYLLDTGVTIFFFVARDCDPSLPNLLFDSSIGSERF
FT                   IFDPERNEFSDSVCKIIKELRSNRHLTPNYVLVRDDGTSSIYKDIFFTYFVEDESHGLP
FT                   SYSKYLELLRA"
FT   gene            <135968..>138736
FT                   /locus_tag="Eint_021200"
FT   mRNA            <135968..>138736
FT                   /locus_tag="Eint_021200"
FT                   /product="chromosome condensation complex Condensin subunit
FT                   D2"
FT   CDS_pept        135968..138736
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021200"
FT                   /product="chromosome condensation complex Condensin subunit
FT                   D2"
FT                   /note="similar to ECU02_1240"
FT                   /db_xref="GOA:E0S5Y2"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y2"
FT                   /protein_id="ADM11117.1"
FT                   /translation="MQRELEDLITKLKTMAIVDNHEDYNYLVSCTDKYDNKGKIFELLR
FT                   NRNNAPGEMAPLLFTFTSKLGTESDEGLLVRIIDFIRGCRRDSRETSEWMVKILFLILE
FT                   KVKEKRKDSAIRLRLLECIRIYSQDIGLVNHMIDLMCTKSSSEIIGSILESIPSVSHEF
FT                   IECAMKQDNPALLKNLSLVLPSLSEKDISLFVNYESFEEFLESEHFFMRNCFLEICANL
FT                   VEHFKKKGMVEKMNDLIGMVVERLSDTYFLTRYKALQVLECLFQRNSIGVGRRHEIIRE
FT                   IGGRVLDKTVVVRKKAIGICSGLLMSHPFASEKSLEKKNFKPSEDENNSNYPDNKKKEV
FT                   ERRYHEDLNEFHDIMREIQDNVIILLNGETKTEIAECVEFVKLSFYYKIDGSKEAFESL
FT                   FDLVWTQDQELLVLSFKDLIMQMKMSKISLFGFFKEFIRKEGNHSFERMIRELSTRRYI
FT                   DKSFVGELYNTFLQGAYLFETSYLLRHIGRPVPVDMFHSLALSITNLLFSIQEEKDLVE
FT                   MLSVYKNIIQIKIRERVEFDGEIIEMLIKNLVKMTFFEHQVTEITVSVIYSISRFPEKS
FT                   IIMLLEKLCMMEKSMLKVISAVGYIGLKHMKYLEELERLVKSNRIKVKVDKTVITPEIV
FT                   ERRRSINASRQSISTIIEEERDGNSTILSDPGFSNNISSRIGDKSEEEIIDFFFYIKEK
FT                   EMLYGKSILSIFKRIVEDGCHSNDEEIQVCSYVSLYRLMCISFEFFTEHYDVFVRSMNH
FT                   PVSRVRANAVVAMGDFLLNYNTVAEQHTYLLLESLSDADVDVRRNALLVIHNLLMKNIL
FT                   KIKGYGSKLAVLLIDEETEIREMAEHLLVQISKKENMMSVLLYETITAGNDQLSSVIGF
FT                   FRDLVSEKVKESLFLKALKSKVEPETLRLLHSAFDLDEKMMEVVRLLDGSK"
FT   gene            complement(<138782..>139228)
FT                   /locus_tag="Eint_021210"
FT   mRNA            complement(<138782..>139228)
FT                   /locus_tag="Eint_021210"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF11"
FT   CDS_pept        complement(138782..139228)
FT                   /codon_start=1
FT                   /gene_family="HOG000006355" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021210"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF11"
FT                   /note="similar to ECU02_1250"
FT                   /db_xref="GOA:E0S5Y3"
FT                   /db_xref="InterPro:IPR006809"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y3"
FT                   /protein_id="ADM11118.1"
FT                   /translation="MNESNEEGEKDQNTKDVQSDTESDDLNLMTDDSTYKREDPGRLHS
FT                   ITGTMTEEELHRYEKFRGSGFPKAAIKKYISSVIGQAVNPNFVIAVCGLAKVFVGEMIE
FT                   MAKIVQGEREETGPLLPSHIHEAYRRLHRKIPNIKVFKKAPWNT"
FT   gene            <139262..>140218
FT                   /locus_tag="Eint_021220"
FT   mRNA            <139262..>140218
FT                   /locus_tag="Eint_021220"
FT                   /product="hypothetical protein"
FT   CDS_pept        139262..140218
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021220"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1260"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y4"
FT                   /protein_id="ADM11119.1"
FT                   /translation="MIIRIDRKHISSSIEEWFQLLKSNNDSLEDGKTSGCDPSMEYEIE
FT                   VKESIGKKIALVTVNRVGIKHEVSLDKIEETLLEVVGTLLGHELVVIHGFTVKDQSGEK
FT                   TKPIIPIFFRSTLGIQIPKRMGYLKNDGAGIPEIDESMMVPFVHTSPILKSLLNSRPLR
FT                   FSGEGVKALLVLYNGSTFIIPDTARIIPMIRGMLSREKMGEFLKLLKKFPFKFVETFIK
FT                   AYMQPSSLEVNKELSGCFSEFQNNLTKLHIKCIHKIVSNAPVFLDARDKITERIEKFYI
FT                   YNAKGFKRKRGEYLKCREELYIDKNPIGSLKRYFRDL"
FT   gene            <140252..>140674
FT                   /locus_tag="Eint_021230"
FT   mRNA            <140252..>140674
FT                   /locus_tag="Eint_021230"
FT                   /product="Dim1-like protein"
FT                   /note="required for mitosis entry"
FT   CDS_pept        140252..140674
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021230"
FT                   /product="Dim1-like protein"
FT                   /note="required for mitosis entry; similar to ECU02_1270"
FT                   /db_xref="GOA:E0S5Y5"
FT                   /db_xref="InterPro:IPR004123"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y5"
FT                   /protein_id="ADM11120.1"
FT                   /translation="MVSVLTSVDDVNKVVGDTSCRLVVIRFGDKEDPLCTHTDALLEKI
FT                   CPLLSNYVDIYVCERNSVKELEEVMRLDSPLNIMCFFNRRHIKIDCSSGDNDKINFLVE
FT                   NEEMLVEIFTLAYKAGVRGKGIIKSPFKVQELQGEL"
FT   gene            complement(<140705..>141229)
FT                   /locus_tag="Eint_021240"
FT   mRNA            complement(<140705..>141229)
FT                   /locus_tag="Eint_021240"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(140705..141229)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021240"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1280"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y6"
FT                   /protein_id="ADM11121.1"
FT                   /translation="MDEKLKEISRLVSEVKRKLEVIIQSSSHIKEFNYKVEALLAAFDA
FT                   YTIRGVEHNLDLDKTSQTIVFPKKVIPKEKTKEETTSSFSNIRGEESLQEFIERMGSTT
FT                   TGNKLFRNNAAKIARFLYDNREGAVLEEIIKNTGISRYRCVDILNTMLRADPPLVSKKF
FT                   DKGFIYSIVLL"
FT   gene            <141310..>142641
FT                   /locus_tag="Eint_021250"
FT   mRNA            <141310..>142641
FT                   /locus_tag="Eint_021250"
FT                   /product="chromosome condensation complex Condensin subunit
FT                   H"
FT   CDS_pept        141310..142641
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021250"
FT                   /product="chromosome condensation complex Condensin subunit
FT                   H"
FT                   /note="similar to ECU02_1290"
FT                   /db_xref="InterPro:IPR022816"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y7"
FT                   /protein_id="ADM11122.1"
FT                   /translation="MSNDDLGTWLKAAAENKITTKNTWKSTLIDHFTNIDEFREKQGIN
FT                   FQKASFTLDGCAKVYSTRVDDVSENAMRLLEGFGREEGKKRQAKKNKTTIEKNILNLNI
FT                   KVSASRRLVDPKFLYLSSLAENALMIDALGISSDGMFRMTSSRDWETVVVDDLKLSVNL
FT                   PQGLQISPSINEDKEIKDIIIDPIVGNDDESSGGSGGFGIDNHPDFSEFPPTADNQNLA
FT                   YKETSFSYFKGWAGPNHWKVQAKKGKGGSQKPKETSFLDFTEIIDHEGILEAGNTLFEP
FT                   SLIVERRENHHVLPQDFRLEVEDLYRYLVRDGLFHRKDQSHMDEISFDYSPDPCIVEEP
FT                   EDEFITDAPSQGNQRSTVPLRKTSKKINIKKLKDNVFDFVREGSTSLLSIFKSVPKIYD
FT                   SEESKDISMHLCFISLLHLANEKNIQLKDVGDDVKVWISPDSRT"
FT   gene            complement(<142658..>144670)
FT                   /locus_tag="Eint_021260"
FT   mRNA            complement(<142658..>144670)
FT                   /locus_tag="Eint_021260"
FT                   /product="dolichyl-phosphate-mannose-protein O-mannosyl
FT                   transferase"
FT   CDS_pept        complement(142658..144670)
FT                   /codon_start=1
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021260"
FT                   /product="dolichyl-phosphate-mannose-protein O-mannosyl
FT                   transferase"
FT                   /note="similar to ECU02_1300"
FT                   /db_xref="GOA:E0S5Y8"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y8"
FT                   /protein_id="ADM11123.1"
FT                   /translation="MAKSKYLEISTVLLIFTLSIVMKTYRIENGDFVVWDEAHFGKFSE
FT                   KYLSRKFYFDVHPPLGKILTSLGGYLFNQPLDFEFKSGEKFPKGFDYSGMRRFHSAIAS
FT                   FMPVLGYLMLKEMKYSYKRRILLSLIFIFENGFTSIGRLILLDSHLLTFTAAVAYFMTR
FT                   MYFRSKEKIDLASISLLGITLGCVLSIKWIGFLTMSLVGLFTIYCLWCNITSKESILGF
FT                   AKLFLMKAFFLICIPASLYVLLFYIHFEMVNRSSSDDGHMSSLFQATLKGSDIGNNRKY
FT                   PLFGTKVTIKSSKTGGGYLHSHDHKYPNGENNQVTIYHHKDENNAWVLQKVTDDLEDAE
FT                   FISSGDTVVLLHMETRKYLDIPGNHSLMSSGLRAESSGSHLSDTNLFKIEIVEDAIKKE
FT                   GRVKTLTTKFRLFSTKHNCYLKPSSRKYPSWGFEQGEVICGAKKGEATLWNVEENTSAK
FT                   LSEEKNPVYKEITRYPFSKKFVEHNKAMFITNASFIQDEDLEPERIVSKPYEWFILKRG
FT                   LRMTAWDGQNEKFYMFGNPLVWYSSGICVILSPIVLLCRVISRKRKGKPLAFLRNEGYM
FT                   VFLSCCGWLLHYIPFFFVKRVLYFHHYYPALFFALFSLCYIMKFARLGFVAVFTFFVIV
FT                   FFFLYSRLTYGFGEETEFLRRISIIPTWDFIEKGQ"
FT   gene            complement(<144738..>145313)
FT                   /locus_tag="Eint_021270"
FT   mRNA            complement(<144738..>145313)
FT                   /locus_tag="Eint_021270"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(144738..145313)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021270"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1310"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Y9"
FT                   /protein_id="ADM11124.1"
FT                   /translation="MIKEAIERKKTAWKNLAKRDIYGYDKLVSILDPGMDFGPEISLKR
FT                   KIMGMLKSSANRENTSDERRIINGILKSEKGITGDISFALRVHYDFCTRNKTTSSLSSL
FT                   DREYGKMLNFILYDRPEEEMDLCNIDHPFYNEVALFNLFVKCKDNVLELDREALKKNVF
FT                   HTINERGIRDFIGGKVERLSAAREDRGD"
FT   gene            complement(<145652..>147313)
FT                   /locus_tag="Eint_021280"
FT   mRNA            complement(<145652..>147313)
FT                   /locus_tag="Eint_021280"
FT                   /product="Rad4-like protein"
FT   CDS_pept        complement(145652..147313)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021280"
FT                   /product="Rad4-like protein"
FT                   /note="similar to ECU02_1320"
FT                   /db_xref="GOA:E0S5Z0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z0"
FT                   /protein_id="ADM11125.1"
FT                   /translation="MDFEIQSTFKPNVFVCTTGISRDEQDLIRSQLPKHVILEDTLSTT
FT                   TDYLVSYKAMMTEKYIQALKWNIKILHVRWLYDTDENTKKYEMTPLSGSSFTISGVTDD
FT                   SLINYHCLLGASFTENLTAWTDFLITNSQCNEKTEFCKKYGIPVVTSHSVFGNDYGAYK
FT                   KEPHFKAIDSAGEPLFNGKVFFLDSKLPKILFNRLRRLIISNGGTRVSVVDRDVDFIVA
FT                   ESHGEFKRHDGKVFHYQYVFDCVETDSILLPGPYKVYFGRSNAILSEAVCCIDASLREL
FT                   KVEVFNKLRALGAIVKEEVDASCTHLIIRDRKEYTGNRHTPYKVVLLSWVDQCLHRMRY
FT                   VNEDKYRIGIEPSNLFIENKKDEMSRKTGIFASRFMLFQFTGLSPILKSKAIERFEKLR
FT                   VRYSDGDRYEKCTHLIMGSVCTSEKFLSCLCNGGWILRPDFIDNFDNSANFDFGKYEWT
FT                   ADENTPEKERKIVASIKKWRERVASKGKPAFHRWIVRLYCDEQKRESYARVIVNGGGTI
FT                   TEGNEYTHCFVSKNYKGEVSAEKKYSTDYIFSHLFR"
FT   gene            complement(<147385..>147702)
FT                   /locus_tag="Eint_021290"
FT   mRNA            complement(<147385..>147702)
FT                   /locus_tag="Eint_021290"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(147385..147702)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021290"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1330"
FT                   /db_xref="GOA:E0S5Z1"
FT                   /db_xref="InterPro:IPR005124"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z1"
FT                   /protein_id="ADM11126.1"
FT                   /translation="MSVESIKRLVQCENDAKEKLEMARRELEEMRAQARRDAGLMVEDL
FT                   RKENESRLLLLEKEVEEYIKVVDERLKSEFEMKVKKLRDVRNKGDVVSALVEHVSGGSE
FT                   K"
FT   gene            complement(<147814..>149091)
FT                   /locus_tag="Eint_021300"
FT   mRNA            complement(<147814..>149091)
FT                   /locus_tag="Eint_021300"
FT                   /product="SUMO ubiquitin activating enzyme E1 subunit UBA2"
FT   CDS_pept        complement(147814..149091)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021300"
FT                   /product="SUMO ubiquitin activating enzyme E1 subunit UBA2"
FT                   /note="similar to ECU02_1340"
FT                   /db_xref="GOA:E0S5Z2"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z2"
FT                   /protein_id="ADM11127.1"
FT                   /translation="MIRGRVLVVGCGGIGCELLKLLATKNLESITLIDCDNVDLSNLNR
FT                   QFFFGRKDIGKSKAIVAAKVFRKMNKKCKVFPICADITEFDARFFAEYETVYSCLDSIE
FT                   VRSYVNQRCFISKTPLVDGGSGGFKGQAYYFDYNSECFDCIPKRISREHLVCTIRSRPT
FT                   SFEHCISWAKYVFLEMKLKVDGEQDFYPRHLKDIIENCEDMSTPGELEKFRSSEDYKEK
FT                   TKKIVEILGSSDLISFDKDKRDVLEYIYNVAYIRGMCAGIKPLSFDDAVTIAGNIIPSL
FT                   STINSIIASLMILSVKNKCNYYCVDNGNIIRKLETCERNPGCRTCSYHWYGVLYDGTLT
FT                   FKRLMECFETRNLKLIAYSDKRLFFTPDMAEYLDKDIEFENNNIAEVVCMGRRKRKIRV
FT                   FLYFLRRGETLYFGRIHRVVYGRRRK"
FT   gene            complement(<149178..>149768)
FT                   /locus_tag="Eint_021310"
FT   mRNA            complement(<149178..>149768)
FT                   /locus_tag="Eint_021310"
FT                   /product="E2F/DP transcription factor"
FT   CDS_pept        complement(149178..149768)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021310"
FT                   /product="E2F/DP transcription factor"
FT                   /note="similar to ECU02_1350"
FT                   /db_xref="GOA:E0S5Z3"
FT                   /db_xref="InterPro:IPR003316"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015633"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z3"
FT                   /protein_id="ADM11128.1"
FT                   /translation="MARKSTSDRLSSIRSENSLYNLTKRFLKLVSMAPDHNISIHQASI
FT                   ELNVGKRRIYDITNVLEGLGLLSKWSVSNAKWIGGNIDRYLLDDEEKENQENSYLNPEN
FT                   VLKGDDLDETLFRLNEEISMLSQSEKNLANAYVTYSDLQNLPSLDGNLVFAVKAPSETI
FT                   MEYPRYEKGFYKLKLSSEQGTINIFYVSDEKKD"
FT   gene            <149933..>151459
FT                   /locus_tag="Eint_021320"
FT   mRNA            <149933..>151459
FT                   /locus_tag="Eint_021320"
FT                   /product="prolyl-tRNA synthetase"
FT   CDS_pept        149933..151459
FT                   /codon_start=1
FT                   /gene_family="HOG000167538" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021320"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="similar to ECU02_1360"
FT                   /db_xref="GOA:E0S5Z4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z4"
FT                   /protein_id="ADM11129.1"
FT                   /translation="MLLISPPFMTKQKFGLTAKKEEDFSEWYVQVITKGEMIDYYEIKG
FT                   CYVMRPQGQFVWKCIQKWFTEKIEELGVQECYFPMLVPKSTLEKEKNHVENFSPEVAWI
FT                   TKCGNEVLGDPVAVRPTSETIIYPSFSKWIRSHRDLPLKINQWCSVLRWELHGTLPFIR
FT                   GKEFLWQEGHTAFLTKEESDVEVFAILDLYSRIYSELLAVPVIKGRKSESEKFGGADYT
FT                   TSIEAFIPGSGRGIQAGTSHSLGQNFSKMFDIKVDTEEGSENSSFVYQNSWGLTTRSIG
FT                   IAIMIHSDNLGLVLPPRVAMIQVVVIPCGITASSSEEDVESLRTYISKIHAQLKNFVRV
FT                   HVDDRNNVTVGFKFNHWEIRGVPLRLEVGFKDMANSEACLVRRDTRAKKQVSVEDIGQT
FT                   VMEEIDTMHNDMLSRATTERDRRISYVRSFEEFMSSLENKKMIMAPWCGVDKCEANIKS
FT                   KTTKFGPNGNVVSTGAKTLCIPYEAKSCNGMECINCNQKAIHYALFGRSY"
FT   gene            complement(<151609..>153525)
FT                   /locus_tag="Eint_021330"
FT   mRNA            complement(<151609..>153525)
FT                   /locus_tag="Eint_021330"
FT                   /product="alpha-alpha-trehalase precursor"
FT   CDS_pept        complement(151609..153525)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021330"
FT                   /product="alpha-alpha-trehalase precursor"
FT                   /note="similar to ECU02_1370"
FT                   /db_xref="GOA:E0S5Z5"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z5"
FT                   /protein_id="ADM11130.1"
FT                   /translation="MEMASGVKLRYIFLAACTIIPVRASGIMDPGSRMSSELLEVSFVS
FT                   KITKDSKILVDKVFTKPPEEIDEILRNMLRENRSFEKEEDFWRFVDENSFEPETELIFG
FT                   KDDKELQADMPKNTSSYIIKLEEKLSDGSNPLFQTSQYKQSIANLIRIGKELENAWGKI
FT                   YVRQNRLKRGQYSTMIKVKNPFIIPGDRFKEAYYWDSSWILEGLVRSGMEKIAVGMVEN
FT                   FIGLIEQFGFIPNGLRTYYLNRSQPPYFPQMLLTLYKHLPWEKIENTIKRGLDAAVTEH
FT                   TFFMTQKVERVEKNGKSYVLNVYKVNDTTPRAESYSEDRETAEQNKSRDEKYRRRAEDI
FT                   YADLKAGAESGWDFSSRWLGLSGQLDSIRVSKRIPADLNSVMYANECIISKLYEIIEGK
FT                   NSKNSKYFKEKSEERKDAINNVLWNDQQGVWNDFDIETREHTSPGFYASNLMPMCYGIP
FT                   PPKDKGVSVYHILNMFAEDIFGHPGGMPASGSKNKDSTLQWDFPNMWPPLVHIVAFFLE
FT                   RVGEREMALHMVRSYLENISVSTSVVDETKRGIFEKYSCEMVGSPGYKGEYTAQVGFGW
FT                   TNGIAIHFLDRFSSEIVSPKSHEESYKEIKALLEKRILDKAEPKNHTPEGCLLLEERFQ
FT                   VLA"
FT   gene            <153741..>154976
FT                   /locus_tag="Eint_021340"
FT   mRNA            <153741..>154976
FT                   /locus_tag="Eint_021340"
FT                   /product="CAAX prenyl protease 1"
FT   CDS_pept        153741..154976
FT                   /codon_start=1
FT                   /gene_family="HOG000257874" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021340"
FT                   /product="CAAX prenyl protease 1"
FT                   /note="similar to ECU02_1380"
FT                   /db_xref="GOA:E0S5Z6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z6"
FT                   /protein_id="ADM11131.1"
FT                   /translation="MAGNFLLSISIMNYVFMVYLKIRELRQLFKPPSKTYLRLATMDQI
FT                   KKTKEYNRDKLFMSVFELTILLGRDIYLIKKGVLEEVYSIKYFMNSYYGDTLFLLGFAH
FT                   FQRLFDLPLDLISTFYIEAKHGFNKTTFPTFLLDFVKMTAIITVIFAPFSHIVMSIIRK
FT                   YQKTFFCIYLWIFIAIFQIVLVIIYPIAIQPIFNKFEEMEESDLKTKIQELAEKVGFRA
FT                   NKILIMDASKRSGHSNAYFIGITKEKRIVLYDTLLKQANEEEVLAILCHEFGHWKHSHV
FT                   IKMASMVLLIQLFYLFILNVLMNSRSFGNFILGKDLPLLIRCVYFLMIIGALSVPIDMI
FT                   KNSVSRYFERQADRFSVSLGYGKELSSGLIKLFEKNSSNMDPDPLYSAVMHTHPTLIER
FT                   INLIEGEMNKIK"
FT   gene            <155012..>156466
FT                   /locus_tag="Eint_021350"
FT   mRNA            <155012..>156466
FT                   /locus_tag="Eint_021350"
FT                   /product="Ercc4-type nuclease"
FT   CDS_pept        155012..156466
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021350"
FT                   /product="Ercc4-type nuclease"
FT                   /note="similar to ECU02_1390"
FT                   /db_xref="GOA:E0S5Z7"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR020819"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z7"
FT                   /protein_id="ADM11132.1"
FT                   /translation="MKMAEACIDLAPLVKSAVNFLYRLSLSKNMKSRHCYKKMAQELEK
FT                   IEGPLYSLDYLKNIKWAGAKTIEKIQELIDRRILEDIKTEEDFEKYLNVLSPRAYEESK
FT                   RKLWKEGTEKSDSKDKQYKKEKDNISKKRKYIPGYRTGSYGIMKALWIREGIGRHEIAR
FT                   IGRNYCDSEFDFGSRHSAWSSMKTLVRKGFVYKEGRSKFYLTDEGRELAATMFANTSVV
FT                   EEEDEITLLVDTREVKSRRSRLFFQEYFESQQIRHETRALEVGDFLWVRGERVCSSIIE
FT                   RKRGSDLVSSIVDGRFKEQKNRLKNTGIRKIFYIVEGLKNSHMQNVGKETIVSCMAATR
FT                   LEGFIVMETEDIGQTGSVIRMIDYEVKKEQEKKKKTSNKLDHCEESSECLEDPDEEMEM
FT                   SYESFIDKSTKSKGKTQTYLLYMSLLSIKGIGHKKALILAERYKTIGGLISRVKADGVN
FT                   KLYDFEINGKKISRKNGNDIIDFFLK"
FT   gene            <156763..>157989
FT                   /locus_tag="Eint_021360"
FT   mRNA            <156763..>157989
FT                   /locus_tag="Eint_021360"
FT                   /product="WD40 domain-containing protein"
FT   CDS_pept        156763..157989
FT                   /codon_start=1
FT                   /gene_family="HOG000213918" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021360"
FT                   /product="WD40 domain-containing protein"
FT                   /note="similar to ECU02_1400"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z8"
FT                   /protein_id="ADM11133.1"
FT                   /translation="MNEDGVNIKELINARFQNPKFVYDGKRMRVLQERKVVDYTSGICV
FT                   QRVKRRIDPLQVNTSFELSSQILNLKSPELCYNDLSSLFTTKIEHVSVNKVKCPVNIVR
FT                   WTPDGRRLMSGTATGEFTLWNGYGCNFETILQAHESPVRGMAWSPSGSFLISSDNFGII
FT                   KYWHPSMNNIQIIQGHAEAVRDLSFSHNDSKFCSASDDSTIKIWDSIEAKEESVLRGHN
FT                   WDVRAAQWHRYKSLIASAGKDNLVKMWDPRTAEELCTLHHHKNTILALKWMGDENYLLT
FT                   GGKDQVIKMVDIRTMADVFTYKNHKKEVTSIGIHPCIPDMFVSGGTEGGIYFWQAYTQV
FT                   PLEVIEEGHEGTVWSLDYHPVGHILASGSVDQSVRFWVRPRPDENAESTVGGFVDEENN
FT                   SDGGAIPGL"
FT   gene            <158123..>159409
FT                   /locus_tag="Eint_021370"
FT   mRNA            <158123..>159409
FT                   /locus_tag="Eint_021370"
FT                   /product="RAB protein geranylgeranyltransferase component
FT                   A"
FT   CDS_pept        158123..159409
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021370"
FT                   /product="RAB protein geranylgeranyltransferase component
FT                   A"
FT                   /note="similar to ECU02_1410"
FT                   /db_xref="GOA:E0S5Z9"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniProtKB/TrEMBL:E0S5Z9"
FT                   /protein_id="ADM11134.1"
FT                   /translation="MITEYEYDFVILGTGLVECAVGCILAGKNKKVILIDRNPMYGSDF
FT                   ATLRYTELETYFRSSNMVPELKTYDSEFSVDLTPKLFLADSKMLKMLVRYGIDEYLEFC
FT                   RIPGSFLWKRKLYSVPTNEAQSMTTGLIGIWQKPKVMRFFWNVRDYARAAMKGKSYQFK
FT                   STMREEFKEYGLTEESMELIGHGIALNLDDSYLDRHPKETFDKILTYVRSIICYENSME
FT                   SPYLYPRYGLSEIAQGFARSCCTKGGEIMINAEMLEIDEAKMELLVREPVNKEILKIKA
FT                   GKIISDQSYFQKSVVLYEVIRGICIVRGDSVDITKGASSAQVIFLKGELGRKNDIFVVV
FT                   LGSEEKSTPEGYKAVIISTVRETDNPEKEIEVVLERLGDVVRYFIDVKPVYEAEDMENI
FT                   VFTKGVDESPHFEDIYEEIERICKKLDVC"
FT   gene            <159498..>160058
FT                   /locus_tag="Eint_021380"
FT   mRNA            <159498..>160058
FT                   /locus_tag="Eint_021380"
FT                   /product="hypothetical protein"
FT   CDS_pept        159498..160058
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021380"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1420"
FT                   /db_xref="GOA:E0S600"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="UniProtKB/TrEMBL:E0S600"
FT                   /protein_id="ADM11135.1"
FT                   /translation="MEIKTGMISGALSSCYLKTNKTSVICCIYLEQKGETEPQTEVHFS
FT                   EGLPLQIRSGVSSIVKSLFSTKTRSTRIKVTFHAVRCGEDLFSCLVNSFSVCAILSGIG
FT                   IIDTICSSTVYADKNNISLTSQLNSFPLHMVYMIHKKRIMQVHFDGCLDSSLFVKATER
FT                   LVQTCVEQADMLRLTIEEITRTG"
FT   gene            <160117..>160938
FT                   /locus_tag="Eint_021390"
FT   mRNA            <160117..>160938
FT                   /locus_tag="Eint_021390"
FT                   /product="conserved hypothetical ATP binding protein"
FT   CDS_pept        160117..160938
FT                   /codon_start=1
FT                   /gene_family="HOG000191633" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021390"
FT                   /product="conserved hypothetical ATP binding protein"
FT                   /note="similar to ECU02_1430"
FT                   /db_xref="GOA:E0S601"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniProtKB/TrEMBL:E0S601"
FT                   /protein_id="ADM11136.1"
FT                   /translation="MSLIESEKKEEDGTRRKIFVVVGMAGSGKTTFCQRLYSWISQDNC
FT                   TIDPATGLNSHIYSINTDPAVVNTKMPLNLDIRDVVDYHETMEKYELGPNGGINTCLNL
FT                   FLLNIGEYIDRIKEEYIIIDTPGQIEAFTWSSPGYVLIEALKTVGEVILVYVVDSVSSH
FT                   KHAVFMSNMMYAASLMCRYEVETLCLFNKKDLSGSELLEEWISDYESFRDSLNDEDMFS
FT                   PILGSMALHFEEFYNSIKTVSVSSSTGSGKSDFFDAVNQIMNEKYPENKFE"
FT   gene            <161013..>162644
FT                   /locus_tag="Eint_021400"
FT   mRNA            <161013..>162644
FT                   /locus_tag="Eint_021400"
FT                   /product="hypothetical protein"
FT   CDS_pept        161013..162644
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021400"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1440"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="UniProtKB/TrEMBL:E0S602"
FT                   /protein_id="ADM11137.1"
FT                   /translation="MKAKDRRNRTKMKSIDSISRIKESKIAYSLPHGPYRVVSIVSLGG
FT                   GCGNYFDKYLHENRGLFFSPEYKINYLFKETCGVSEFHIGYLCRASDIVVFFINSDEID
FT                   DSKLKIIKKFVPSCLFCISNQRFKDVARKVVKKHFPKERIVEIDGLMGVLSNVRVKNTS
FT                   VCKRPYIVPSNAYSDGEYFYVEGFLKRGFLSDKVVVNGRYEMTIEEIFTDRLYKGEDLC
FT                   VSVDIEKTSLAEGEELESDCNSESLESGCDEYEEKENDESEEFTTDESSTEDRPSLIDK
FT                   YSEYRGIRNLSTCSFKSYNFPSHYKSLVFFDDFRRAEKLITEQDSIIPNDQMVKIKLRY
FT                   EGLIEEQIYVVFGCYEYEKRKTIHNFHFEGIEPLKEESMVVDLGHRIIDIRPMITRNLN
FT                   HRVFKKQEELESGVVSFIGPMAFGLSRVLLYKKSALGELSKETLVAVGMNGFTGDRIIF
FT                   EEVVLQGIPFRNKKRYSLVKRMFNSKEEVMYFRNIQLYMRSGKITGFIKKPIGTKGMFK
FT                   GYFTHPIKSGDKVMMSLYKRAFLEDQ"
FT   gene            <162690..>163616
FT                   /locus_tag="Eint_021410"
FT   mRNA            <162690..>163616
FT                   /locus_tag="Eint_021410"
FT                   /product="Kin28-like Ser/Thr protein kinase"
FT   CDS_pept        162690..163616
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021410"
FT                   /product="Kin28-like Ser/Thr protein kinase"
FT                   /note="similar to ECU02_1450"
FT                   /db_xref="GOA:E0S603"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S603"
FT                   /protein_id="ADM11138.1"
FT                   /translation="MKTYIKEKRLGEGTYAVIYLGYRCLPQDKPLVDSGTKIEDTPVAI
FT                   KKIKLNKYTQGHEISAIREIKALKRISCKYVVKLLDTFIYDKCIHIVLEYVETNLENVI
FT                   RNPDKIIMPGDIKAWMLMVLRGVYECHKLFIIHRDIKPNNILITAEGMVKLADFGLTRG
FT                   IGNKMTPQAVTRWYRAPELLLGSRDYGSPIDMWSVGCVFAELFLRVPLFAGDTDIQQLD
FT                   MIFRALGTPKEKEWPGLSTLPSFLEFHQYEKTSLRPLFSAASSDAIDLLERLLTLNPGN
FT                   RISCDDAIKHPYFKSFPSPTPMGKLPV"
FT   gene            <163752..>165893
FT                   /locus_tag="Eint_021420"
FT   mRNA            <163752..>165893
FT                   /locus_tag="Eint_021420"
FT                   /product="Vesicle coat complex COPII subunit Sec24"
FT   CDS_pept        163752..165893
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021420"
FT                   /product="Vesicle coat complex COPII subunit Sec24"
FT                   /note="similar to ECU02_1460"
FT                   /db_xref="GOA:E0S604"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S604"
FT                   /protein_id="ADM11139.1"
FT                   /translation="MHSRDFASQAMHQTSKQFPKAFEGQRRPKMKIPDFPSELEKDQAS
FT                   FFSFDTSVQPPPLSTTNCFITETTNTDPNLLRSTMYTLPTDTDTFESMEIPFGLVLNPF
FT                   NQKAMATELDKSISMKCWQCQSYVNIFTKIEGNTFYCNICNSKNQAKEKISSEVTRYST
FT                   IEYVDRVKEERITRPEAGNIVSESLFRTTMIDGPAFIFGIDTTASPLMEHAFKAMKLLI
FT                   NDENFRFLFKKVGVILFSSTVSLIKPSGGMITEVLLSDRLQLPFISPEFLMDSEDDGLM
FT                   KSLMEYVMGKSEDKGKFKNGFEDCLRVAISIAGYCKGSKMAVFSNIQDKVEYEEVAKQL
FT                   IEVGCSLNVFSTQKTSATKLCASTTGKCFIYSLESLSKLGPDLLNLGVTKSSYKVQVEA
FT                   KTSDAIRKLSFYGNTVFEHLGFQDFAHMDDKTAFGMTFSLEEPLQNKSKVYVQVILRFY
FT                   SFDGSSRVLVMNSSFEGSSRISEVYASLSFDTLACIYAKYIAMDESTAKEHCKKVENSI
FT                   SRSLKYYRDNCCKEASSSQFVLPESIKLIPLIYQAMVKNSCFSNNISTDTMSRVTGFTV
FT                   EENLRFFYPRLFAFTDFYIDKSLEKVKALRLNVESLNSEEIYILDNSQKIYIYIGKDVD
FT                   ISLKEAIFRDKTEENEVLDKMIDEFYTYYDSELPVIFVEEGKGGSEVEFVGYMVEDRLN
FT                   DIPSYSDYICELHFKVKNA"
FT   gene            complement(<165972..>166442)
FT                   /locus_tag="Eint_021430"
FT   mRNA            complement(<165972..>166442)
FT                   /locus_tag="Eint_021430"
FT                   /product="prenylated rab acceptor 1-like protein"
FT   CDS_pept        complement(165972..166442)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021430"
FT                   /product="prenylated rab acceptor 1-like protein"
FT                   /note="similar to ECU02_1470"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniProtKB/TrEMBL:E0S605"
FT                   /protein_id="ADM11140.1"
FT                   /translation="MQGGMHEEKTFQKNIKEALGDKNAARDFFSIRKASIPRDFSVAKR
FT                   RILVNLDRFKFHYLAMSSAFALIYVLYRLELVILIGIIAVTAYAYQTKPTLFNVELEPR
FT                   SVCIAGAVGILIFFIFSREAIVGLLAISAVCGMMTLAHSMLLEEDLQRDDEV"
FT   gene            complement(<166579..>167130)
FT                   /locus_tag="Eint_021440"
FT   mRNA            complement(<166579..>167130)
FT                   /locus_tag="Eint_021440"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(166579..167130)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021440"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1480"
FT                   /db_xref="UniProtKB/TrEMBL:E0S606"
FT                   /protein_id="ADM11141.1"
FT                   /translation="MEEAKTLLQDLCEKFKNPAEKNILMALDSQRKEERLKMETVTRTL
FT                   QENVQLFKKKNMQLEGEVRKYSYTHSKKNDAFVEINNEKLRLAKKIVELEDENEKIKAG
FT                   IITTDKRIQEKEEKLRALSRPSFNEIYLEIVKGFGTEFIEGDGRKYCRIKSKKMGDVFT
FT                   IDIGSDVSLFEITNSIWEKI"
FT   gene            167214..167295
FT                   /locus_tag="Eint_021450"
FT   tRNA            167214..167295
FT                   /locus_tag="Eint_021450"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Type: Leu, Anti Codon: AAG, Cove Score: 52.86"
FT   gene            complement(<167401..>169995)
FT                   /locus_tag="Eint_021460"
FT   mRNA            complement(<167401..>169995)
FT                   /locus_tag="Eint_021460"
FT                   /product="alanyl-tRNA synthethase"
FT   CDS_pept        complement(167401..169995)
FT                   /codon_start=1
FT                   /gene_family="HOG000156964" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021460"
FT                   /product="alanyl-tRNA synthethase"
FT                   /note="similar to ECU02_1490"
FT                   /db_xref="GOA:E0S607"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:E0S607"
FT                   /protein_id="ADM11142.1"
FT                   /translation="MMWTTEKLRRSFLDYFASKSHKIVSSSSVIPFEDDSLLFTNSGMV
FT                   QFKKNLLGERDDLRRACSVQRCIRAGGKHNDLDDVGKDTYHHTYFEMMGNWSFGDYFKE
FT                   EAIGFAWEFLVDVLKLNKDKLYVTYYEELDKESGNIWLKYLPSERVLSASYKDNFWEMG
FT                   DTGPCGPCTEIHYDRIGNRDASELVNKDDPNVIEIWNIVFIEYNRTISGLVPLERKCID
FT                   TGIGLERLLSILIDVRSNYLIDSFAVIIKAIEDRCNFKYNDTEESIDVAFRVVADHCRT
FT                   IAVCTYDKVDFSNDGVGYVLRRILRRAVRYAHEVLGLKEGVLGELVGIAAHAIGIELKS
FT                   VDCVNKEELQFMKTLKKGIERFHKLAENNGKISGEDLFLLYDTYGFPVDLTEIMAKERN
FT                   IKIDYTNFESFKQKAVEISKMSKGMKLNIDAGLQSKFPRTDDSFKYTKNSINATFFFGI
FT                   EGKEIITKPNEIPEGRELGLVFDKTCFYAECGGQVGDTGKIIFYDGEKDVGVFNVMDTQ
FT                   AIKGFVVHKGILEGSASYQALQMYDQELRKKIMKNHTGTHLLNFFLRTIIQTEQRGSLV
FT                   DPEKLRFDFEGRKLTNQELEEVEKKVNEFIQSNTDVEAITLDREQAMESPNIVRMRNEE
FT                   YPEKVRVITMKANGLTIEEMCGGTHVTNVSDIGKFRIISETGVSANTRRIVAVTGKKAQ
FT                   ELDMEAEIYLSKLSIGEVVNVDKTIPLFYRQKVEVLNQKNKKKGEELSRAQYAKNKKEI
FT                   LELIAKAKNTSNLDDKTVVYYYQPTDSCTRKDLVRFIGLLCGEALKSSVQCLVYVFVNE
FT                   ETILAGNVSDNKGLIEKITSRYPNSHVRASKGIVQGSIHTKMNYEDAKGLLR"
FT   gene            complement(<170339..>170644)
FT                   /locus_tag="Eint_021470"
FT   mRNA            complement(<170339..>170644)
FT                   /locus_tag="Eint_021470"
FT                   /product="putative transcription initiation factor TFIID
FT                   subunit TAF12-like protein"
FT   CDS_pept        complement(170339..170644)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021470"
FT                   /product="putative transcription initiation factor TFIID
FT                   subunit TAF12-like protein"
FT                   /note="similar to ECU02_1500"
FT                   /db_xref="GOA:E0S608"
FT                   /db_xref="InterPro:IPR003228"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S608"
FT                   /protein_id="ADM11143.1"
FT                   /translation="MNIEHHFLCPKKLLKLCNKKIDKDVIRNLQLLTEKFLSDIIHRSA
FT                   LLCKHKGKNIVDNGDIRFIIEKDFDYSFGGREIQGSKSLPTSEHLERMAEISRQNK"
FT   gene            <170637..>171791
FT                   /locus_tag="Eint_021480"
FT   mRNA            <170637..>171791
FT                   /locus_tag="Eint_021480"
FT                   /product="hypothetical protein"
FT   CDS_pept        170637..171791
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021480"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1510"
FT                   /db_xref="UniProtKB/TrEMBL:E0S609"
FT                   /protein_id="ADM11144.1"
FT                   /translation="MFILGIKNSTRLFSPFSQMVEIIDKIREIKYADEMDYIVEGLVNN
FT                   EIEESLRLILDLTNDEKFKSYMKESRYLDEIIQVISEKGVLETTSGMVLEILSRTFNPY
FT                   SLVDFKGLFKVLAMAFNRCEVENISAESSICVQREANFITEILEKIPIKWYSKFSNHTE
FT                   LRKVVFSLQMCTSRKVIEWNKFLISLLMKHPELGIIDDFASILLKKGRNYEVIANYTMF
FT                   RENAEKLFLSENFRQCLRRVVIKEFIKDKDYKRPRYMLKGLTPKSLVLPVPETKKKESL
FT                   GGIEKDSKSLSRKRFLIIILINLLFRDFHLDIPLSLIERAYYSVDEITRCYIAILLLSI
FT                   EYSEKNTVQSIHVEDLKKDARHLLSISNTCLCEEILNRLIKISS"
FT   gene            <171876..>173150
FT                   /locus_tag="Eint_021490"
FT   mRNA            <171876..>173150
FT                   /locus_tag="Eint_021490"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="involved in mRNA export from the nucleus"
FT   CDS_pept        171876..173150
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021490"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="involved in mRNA export from the nucleus; similar to
FT                   ECU02_1520"
FT                   /db_xref="GOA:E0S610"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S610"
FT                   /protein_id="ADM11145.1"
FT                   /translation="MADKSLIQDDKEVARELFAMIKQDTTAIETGLDGNVSGVVTDRGK
FT                   LLVAEHFSDMGLSDELLKAIYNRGFEKPSLIQKSAVPHILKGHNIVVQSKSGTGKTIAF
FT                   TCGILGNVNAGEGTQALVVTPTRELSTQVTEVISGFAESLGMKVFSALKNKTTDIVREE
FT                   VVVGSPGTILKLIDLGKLNHKEIKMVVLDEADILLDKDMMGTQTFRILKLVSGAQIIFF
FT                   SATYSDQVKQTIEFYTPDAVKMYEERNGKPEEIKLFYIEAEGDNKRKALKSLYEYLSIS
FT                   QMIIFVSTKATVNYLRKRLEDDLHSVSCLHGDLEIEEREKAVEEFRTSKTKILLTTDVF
FT                   SRGMDIPQVNLIVNYDLPIYKGVASTQTYIHRIGRSGRFGRTGFVVDFVRDEELEAYLK
FT                   FQKELKFASKKFTIKALEEVAEEID"
FT   gene            <173280..>175397
FT                   /locus_tag="Eint_021500"
FT   mRNA            <173280..>175397
FT                   /locus_tag="Eint_021500"
FT                   /product="hypothetical protein"
FT   CDS_pept        173280..175397
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_021500"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1530"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S611"
FT                   /protein_id="ADM11146.1"
FT                   /translation="MEGLEDDFIPDFTHLSVAGEVADRNSLVRQEGDVVYISVGNRLNG
FT                   WNLRFSEIEKSIPTLKKRITHFDFSDGVLVIGYENGAIQVHSSEIISFRPHSRRVTKVS
FT                   KIGDYILSSSADGSIILYDLIGEEIRISYEGNDICVEKFFSDSSVVIGICSDNALRIWN
FT                   LEEKHVKSVHIFGKAIKDVFAVNEEALIFFKDGECIFYNLVEKTSRPFNKFKKLRNIKV
FT                   RGNKMFLQNKNKLHIYEIDSKDKIVLRDLEAEKISDRYTDFDVMPDGGLLFATIDNSWE
FT                   CLKDGKIYPFGFHRSEILGLETCEDKIVTMSKESIIFWVIDKKEMKRVGNIQIKNGKCM
FT                   CIWNGHVVIGGSEGLSCYSGLNYLLVKEENIGPISSVFATRQELLVGKDNSLLFYDNRW
FT                   VVSRTLEVEDPISSIEASQDGSLLCIGLLNSKVHIYGMNELNLRITLYGHALPVRSMKL
FT                   SPDNSEILTCGSDKTVKMWGTQFGECRKSFIGDSRSIEYWNKDLFMFTSGVIQYFKRYE
FT                   KLKEFKNRESNLVKIRKDMMISCGKFNVDLYTMNKYEFQKEDEEESNEEEVMRVAKIMN
FT                   YKMYDRFLTELEELSKDFSSDNIKTFFNVLMDIDFCELDKFLCLMNSSDIIQVMNVLHE
FT                   CCNWNAILVARVFISLVRLHKDICISHPKFKVFLQTITDKTKEVRTQVSRNQGLLLTRK
FT                   SINKEQSFSVE"
XX
SQ   Sequence 175776 BP; 52108 A; 35673 C; 36206 G; 51789 T; 0 other;
     ggttagccat gccctaatct tataatagca aggttggagt taagaaaaac taaatttata        60
     accctctaag aaaatataga taggaaatat cttattcttt taattagtat cctaaaccga       120
     aactctttat tattgccttt tctgtatatt tctcacactc tcaaagacac cttttcgttc       180
     acttttaaat aacttgtaaa actagttaat gaagtatatc aaattctact ttgggatcag       240
     attcttactg aaaagcttac tggaatcttt ccccttactt caactctttc aatttatttt       300
     cacataagtt ttatttcaat acgtcatcat ttctttttaa tatctatgta gaaatagtct       360
     tgaacaaaat atctccgttg ggacgtactt gccattttaa attaacgtca tagttggcct       420
     ctaaacttct atccaatcag ggaatgttga tatttaatag aattgtaaaa tttatttggt       480
     tattccatat tcaattatat tctcctcttt tataaaatca atttccaatc ttatttacct       540
     cctgctgatt attttaaata aaaaaacttt ttcaccctta taggaacata tgaacattca       600
     aaagactcct aaagatttat ttgataacaa gaatgaagaa aaaatcacta agaaactcca       660
     tcccgaatac ggtgtctact ttggtgctct tgtatccatt ttaattcctg ccattatgat       720
     ttgcttattt gaagaggata ccataaaaaa aaatccattt tttatatctc taatggttgg       780
     tttttcattt ttatattcta tgattctaaa tgtctataca tttatgaaaa ttaggaagtg       840
     tgattgggaa tccttagaga cttactacta catatccaaa ttcttccttc ttttattttc       900
     catcatctct gccctttctc tcatttcaat tcccatgggt ggtaactttc ctcgaaatga       960
     tcagaaactt tatacttttg ggttcttccc gtgtattgta tcgactgcct atttgttgtt      1020
     ttttaatctt acaccgaagt cctccccatt tatgggccca gttaccgaca tttttattat      1080
     tctactgttt ctaacatatt cgataggaat ttggctttgt gttgctcttg aaaactctaa      1140
     tttttctttt ttaatttacc ttggagttct ctttcttgct cttattccgt tgaaattact      1200
     gaaagatcaa tataatccat gtagaaagga tgataaagct tctacattgc agaagcaaat      1260
     tctctttatc cttatattga ttactgctgc aaccatctac ggacttttac tattctttga      1320
     tttgcattct ctcccattct ttaactttaa tgattagaaa taagataagt taataaatat      1380
     caatagttta tttatcataa tctactatgt ccaatatatg aaatatgaat ataactctat      1440
     ttttgcatgt ggtatccctt taatgcatgg atagttctac tcataatata tttatttatt      1500
     gattcccctt tgcttaattg tttaaatata aagttctcgc atattccata attttttgct      1560
     caaaaagttc catgttcgat tccctttccg cctttttgga aatcattgtt tcgcttgtgt      1620
     tctcacttcg tttacaagat ttactacagg cgttcagact ataccaaaaa actaaaaaaa      1680
     gatggtgaaa atagaagtta atccaaaagt attgttgtga tttcaataac aatagtacgg      1740
     acattatcga tatcagccca aaggtgaacg gccctcttta agacaagcat tttaagtttt      1800
     aaacagattc aattacctta gaagaaacaa ttttaattaa aaattagagc tcttctcttc      1860
     ctatttcctt ctcttcccca gactttgccg agctaaggaa ttcttttatt ccgttgtcaa      1920
     attcctggag tttctcttca atatggattc ggggagctat ctccttgtgt ttttccagcc      1980
     acaatctcgt tttctgaaca tattcaagag catccttctt gatattttct ggaattacct      2040
     cgacaaattt agggctctcg gcctgttcca gagcatattc caacttttta actacttctc      2100
     gtttcttcac aagttcctga ttttcctcac tgtggactct ttcttcaaac ctctcgatct      2160
     cctctggggt catgttggca acggcagaac tgaaatatgc atccgcggtt ttatcggttt      2220
     gcaaatccac agccttcaca taaatctttc cgtgtgtgtt gatttccaat gtaacagcaa      2280
     ttcttgggac accccggggt tggttccctg gaagacccaa ctcaatatct ccaatatgaa      2340
     cattgtcttt gaagctttct aagcccccaa gagccacgcg gatcctaact tttgtctggt      2400
     tgtcttgggc cgtagtgaat tcttttgttc ctgttgccgg aagaagagca ccctttgaaa      2460
     taatggcttc aaaatgatcc tcctctgtac agattccaag cgaaagggga acgctatcag      2520
     cagttacaat ctgctcggac tcactaagca tgttgagctc attagctgtg tataaggctg      2580
     cacctcttgc aactattgta tctgcattaa taccttcgta gtgaatttta tctgctccaa      2640
     aaatctcttc aacaatgtca attactttag ggattcttgt cgaccctcct acaagtagta      2700
     ccctattgat gagattcttg tcgtatccct tattgtcctt tccgtctcca gaaagtaagg      2760
     agttcataat actttttatc ttggagtaga aagcctcgtt cagctcgttg aacttttcat      2820
     ttgtaagttc caaggtaact gacttttctc catcataaat aaaattcttg gtgatcaaag      2880
     gatttgcttt ccttcctgga gatttgcgaa cctggtcaca aagatccttt ttcatttcct      2940
     cgacaagatt tctcaatcta agcttaacat tctggttctc cataacatcg aacccggttg      3000
     tgctcttgat gtaagcagca aagtgttttg taaggttatc attgacattt tctcctccaa      3060
     ggaagttatt tccttcatag cacggcacca tcatgaatcc tcctgatgat tcaacaatgg      3120
     aaacatcaaa tgtacctcct ccaagatcga atacgcagat attcatgtca tccacctcct      3180
     ccttagtggt gattcctttt ctgataagat catatgtatg ggcaaatgct gctgcagatg      3240
     gctccttcca ggttaagggt gtgggaagtc ctgccatttc tgctgctttg atggttgctg      3300
     caacttggtt cggatcaaaa taagctggat aggtaatggt aagcccctga atcttatagt      3360
     cctttaaaat ttggtccttc agcatgcgca agacatggct agaaagttct tctggggtaa      3420
     ccgactcata tccgctctgg ttgggctcct ggatcttgta agccaccctc ttctttcctc      3480
     caacattttc cacaaatata gggacagatg catttctctt gatgtcctca accttcctgt      3540
     cgatgtttgc aagatcttca attccaatgc ctcttttgaa agcatagaaa taagtgtttg      3600
     catttccttc ggagttgtac atctgcaatc cagcccatcc tgctactgcc tcatacttag      3660
     acttctttcc atctccctca ggaagcttct tgaagaatac aaccgatgga taggtttcct      3720
     ctccactggg agagagaaca aaccttgtat cctttaaaga tgggctatat acagatatgc      3780
     agctataggt ggttccaagg tcaattccaa ctgccacaga ttctctcaga tcagcgtttt      3840
     cggttcctgt acaaaaaatc gttgccagag acaacaacaa acctctaact tgcatacccc      3900
     tatctctaga gaaaaaattt atacaaaatt ctttccaatt tttacatgtt gaaccatcgg      3960
     aaaacgaaga ggcttccata ttaggaagtg cccatgtaaa caaattatac aatcccgcca      4020
     ttacagaata aagcacagtc ttggatacct taaggaatta tctgcagcct tggagttgat      4080
     gcagatatgc tccgaagact cgatgtactt agccccgtag atgaatccat tttcgaacac      4140
     gtagggctga ttggagtcgt ccatttcttc tccgcttccc cggcacagta agatgcttat      4200
     ctcgtgtttg ttgaacggta catcctctct tagtcggaat gccttgcagc atgctgggca      4260
     attgtcattt tcggtatcga tgcatcgata tgttttgtat gccatcattc catattctat      4320
     tcgttgcata agcctagact taggtcctct tctaaacaat ttcagtgcac atcttagaaa      4380
     ttgctctgca gttttggtat gccttgaaaa cggatatttt ctgaagtttg agttcgatac      4440
     aagaacaggt aagtacgact ttatctgttc tggaactctt ttaaactctt tattgatgaa      4500
     ctctagagcc ttatcgaatt cttgtgcatg acacatctct ataaactttt caactttcag      4560
     gtcgttttca agggaaatcg cctcttccca ttttatgctc ctaagctcca tcctgtgctc      4620
     tctgcaaaat gctagagcat cttcaaaaga tccagtctcc acctggttcc tgatctcata      4680
     aatccgcttg taaaagtctg aatcagaata acctccaatg gagaatttcc tagccatcag      4740
     ctctgcagta tcgaagtatc ccatatgctc aaaatgctcc ataatgaaca cattgagaac      4800
     gttcaccggc tcttttctgg ccactattgt ttttgcgttt ttttctattt cgtcgatgtt      4860
     caattttatc acctccttaa gcttttcaag cttttgcatg tattcttctc tgcttatcct      4920
     tccacattta tacatctgaa agagcctttc cataagcttg catgttgttc tgagaatgtt      4980
     tgatattctc gcctcctgga ttgttgagag atccatcaaa acaatttgct ttctttcaat      5040
     atatacacat gttgacatcc cactcaaaaa tcaaagtgtt ctaaattgga aatcggcgta      5100
     tttattggaa ttagctctaa aagcctaaga ggagaaggtc tattcagcta aaatcaacct      5160
     tgtgtagctt atttgtaatt gaaagataaa tgtttttgtt gaaaatcctt cttggccttt      5220
     tatctaccag ggcttctccg ttcttcttcc aagaattacc atccttccta tatcttttta      5280
     gaacagaagc atcctttacg cgactgaacg ttaaaataac ctgatcctct acaaaaacat      5340
     ccatgacatt tgaatcacta attaagttct cttcggcagc tccatctttc atttcaaagc      5400
     taagtactcc atccctaggt aatgatacaa ataatgtatc accagaaatt ctaaaagatg      5460
     taattttttc ctctcttaaa atccactctt cggattctac tctgaatatt ccacattcat      5520
     caagtaagaa aattccattt tttgtctctt caatttgccg aatattttga ttgataaggc      5580
     tttttgtgat tccaggacct attacttcga taagacttcc atccaaatat aagaaaagct      5640
     ttcccttgga aaacaccatg tctgcaggtg tagccagtgt ttcaaccgag ttatacttcc      5700
     ctatcaataa caacccatca ctttctatct tataaacctt ggcagttctc ctcccttttt      5760
     ctcttctatg ttctaatcca ataatgaatc ctgatgagta gaaaaaatca aatccctcga      5820
     ggtaagctat tctttgcatc tcttcctttt caaggtcata tataaaaata taatctctcc      5880
     ttactgcaac tatagagttt ttggaggaaa aaagaaaatc ctccttctga aatacataag      5940
     gcatctttac cttggttttc tttatattat gctcaaagat ttcctttcca gggatttctt      6000
     cttctctgtt ctcaaagcca ttaagagact tgcagtattc aaagttcgga agagaaaata      6060
     tctgtttttt ggtactcccc accttcaaat catataccaa aaggcaaaac acagtcaaaa      6120
     tgtaaacatt actctcgtct tggacaaaat ctacaaggtc tccttcaaat gttgttagaa      6180
     atgtcttctc atctctctta gtttctattc gaacaagctt tctgcttgaa cacacaacta      6240
     gaagactttc aagagtagtt attataattc cggtaatcgg acgagcatgg taatggtacg      6300
     ataggcttga ctttcccttc aggaaattca gaacattcgc atcgtctgta tatgcaatca      6360
     ttccattctt cactgcaaga tacttgatat ttacatcccg aagaacttct gaacttcttc      6420
     tctttacaat atcaaaccta attaggcttt tattactaca tatgtagaaa tcgaccccgt      6480
     cccagaaata agttcctgct tcaaaatcaa acagcatttc ctgttcctca ttgattccta      6540
     agtatctgtc catttcttgt acaagataaa agagttgacc gtgatgcaca taaaagtcaa      6600
     aagtcttctc gcttggaact tcaacttcat gagccggatc ttcaaataaa ttttcgtaga      6660
     taaatatctt cttccttgtc aagaagtaat atttccgatc aaactctctg gctactttaa      6720
     tcttaaagaa ctttcttctc cttaataata caaggtcctt tttacaatat tcctcaatag      6780
     aattctctcc tactttataa accacctctc cattgataaa tatctttctg ttatccccgt      6840
     ttaatatcat aagggccata aaattttcaa gtttctttat aaaattggaa agctaagcca      6900
     gggtttcatt cctagagccc tcctttatct tatctcatac ttccttccat tctgctcaag      6960
     atatctctgg aaaaaaggct gctccttcag gctgatcata tcttctacat acttcttggc      7020
     tataacaaac tgaacgctca ttcttgcaat ttctggagac tcatagattt cggttctttc      7080
     caaggtctca tcaatgagct ttacaaatct aatatcgttt tctactgagc cctggcttaa      7140
     cacaagcagt attttgctga tagcttcttc ttttatggct tcctcatgct cgataaacct      7200
     ttgtttcagc aatcccagca agttcttaat tttcaaatct tcgtatttca gcattacatc      7260
     ttctctttcc ctcataactt tgctatggaa ctcaactccc ctttcagctc ccttcaggat      7320
     attcaatcca agtctattga tagaacatcc cacttttctc tccacatttt tggtatgatc      7380
     actatattta cgggaccgtt ggaagctcag cagcttagcc gccatgtctg tattgttata      7440
     aagacaagag agtaatgcag agactccttt tttatagtgc tcttcctcta tgttcttgat      7500
     aggttttcca acttcggact ctaaaatacc ctttttcttt gcataaacag cttctatata      7560
     cccaaagctc tgttctaata tccattcatg gaactttcga agtaccttac atatttctaa      7620
     ctccataaag atcctttttt ctttctcctc tacctgagag tcaatatttc gctggtaaaa      7680
     aatcaaatcc ctataatctt tgaatctatc ttccacttct ttgctaagac tggccacttg      7740
     caatgtcttt tccgtgtttt ctaatgcgtt ctcgagatac acaacaagat ccattctacc      7800
     atcctttcca ccttctaact tatttcagaa ggtttcagaa aacacaaatg aaattagaaa      7860
     tctcaccaag aaacacagca gatatgctgt ttgaggaaga acaaaaaatc aacctttatt      7920
     tgcttttgtc tttagggatt tctcattgtg agatcttccg agatcatatt cctccccaaa      7980
     cttctgaaaa tcttcctccg aaaaaaactt gacgacaaat agctgggttt tctttctctg      8040
     tgcatctgtt tcaaccgtgt cttcagtgga catccacatc catccgttac tgacctttcc      8100
     atggggctgt gccttaaatc tcgggttgat aaagtggttg catccaagcc taccaatctg      8160
     atccctaaaa actgttatct tcactagatt acttttagtg tgcattccaa taaccatcgt      8220
     tccctctgca cgctcctcaa gtgccttagt ctcctcagag aagtaataaa gcttgcatct      8280
     tgctttaaac aggacatcat cgctctgatt ctcctcgaga tgttttcttt gcttttcgac      8340
     tacctccgtc acatcaatct tgtccttttc ctctcctccc ttggaattgt ccttccgagg      8400
     aactgtatta gttagaaagg gactttgctg tgttttctta gtttcaattt tctccttaga      8460
     atcccccaac gatgtttctt cttttgtatc actctgtaat tcctcctctt tcttaccaga      8520
     aacagcttct attcccatct gctcttcctt tttttctacc tctgccatta gactttgggg      8580
     aaggaatttt gaacaaaaaa atacacagtc tcaaactaga aatgatttaa tatgttagtg      8640
     gcagatccca ccggaaaaaa gcgagaaatc tgtcgtcttt aagcgtatat ctcttttgaa      8700
     tccatctctc ccattgtcca cttcttcgaa ttctaccatg tcattcaagg gagatccggc      8760
     tgtgataaac agagcattgg caattataga ctcaatcttc attggctcag tctccgtgaa      8820
     tgttgccaca tcgtttgagc actcaggata cttcctctga ataacgagag gtgtcttctg      8880
     ccctgccaga ataaagtcct cactatatcc ttcagactcg caggtataga gaagaattat      8940
     cgatgcccct ggcttatctc tagctgcttg aaccagatcg tattggaatc ggcttgtgtc      9000
     ctttccacat ttatccaagt cgatctcggg agatgtcatt ccactaacac tccagtcgaa      9060
     gtgaaacttt cgtttgtctg tgcttgccct atctgcatat acatgttcat tcatcttctg      9120
     ctccagctcc tcagcaacac ttcccacaat gtcttcaata cttctacctt tatcaagaaa      9180
     cttccttctc ccagcttcag aaatgtacac ctctactgga actctcctga tacctattcc      9240
     ctgcgagcaa atcgccaggc ccatcagaag gatcaggaag tgcttattac caaacatgca      9300
     ttccttagaa aggatgtatt tatttccaaa tctgaaactt acttgaggca ttgatgtttc      9360
     acgaccaccc taaacttgga tccaggaaat caaataggtg tcttttcctc tcatattaat      9420
     agcagaagac ctaaggtctc tcttttttaa aattatcaaa gagtctcttt cttgctcgat      9480
     cgctgcactc gttaggtatc cactctgaaa ctaacgaaaa caagactaaa accaagcgtt      9540
     aatggataaa caatgaagat tcttcttcta tctcctcttg tgcttgcaca tgtaatcaat      9600
     ttggttattc tttatgaaaa gacagggctt aaggaggtca aggagatgta ccactatgtg      9660
     gtcgaaagat tgttggacaa gttcaatgag catctgcaac gaagaggaat aagaattagt      9720
     ctgatggact ttctggcata cgacgattac cttgtcaaac ctgggtatca ggatatatcg      9780
     attatgggtg gagaggagag tcttgatgca agaatcgaag cattgaacgg aatccccact      9840
     aatgttattc tcgttgcctc agcaagtccc gaagaagaac gggaaaaatt tataccaaac      9900
     tctccgtgca caagccggtt tattagcaat atggtttcca acgacatcgt tgacgacgag      9960
     ttacttacca aaatcatata tgcagtcctc gactggatga ggggcctttt taaggtggag     10020
     gttccaagtc ctgtaaagga gagaagccct gaagtctttg acaaatttgc aaaagatgtt     10080
     actacacccg agtttataga aaacttgaag caatgcacaa aagaaacaag agacaagttc     10140
     gagaagttta tccgagcaat gaactgggat gaagaaaaaa tgcttagctt gagaatgatg     10200
     tctgaaaaga ctgaccattc ccaaaacgaa ggagttgaaa tatcaagtcc tttgaagtgg     10260
     gtcctatcca agtcagaaaa gaaaaccaaa gatactgaaa ccgatcacca atgctcggaa     10320
     gaaaataaat caaagaaaga acattcggaa tcatcttccg aagacgaaga ttcctcctcc     10380
     aagaatgata aaaagaagcc aactaaatcc cataaaccta aagaagtacc ttctaaaagg     10440
     ataaagaaga ttttgtcaag aaaggaagag tcagatgact ttacagactt agaagagaca     10500
     gacaaaaaag aaagagacaa ggaatatgaa aaaagccaag gtaatggctc tctaagatac     10560
     ctagataaga atacaaacct ccacaatatg cgaaggttga aagaagacga agaaacacta     10620
     atggaagaga agatcaggga ggaactccaa aaaatcatct ctcatgagcc ccacaataca     10680
     aaaaaaaaat ttgaagactc catctttact ggaattcctc cttatagtga tgaagaagca     10740
     agaaatggcc catccagaat actattttca agtagagcta ccccagtaaa agggacatca     10800
     aggcttaata gaagcttatc atacggaaga atcccataca gaggcggcta atggaaaatt     10860
     gaaatcttgt ttcacaacct tcgttacttt attaaaaata gaatgtgatt ccaggtgtat     10920
     cccctttcaa atatctcctt aaagatctga aacatatgtt ttcttgttag atgtgttgtt     10980
     cacgatcttt tgtttcaaag gttgtataat aaatcgaaca atgatttcag agagaaatag     11040
     atgaagtcga ggctgctagt atttgcatgc tttgtcttcc ttgtttatgc aagagaacca     11100
     ttaaagatag gttttttaga agggatcttt gggaaaaaat catcagataa agaaactgga     11160
     aagggtaatg gaggaggagg tggtccatta cctcccaatc ccgatgagga agaagctata     11220
     agaaagttaa gactccaagc tttaatgttg ggtacagagg tcgaagatct aggcaaaatc     11280
     ataaatcagc aatctaggga attggaacaa agaagggagg aagaaggaga aaaactaaaa     11340
     aatagttctc aaggagtgat acaggcgtca gaaaacatta aaagcattaa cgaagaaagt     11400
     aaaaaaggtc ggagaaaaat tcgtagactt caaaagagga ttaaaccaca tacatcagct     11460
     atagaaaaaa taattaatga tgaagaaggt ggagaagaca gagatgatga tgataacgat     11520
     gatgatgatg acgatgatga tgacgatgac gatgacgatg acaaaaagaa aaagaaaagc     11580
     aaaaagaaaa gcaaaaagaa aaacaaaaag aaagatggta aaaataagcc caaatcagga     11640
     ggactaagag gattgttagg gttaggaaag aaaggacaaa aggattgatt tctaactata     11700
     gaatggggaa taaagtcgtt gcaatatata cggttatctt atttgaaagt gttttgtaag     11760
     tttcgattaa tatttaaaac aagtaccgaa acattcgaaa taaattggac ccaaagcagg     11820
     taaacaaatg agatgtcttc ctcatctgtt tcttacaaca ttttttcgta tatacaccat     11880
     gaacctttcc catgaaaatc ttttagagaa ggagagtgtg aaaaatgctg tttcaagact     11940
     aagtggaatg atagttaaca aaggtagtaa tcttttgaat ggctattcca aatcccttta     12000
     tctttccaag gcaaaggagg aggaaagtga ggaagaatca tcaaaagatg atagtagtag     12060
     tgactcggag gaagaaaaag atgacagcga gaaagaggag gataatgaaa gtgatgatga     12120
     cgatgaagat gaagatgaag atagttcttc cggttcttct gggggaaaaa aggatcttgg     12180
     aaaagccgcc ctagagggag ctctgactgg actaggtgat acaccacaag gaaaaatggt     12240
     taataatgtt agaaaattat tcccatttgg atagaagata cttagagtca aacaccttca     12300
     cccaaacttc tgaaactaat aaatcattta tctttcattc tgatcttaaa tctattataa     12360
     aacccggcat aataatggga gaattcacat gtttcgattt tgttagaaac ctgaaaccaa     12420
     ataagaataa aatgaactat tcgatgataa tccaatgaag aaaggcatca tagcgctctg     12480
     cgctcttgcc gtttccgatg caaaaagcct tcacttccct cacgagaagg aaagtagcaa     12540
     atctcgtaag gaaatcagca ggatggaagc ctctagttta atctctagtt tggacaaggg     12600
     aggttatcta cttccaatgt catcttatgc taagggaaaa gataataatt ccgagtctga     12660
     ttcctccgag gggaagaagg agaaggagaa gaaggaaaag aagaagaaga agaaaaagaa     12720
     gaagaagaag aaaaagaagg aaaaagaaaa ggaaaaagaa gaggaagaag gtgagggtga     12780
     aaagagaaag aaggacgata gtaaagaaga cgatgatgaa gaagaagaag aagaaaaaaa     12840
     aaaaaaaaag cataaaaaaa agaaggacga tgattaatat tttagaacca aagcctcaac     12900
     ggagagatgg cttgaattca ataaacatat acggagggat taggattact attaaatttc     12960
     tgcggattcc aaatgtgctt ctacttaagt tttatatttt aatctgatac ctatggatga     13020
     gatttattct ggatactcca ccaggaaaag tcactgaatg aatgatctat aaatgggatt     13080
     gtcttagcgg acagatatgg aaacatgcta tccacaaaat cattcattgt cctgtatgta     13140
     ccggataatg tttttaccaa ttccacatac aactctcctt tgtggttgat tgtaaagatc     13200
     cttgagagag gaatttccat ggccttgtaa gtaatcacgt ctgtgatttt attgccaaac     13260
     cctgcaacaa atgggtttga gtcgcagaaa agaccttgaa ttgtttttag gcatgctatt     13320
     ttgaaatcct ccggtcttct tattatcagt tccctatata gtgcagcaaa tacgccatcg     13380
     ggagacaaaa ttacggggcc gtcggggagt ttgtatccgt cttgacaaac gtttttgagg     13440
     tatgactttg tggagaatga ttggcccaaa gatctggcag tcagatagac tattttatat     13500
     ccattcctga ctatttttgt gtataaagaa gccacaccat ggtgagtcca gtccttacct     13560
     atcattccat agagatggcc ccacacatca ctttttgtta ttgttccatc aatatctgag     13620
     acaattattt ttgcatcatc tttccacagg tagatgtttc cctccaagtg cttatttagg     13680
     ccgctaattt tgaagactgc ttggtttttt ccctctttca ggtttagcat cttcagctct     13740
     tccgagtcca gcttcaggga aaaggacaca tctcttttga tgattttctt tgttccaaat     13800
     atgttccatc caagatgctt attgtgttca ttctcaagaa ttttcatgat cctctttgcc     13860
     ttattgatcc ttgagccctg gatttcaaag aagatcttgc agaatatgtc gtatggtagg     13920
     tagaagcgaa agctgcattt tttgcatcct tgaactctca ccaccaggtt ttctatgttt     13980
     cttatttcct gaaccaggaa agagttgaat gtatgatcta aggattcctg tatctttttg     14040
     ttgtagcaaa gggagaatga tatgcttgca cctacgcatc ctttggtgtt tccatcgcat     14100
     gttttgtcgt taaagggagg atatagatgc agtccgacaa taagatgaag aacagagcga     14160
     tatcttccta tcaaaaagtc aaagtgttcg gtagagttga ttagatttcc gaacttgacg     14220
     aatttctttt cgaagtcgtg gtaagaatcc ttatattctc tttggtgcaa aaattggcca     14280
     tacatccttt tcttgaggtt ctctgctcgc tcgcttctta agtacttttt aaactcgatg     14340
     tcctcgatgt tgaagttctt ttctttgaac tttgccagaa aatcaaagtt cagagtgctg     14400
     agatcggagg catttcccaa agaaagctgc tcaagtcttt tactaaggat catctcatcg     14460
     tcggagtcga acatagtgga aagtttcttg ttatactcga gtataatgtc gtagtccatt     14520
     ccaagatcat cttcggtatc tttttcaaag aacagctctc cttggcttgt tatagacatt     14580
     acaatatcgc acatcttccc atttatgaac aaatgaactg tttggttatt gactccgtag     14640
     aagtagagcc ttccaaatcg tagttgaaac tctgtgcacc tcaagattcc gtctctgccc     14700
     tcaacaacaa taacatcatt aactccgctt aatgttattg gattaatgtt gttgtacaac     14760
     ccagagacgg aggttataag tttatgaact atccccatat tctagggctt tcttttctat     14820
     tgatttatct gccgaggaaa cattgcccga tcctctgtcc accgcacata ggaccttgct     14880
     tgccataaga tatggcctac acctttctct tgtgctaaga gtaacctgta tgtctttgct     14940
     tttatttccc agcccattaa atggaagaag atgggccgag actagccaag atgaggcagg     15000
     cttataagcg agccatacaa gagatcctta aggaaaaaga gaagataaaa gaaatactta     15060
     ttgacccaaa cacctctgcc gaggattctt tttttttaaa cagctctaag gctaccaaca     15120
     catctcgagg aaatcctgag agggataccg aggcaatctc gaaagcaatt gaaaatgttt     15180
     ttcaagatct caagtcaagg ctatctagta tctttaaaaa gaagctggag gttaatgata     15240
     ttgagaataa gctcaaccgg ctggacagag atgttcttga aaatagaacc agcttccgag     15300
     atgtaacttc taaggaatac atcaaagaga tttttgaatc gtaccttgtt gacaccaagg     15360
     ttaagtacat agactacatt gaggaaacca aaaaggaagc tttggagaga ataaagatac     15420
     taaaaggcga acttgaaaag gccacagaag aattaaggtt gttgagggag agaaatgttc     15480
     tttttgataa tgcatacagc gatatgatta ccaaattcac agaggctgtg aagaacggaa     15540
     acaatcgatg agaaaacgga ctttaaacca atggaaataa aatttagttg aaggtagttc     15600
     ttatactctt gttaaacttc tatactcctc agcataacaa tttttgcctg aacttacttt     15660
     cttaatatgt ctagtactac ctttttgata tcgttaaaac cttcatgaac tctcatatta     15720
     caaaacacaa taagcttctt tttaggtctt atcttattct tagttatctc cttcttcaac     15780
     gcttcatcat ataagtgaat tgtctcttcg cattgactta catatatgaa tatatgagta     15840
     cttgtttcta ggacttttat atcggtgtcg aatccagaca ctttggtcga aaagtccata     15900
     tatgcagtcc ttccgtctcc tgtgtccatc accttttcaa atagctttct ttaatcttga     15960
     attcatctca tacataattc ttgggtttca acctaaaacc aactcgaaaa attaaagaag     16020
     aaaaatcatt ggtgtttcac agacttttcc tttgatttgg atggaggctc actatcctct     16080
     aaaaggtagt acggatatag aaataccatc catgcaaggg taaataggga aagaaaggtt     16140
     tctacaagaa ctctgtgaat aggatatatc ccacagaatc ccaggcacac aaaaaacaat     16200
     ccctcagcca agaatgatgc tgctattgag gaatagaact ctaccatagt tattttcctt     16260
     gaagcaatta gcctggttgc accgagcact agtgcaaaat atgtgtgcat agaccctgaa     16320
     tctagatgtc tactgatgct gagatgattc ttgtacttta taaaaatgta tatagtctta     16380
     gacattgtgt aaataaacaa ccatttaggc agtaatcccg gtttgttttt cattgattgg     16440
     ggttaatatt agatagaatt tgacaggtct atgcccttat ggacaattat aatagaaatg     16500
     tgctccttgt aaacgaagag gacaaaatag tcggtatagg aaaggcactt aaaactcact     16560
     tcggaagaca tctaatgctt caccgtgcat ttagtgtgtt tttattcaat tcgagaaatg     16620
     agcttttggt ccaaagaagg gctgatgaaa agcttctctt cccaggtaga tggacaaaca     16680
     gtgtatgctc tcatcctttt gtcaacgatc tttccttcac tgatcctatt cttgatgtca     16740
     aggtccatgc aatcaaacga atagagcatg agctgggaat aagaggtata tctatagaca     16800
     acctaaaatt tgtttctcgt gttgtttata aagcagcacc aaccgaaaag tacggaaagg     16860
     ttttacttgg gaatccaacc acacagaaaa ttgtaagatt ttcagatccc gaaagtattc     16920
     atgatgagcc ttactcttcc agcgattttt atgaatggga agtcgattat gtcattcttt     16980
     gcgtatctga tgcatccccc tgcccaaatc ccaaagaggt ttccgaaacg aaatacgtct     17040
     ccaaggaaga gtttcaaaag atgattgctg aagacttcgt gtctccctgg ctagatgaaa     17100
     tatcgaagct aattgatgtg tttgatattg taaaattatg ttttccaact gatttctaag     17160
     ataattatgg ataaaactct gtcccagaaa tggtccagcg gcctttaaaa aatgtcaaac     17220
     ttcacaagaa gcctacaaag tacaagagag tacttaaaaa aataacaagt gagagtgata     17280
     taataacaag agaaatcaac aaaggaatag tagaaaaata tatgtctttg tataaaaaga     17340
     aaggaaagaa aaattccgat gttagataat ttcttctcca aaaagataga aaggaacaaa     17400
     gaacaaataa aaggatttct ttatttcaat gtaagtaatg cttcttaatg ttctataaat     17460
     tatcttgatt gctttcctct ctcgcctttc gtcttctttc ggctccttca tatgattcgt     17520
     ggattctctt gagtgtattt tttaatggct tgggaaggaa cctatgccta gatattctgc     17580
     ttatttcatg aacttccttg tatttctcct ttagaacctc ggagtatcta aaggcgtctt     17640
     tttcttttct actcaatgga cctaactttt tcgaagcatg gctcttccac agtcttatcg     17700
     atccttcatc actccctgac acaataaatt gagagtcgtg ggaatactct acaccaaata     17760
     cattatgcat tcgtctgtta tagtaggtgt ctctactttt tctttcgtta attccaaaaa     17820
     tccttattgt cttgtcaaaa cttccagatg ctatctcggt cccaagtgga ttgaatgaca     17880
     ctgaaacaac cgcatttcca tggcccctgt atattccctt tggttcatcc agatacctta     17940
     tgtcatgtaa atagatgcag aaatcttcat ccgccgatgc aaatatatgc ccatccatcg     18000
     gactaaacga tatatcatta gtcttatttc ccaccgatac agagtaggct atctttccaa     18060
     ccctagaatc aaacagagaa agacctccct gctccccaac ccctattata ttctttatca     18120
     ctgggcttgt acttatgcat aaaggatact ttgtgcttat tttctgcttc gagaactctc     18180
     tttcaatatc aaatatttct attcctccag aagttcccac attaagtgtc tccataatgt     18240
     ctaggcctag cacttctgaa ttgcaggaat atgcttgtga actccctagt tttttaacct     18300
     gctttccctg ccccgcatat acatttccct ccgtgtccat tccaagacct ttgatggagc     18360
     aatggcattc aaatctttca ataagactcc tctcctccat gtcccacaat accacctggt     18420
     tatcaaagct tccagatgca aacaaggacc gacgaggatg ccttgtaaga acatgtatcc     18480
     cctctttatg ataagatagc gctgcaacaa atggcttact tagcatcctt tcaatcttag     18540
     ttgcattgag cgcccttaca aactcccttt ccctcatgaa tggatgataa gtctcgtcct     18600
     tggaaaagct cacatactga acgtcttttt ttctttcctt acagatttct tccggtttgt     18660
     ggtatatggt attgattttc atgacagggc tggggcttca gagaaattca tattggcatt     18720
     tatcccatag atgacatgca aattgttcgt aagtaatttt cccgaaagct attcggaaga     18780
     gagcataggc ttaattttta gtccttttgg agagatcaaa tccattaaga ttcttcgcga     18840
     gcctagactg ttttcaattg ttgagttcca ggaacttcag gatgccaagg ccgcgatcga     18900
     ttctttaaat ggaagaaagc ttcattcaca aggtttgtta ttgcatgtgg agatggcttt     18960
     tgaaagaaga aagagggtgg tggtatctgg aattccccca gattcatcta aagaagaact     19020
     tcagagattt tttgaatatt atggatctgt ggaaaatatc acacattcag atgccatgcg     19080
     aacagtcttt attgactttt catcgcatga ggatgccgaa agctttcttg agcttaacca     19140
     aaagataagt tttggaaagg aaagagacaa actcagcatc aaacccttta ctaagaaaga     19200
     gtgcaaagat aatacttcca gtccagaaag aagtcttttt atatacaatc tccctgcaaa     19260
     aataactaaa acggacctcg acggtctgtt tgcgaggttt ggagaagtga aatctctagg     19320
     agtgttaagc ggaggaaaag catttgtcaa ctatgaaaga gagctgtctg ccttaaaagc     19380
     tattcgtcac atggatggca agaatgtagg gggaaaaaag atcaggataa tccttaagtc     19440
     catgaagaaa ggccttttta gaggacctat ctagaatgga acagatgtta catgctttca     19500
     aagatgtgtt ggtaatctct ggaggctttt catgcttaaa ttttctgttt aattactctt     19560
     tcatatgcca gccggggtat ttacattagg atcacaggaa tccattccat tatcactctc     19620
     gccgatcatc tccccaggat aagcactctt gaacccggaa tccaggcctt ttttgggaaa     19680
     aggagcttca tactctccaa atcggggcgg tgtgtgatgc ttttcgttta agtagtaata     19740
     tccataggat tggggataga caatggatgc agaggagtaa cttctaaacc cgttgtctat     19800
     ttctcccttc tctacgtagt gatatggaac attatactga tcgggaatct ccctagtata     19860
     gaatctagaa tatctattgg aaagtatttt ctcattaaac tcgctttggc aatctctttc     19920
     ttcgttactt ctagggtgtc ctctcctact tttagcatac gataagcacc catcacagag     19980
     atagccaggc gtgttcttgg actccgaagt aaaaaaggag atattacagg atacacatac     20040
     aatcctttca tgaccaccct ttaaggcttt tgttcttcct ccagcagtaa tggtgtatgg     20100
     tcttgtcctg ccgtgaagct tctgataaag cccgcatgca ttgcataaga gcgatttccc     20160
     ttggtctcct cttctccacg atggagtgct tgtagttgca cagttggagc atattctttg     20220
     ctttgctttt cttttaagtt cttttgcaat cttgggcatc tccatcgatc catactctga     20280
     aatcaattcc tggtacttcc cttttctatc attgaatcta tctagatttt gagatatttg     20340
     tgcgtttgtg gtgtaattat ttgtttcatt aagactctgt aaagaagaat tacaagggtc     20400
     ttcccctcca tgccttaatt cttctacatc aaaagccttc ttatcatatc cttttatatc     20460
     ttccatttct acattcatgt cgtctttgtg aaaagacttc ttctgctctt catctcggaa     20520
     gtctttagtc catgtatctt ctatctgttt ttggccccca ctttctttgt tcacacatcc     20580
     cattgttttg ttttcaaagt gctattttat agtgaaattt ttataagtag ccttatattg     20640
     caaaattaat atatttccga tttaatcttt gatatatttg acaattacac aagatctaat     20700
     cttgtactca caattcatgt gcagaaatat ttatagtctt tctaatgaat atatctgaat     20760
     cttatattat gtaatatctt tggaagaatg ttattacaaa cataaacaaa acagaataaa     20820
     acatacctgg aaaacaaaac aattgaaata tgggaaataa aaaggataaa gagatggtcc     20880
     gatgcgagct ggagaactat gtcgcagtgg agattaaaaa cacctctccg aatgccagac     20940
     aggttgatgc catccaaaag atgatttcgc taccagaaag gaattttgac gaactagtct     21000
     cagacattgt caatgaaatg cgaagaagga gtaatgcact gtcaacaact cctgagaccc     21060
     ccatgcagag aaagctctct agaatccatg aagatggatt caaaagtctc atcttagacc     21120
     tccttctagt aatgaaccaa agatccccgg aaaaaggatg ttcctcggaa aatgtccatg     21180
     ggcttattga taatcttgat aagcttatat ccgaacttaa agaagatatg atgaacgagg     21240
     acaaaatggt tcaggacata tattcctctc gaaacatttc agagaagctc attatgttca     21300
     ttgagtacac ccggaatgtt tttgggcgta atgaagaaga tgtcaagatt catgaataca     21360
     tgacaaaaga agtcagagag tattttgatt cccaagctac cgatgggcct gacttaatgg     21420
     ctggtgtaga tgtatttcta aagaaatgtg acaagtcaaa gtacagcaat catcctgaat     21480
     ataaatacca tagagataat atccagaagc tggaaagtat ggagttagag caggaggtaa     21540
     aaaggaacct tataaaaagc gaagtgtcac aaatatattc aatctttgtg gcagaaaaca     21600
     ccagtctgaa gagtgcagga gaaaaacagc ttgaattgaa ggttcatggt cttgtagata     21660
     tcctgtctaa gataaagtac gaggccgaag aaagaaggtc tgtagatgct tatgactacc     21720
     ttgaagaagt gatcaactct agtaaagaca ttcttgaact cattgaaagc atgaagttga     21780
     aaagaaatac acatctagat ctgctgagag ccaaaatagc tgctctggaa caaatacaca     21840
     atagaaacgg taacgaggag cctctttttg ccatgttttc aacaattgag gcggtaaaga     21900
     aagccttgat ggatatctcc aacaatcaaa atcaaggaaa tgcttagaca agatataaat     21960
     ctggcaggga aaacggtaag atatttaatg gaataaaatg ttgacttaca attttatttg     22020
     aagcctcaaa tctttatgtc taattttgaa ctgagtcgtg ccttacccag ttcataaaag     22080
     tcaaatatct taaagttctt tatcggaaga ttcttaaccg atatctccag atatgtatca     22140
     tttgcagatc tatttttaga gttgtataac actttgattt tgaaggggct taccttactt     22200
     acctccaaat tggacatact tgtgaaaaac tctatctgaa acttcctttc ttctcctctt     22260
     accacatatc ctggtctatt gaactctttg tttgtgtttt tttcaaatgc tccggatttc     22320
     tcaatgttta aaatcatatt attaaaccga aaagtgtctg tcttgctgtt aacctcactc     22380
     atcaaaatac taccattaca gaatatctct gccaggaaaa aataaatgta tatcatgtct     22440
     taagttaagg cacattcatt ttatagtttg gagtgtttca tttccttcga aacattagga     22500
     aacaacccgc ccaatacaaa tcaaaacaca tcttgtctgg atagatgtaa caaagtttgt     22560
     gcttatggat tcggttttaa cagcccatgc agcaaccgtg gacagaaaag taccgcccag     22620
     aatccttaca acaggtggtt ggaaataggg agattgttgc agctcttaag tcaatctcaa     22680
     gcacaaacaa aattcccaac atgctgttct atggacctcc agggactggg aagacaacat     22740
     caataagagc cattgcaaat aatcttccaa gatcatgtgt tcttgaattg aatgcaagcg     22800
     acgaaagagg aatagccacg gtgagagaaa ccataaagga gtttgcatca acttattcca     22860
     aaacgacaaa gttggtgatt ttagatgagg cagacatgat gagtagagat gcccagaatg     22920
     cccttcgaag aataatagaa gacttcagtg caaatgcaag gttctgctta atagctaatc     22980
     attcaagaaa gataatacct cccatccttt ctaggtgtac caagtttaga tttgggccta     23040
     ttgaggacac agaaagcaga atcaaagaaa tatgcaagaa agaaaacata aaatactctg     23100
     aggaaggtat taagggaatc gcagagatat cagaggggga tatgcgtaag gcagtcaacg     23160
     atgttcaagg aatatctgtg tccttgggcc ctatcagtct ggaaaatgtt cgaaaattca     23220
     atggagttgc tcctatagac gtctacgaag agttgtttga gaacctcaag accatgagta     23280
     tggctgatct tagagtgaaa tgcgaagaat tgaaatatga gcacggaatg gattccgacg     23340
     atttactaaa aaatttgagt aagatggtcc gaaaaagtaa catgaaagag aagatgagga     23400
     tacttaaaga gatgggagat atagaatacc gaagaagcat cggatgtagc gagaaagtcc     23460
     agacagatgc aatcatttct gtattcttat tgaatagagg ctgaccccta tgaagtagta     23520
     aatttattaa aacgcccgtc ttgagtttac caaagtctta cagaatgtcg tagtatggaa     23580
     gcgcctcagc ctctcttaca tcgtatttgc tttttgggat gttattcaca atatttgaag     23640
     ctatcaatgc caggactatc ataattatgg atccgaatat ccataaaggt aggtatatta     23700
     agatactacg gaatcctgcc aatacaagag ataatgtagc tatatacagc agaggtaaga     23760
     gtagcataca tgcattgatc ttcaaagaat atttcttccc gcatattccc cagaggattt     23820
     gcataagaag tagaaatggc tttaaaaaga caggaattgc aggaaccatt actaggccaa     23880
     acaatatagc cctaatcaac tttcccatca ttatgttctt ctttgtttca aaaaagagct     23940
     tgtacttatt gctatggtaa tatatggtat tgactgtgga caagccctcg attcctagga     24000
     acaaagcccc tgaaaaagaa gtgtttatga gtccatcgac atatgaggca tagttgaaca     24060
     aatggagtgt tgctccaatg atttccatag atcgaaatat catgcttttc aactcagctc     24120
     ccatcccgta tatccagtac aatgcagaaa gggatcggat cattggaatg gttagagtta     24180
     tagccgacac cccaaaagga agagacatgg ctatgctgtt atactctcca tgtgcaatca     24240
     tgggaggcag tgctaataat gttcctaggt atattgcaaa tgtgaccaga tagaagcata     24300
     tgttaagtct atcaaacatt cttgttacaa tatatgagtc tttgttgtgg agaagaagct     24360
     gcaccgacac ctcgccaaat atgtcataaa aatctctttt atatctgtct ttcaatattg     24420
     tgtatgcctt gttgatctct gcaaacttgt ctgggcttat ctcgctctta ttctgaaaat     24480
     atgttcttac aagaaatctg taggactttt ccacactctc ttttgtagca ttctttggga     24540
     ccttgagcac atcgtagaga ctcatttgag gggatagaag gaagaattaa agaaagaccc     24600
     ttcccaactc ttctagttgc aaaaaattta ctcctcgatg ccaagaagtg atacgaagaa     24660
     aagcaaaagg agaaagaata ggaatagatt gaaaacaaaa agagctcagg aatttggccc     24720
     aaagggaatc gaccaggtaa aagaacagat tgagggtcag aaggaaatag attacgatcc     24780
     agaacttcca ggacacggcc ggttctactg ttacgaatgt gatagacact ttatttcgga     24840
     gaaggtcctt attgagcata ggaggtcggg gacacacaaa aaaagagtta gggatatgag     24900
     agaaatccct cattcccaga aagacgcgga gtgggctgtt ggattaatat gatccttata     24960
     caaatcttac tttaaaacct ggttgtatcc acggtatcat tttaattcgt ctaggccttc     25020
     aatctcaagc caaccaatgt ctccatctcc ctccagaatt gagagattga tgctattttc     25080
     cttatcacct tcttcatcta catcatttga agcttttctc cttgttctct tgaatggaaa     25140
     gataattctt gcaatgttat atgaattaga acgtagaaat aaaaccatat cttcaaaaaa     25200
     ggtagtaaaa aaggcactgt tccagcatcg gtgtctttca aatacatcgc gccacgtctt     25260
     catcaagact aggaatgaag gcttataaaa gtacctcttg tcgacaaaag aatatatgtt     25320
     agaaagaagc ctcaatatct ttgcggtgtt gcagtcttgg aaacattttc ccatccattc     25380
     atcttctctt aatcccccta ccgaacagtc tgactggcta taggcgcatt cctgaaaaca     25440
     tgagcaatct acataactat actcgagtag actaaatatt tttcttattt tgttctcatt     25500
     gaactgcttc ttgtctaggt tccaatcaaa gagataatag taattatata gtactaatcc     25560
     acattccata actatattgg tgtccttaca ttccaatagt tttgctacat gaatcattag     25620
     atccgagtct tctatcttat ctaaataaag tatcgccttc gaggattttc caagactctc     25680
     cagcattttc ctatacagcc tgatggctaa gtaactccca ctattcacta gttccttaag     25740
     tccagatgac ccgcacaaga agagataatc ccattcgcaa tagttcatga gatgtaaatt     25800
     cttatccaat cccaaatcca ataggtcaaa gaacgtagta ttgtaaatat catcaaatat     25860
     gttcttaaga actggctgcc ctactttgtg aagggaagaa ggcttcctaa aggtaaaatg     25920
     cattttatcc ttgaagacca cttcagaatc aaaatgcctt ctttttattt cgtgcataat     25980
     gccttcacct ctgtcctctt catacttccc tcttgcttcg tataccttgt attcaaatat     26040
     caaggaatac aatcttgcgg tctccgaaga gacaagagag ttcagaagaa taaagaatcc     26100
     gcagtcatat agcacacctg gaaacagaga actcttcttg atggcctcgc aacagaagga     26160
     aataacatac tggggactct ccatagactc atacagaatc tccgacaaca aaaatccacc     26220
     ctttcttgtc ataaacagca ctggaagcct ggagttaggg agctgcaaga tctttattgc     26280
     tagtccaaat gctttctgtc tatctttgga atttcttata agataaggaa aattcctttc     26340
     aatgaatttc cagtcatcta gaagactcaa gagagatgga tcctcatcag taagtgatat     26400
     tatcttctcg agggattctt catgctctcc cgacaaacct ccttcgttca ccaaggactc     26460
     attaagaata aagagcactc cccttgcttc gtcttcttgc atcaaccctt ataattcata     26520
     aaaccaatat gagacttgga tttctttaaa tcttaaaaaa gattttggca gaaagaccaa     26580
     taaagtattt tattagagca tgaacatgta gaagcatgtt ttttccacca agtaacacaa     26640
     cactatatcc atcactaaca cactataaac aaataccttt acattgccca tgtcaacaat     26700
     ttccatcttt gctcgaagtt cgtcgttatt ccccatcacg agttgatgta taaaaaggag     26760
     caagatagta agacatccaa gtagcttttt gttttccacc aagctttctc taaaaggcct     26820
     tcctatgtag tttacaagaa acgtcgatat ctgctgtgtt gtcgatagga agaatagagc     26880
     agagttcatt aatgaaggag aaaacttttc gttgtacaca ggcgtctcta catcccttat     26940
     tcttcttatc atgataaaga aggaagctat atgaacgata acctggagaa caacagagga     27000
     gatgatgtac gagttgatta tgtttgtcaa gggccttttt ttgcttattt ccttaagagg     27060
     ctggctttgg gtcaggaaca taaatgcaaa tccaatgagg agtccagaaa cagtcaactg     27120
     cacatctcca tatctaacac ccatgcaatc caaaacactc aaagagaatg cactgacaag     27180
     ggaattcaat gccagaatct tgtacatttg aatggttgtt accaaggcac ttcttccttg     27240
     tcttatgata tcaagaacag aatcaagcga ccctgtcttt gctgtaaatg gcgctgcaac     27300
     acttgcatct ccaagattga tcttctcttc tcctatatct tttgaaagac tttccataat     27360
     gttctcctcc ttggtttttt cctttttctc cttgcgaaca atcaccggtg cttccataag     27420
     agctattccc acatgggcac tctttagtgc tccaacatca tttgtcccat ccccacacat     27480
     cagtgtgtac tttcccatct tgttgtattt ctcaatgatc ttctctttgt gaataggatc     27540
     ggccctagca aaaatcgata tggatggaaa ttcatcactt tctaatacct tatctatttc     27600
     tgctccttct acagcttttg tagatatccc gatctttttg gaaacattcc ttgcagttag     27660
     cacattatct ccagttatca ttatcacttt atgccctgat atatgaagag cctcaattgt     27720
     ttctcttaca tccttcttca atttgcagtc aaacaagaca aatcctgcga aagataaacc     27780
     tgattccatg tcttttcgga catatttgtc ttgcttactg gtaggcttga acccaagtgc     27840
     aagcacacga tacccatcgg ctgcatattc cttatagtca tcatagaagt cgggtacaga     27900
     acttagatac tccttgacaa cttcgggagc tcccttcatc ccaacaaatc tctttccttc     27960
     tttctccacc accactgtca ttctctttag ttccgagcaa aaggagtatg tcttaagaac     28020
     ttggtactca aagcatttgc tccctagtga cttcttgttt tttaagtatt cataagtact     28080
     tgtttctaga gggtcacccg ttactttccc ttcaagtaat aacaaagaat gacagctgga     28140
     aagtacatca gttgagtttt ctgtctcatg cttaatcccc gcaacttcca taactgtttc     28200
     tgttaatgtt ccagtcttgt cgaagcagca cacatttacc tttccggcat acggaattcg     28260
     aaagggctcc aaacaataaa ctcccttttg aataagagcc cggacacaac tgttgactgc     28320
     catgcttaac tccattggaa gttctgtggg aactacattt gttaaaatca aaattacttc     28380
     caaaagtagt ttgtagttgg atttccccat cttctttccc tctttatatg catagaatga     28440
     cgcaataatt gcaaacacga ggagggcaaa tataaaaata aatgcttctc tgtcgttcac     28500
     agtcacctct tctgtacaca tcattttcct tacaagccca cctttttcag tttcaaaccc     28560
     cgtatgaagt acaaaacaca ctaaaggaga gtcttttatc atcactatct ccgttcctgc     28620
     atacaggata tgttttttat ctttactcct gtcaaatgta tcttttggat ttctttcgga     28680
     aatatcttcc tttgcaagag gaacagattc tccagaaagc attgcctcgt tcactgcaca     28740
     agacccctta accagcagaa gatcgcaggg gacactcata gtagatttga ttctgataac     28800
     gtccccagga aataaatcct cagatgatac agttttatct tcgctctttc tgcatgatct     28860
     actatcatat aagacctcga cattaacctt ggcatgactc atctttttga agtgtctggc     28920
     cgtaaccatt ctttgaaaaa caagtccaga ctcaagaaca actaacatca caagactgaa     28980
     tatcgcttgg tagacgtact cgtcaagaca ccaaagaagc cctgaaaaca cttggaatac     29040
     aaacagcgga gacacagcat gctgtaaaaa caactggaaa aaagatggag gtacaatatc     29100
     aaacctattc tttttgaaat gtttcagaag cccagattca acaaattctt cctttctctc     29160
     ttgccatttc tcataatatt caaaaggcct ttttgtatca gctcggagtc taacaatctt     29220
     ttcaccagtt aagagatatc cagacttttc aaattcaaaa gctccgtcac tgagtttaca     29280
     cagggaacct aggtactgta tataatctcc ctcggtgtta agatccattg aaaataagat     29340
     atgaactcgg tcagaccaga atgtcgatag aaacatcgtt ccagagagta gcaatgtaaa     29400
     cacaatcacc acctggggat agttgctttt caatgctaga acagggagga agtacagagg     29460
     agctacgtac gctcgcttgt agaatggctt ttctttgtat atattgtaca tttcaagggc     29520
     ttattttcga aaatatacta aagactcaaa atctatttga aacatccccc tggtatgtct     29580
     gctgatatag aaacattcta tggtggatca attctggcca ttgcaagtga cgaggctgtc     29640
     gctataatga acgacaaacg tcttggaatg agctctataa cagtttccaa ggactttact     29700
     cggatccaca aaataggccc aaggttatat gtgggacttc ccgtatttgt cccagacaca     29760
     caggttcttc tcagaagcat aagaaagaat tacaacttat tcaaattgga ggagcaaaga     29820
     gagatggagc ctgaagagct tacaagtatg atttcatttc ttttgtattc aaaaagagaa     29880
     gcaccataca tcacctctcc aatagttgca gggctgagaa gcgatggtaa gccgtacatc     29940
     tcggggatgg atagtatcgg atctataaca tctcctcgag actttgtagc agccggaact     30000
     tctgaagaga atcttatggg aatttgtgag gctctctaca ggccgggtat ggacgaggaa     30060
     aacctgtttg taacatgtac tcaggcattc ctcaattcaa ttgacagaga cgctctgtcg     30120
     ggatggggtg cagattgtta tatcataagc aggaacaagg ttactaagag accgattaaa     30180
     ggaagatgtg attagtttgg aattgaagct ctgtttttat aatcgttgta aatattggat     30240
     tttcgggggc cctttttaac taagatgcct aggcttggga ggattctaat gtatgcactt     30300
     attttcatct ttagatctta tgacgtccca tcgctctgtt acaactacta tgacccagaa     30360
     tcatgctacc agcaggagtt tctaaagcct tctcccatcc caacggtata tcaagtagta     30420
     ccaaggaagt attttgttta cgtttcagga gtatgtgact ttatagtctc aaggctgata     30480
     aattcggaaa agtacttcat atactcttcc cttcttccag cagatgcaat atcaatggaa     30540
     aaccttcttc ttgtgatgtt ggagaagggc tatagagata ttgcaggctt cttcctggcg     30600
     aatctaagta tattctatgt ccctattctt accgcctcga acctgtatgt cttgtcttat     30660
     ctctatccgg catacaaaaa ggattacgaa aatgcacaca agccttcatt aagtatcacc     30720
     tggtttttcc atctgaacat tttttcacag tacagtaggt atttctatga tatgttctat     30780
     gtcctgatga tttatctctt cagcattgtt cctgaagaac agaagatgga gattatttta     30840
     ctattcaagc catctaacta caagagttat ctcttgtaca tggcagaatc cccattgttc     30900
     cacttttaca cactcatttt cgttctggaa aattatgtac aactcctgtt caggatctat     30960
     ggcataggga accccaactt cctcaattgg tcgtaccttg cattcacatg tttatttatc     31020
     tttgaaagga gatggataat gttaatgaaa gagccttaca aaaataagga ccaggaaaag     31080
     gcttctggtt gttcccacca gctctagaat aaaagtagag tagctgtctt taataatact     31140
     ttattcctag ctggactcct catcgacacc gctgtcctca tccaggtcat cagtatcgtc     31200
     atcatcttca gacatgtcat cgtcaacact ggagtatcca gaatcttcat cggaactatc     31260
     atcagaacca atcccggaat cgctggagcc gtcggtgtcc tcatcggtgt aatccgagac     31320
     atctgtggtt gaagtggttt cttcctcgct ttcaagctcc ttcttagatt tttcggctgc     31380
     cttcttttgt cttgctggac acatatttta ggggatctgt ctttttctaa agtaaatttt     31440
     tcaaactttc cagaaaattc atacctacaa cacaaaatca tgcctgaatt tacactccaa     31500
     aaacacttta ttcaaaaatt tcttagtgcc tttcatttac atcctcctct cgagttcttt     31560
     ctctgtcctc aatctcttca atcatcttct gatactctat cgccatcttc ttgtctttaa     31620
     cttctatggc tctatctctc ttctggatta attctatctt aaggtgtgta acacctcttc     31680
     tctttggata cacttcgtct ttgcaggtaa ccatcttgct tatttcctca tcactcaacg     31740
     ccctattcat tgtcttcaca agtttttcgt atccctcttt aaccttagac atcggcccaa     31800
     tcttgaagga tctccacaca tcttcgtact cctctctgag tagaggagaa ttgcttatgt     31860
     tctctattct aaagttcttg tatgttctgg tccctgtaga tatctccaag tatctgtttg     31920
     ttttaacttc ttttctgtca atccggaggc tgtaaacttc tcctttactt accccaacta     31980
     tcttgacaac aagatacagt ccattaattc ttgctcttgt gaaatgtcca acaaactcgt     32040
     cgaaaaatgg cttgaacaca ttccttgcaa tcatatccct attcactatg cataaggaaa     32100
     attctgaaaa gtcatctata tcagaagtac tcttcttatc tgcagaaggc accttccttt     32160
     tcaacccttg tgttttctct tccaactcct tcttttcttt gaatttctgc agctccacat     32220
     gcctcctgta aagtatctct tctctttttg tttcaggcat ctcaagaagt gctttcctat     32280
     cttcttcgga ctcataaagc tcttccctat cgaaattcac atgtccagat gacttgtatc     32340
     catctctcat tggggtatcc tgcttgagta cgtaattctt cagcaaatat tggctcaagt     32400
     ataccttcct accctcgaaa atggtacttc tagcaaaaaa gaagacctat atctgtctac     32460
     atgtgctaaa tactattata ctcacagcca tttcggcaat ccatgagaaa aggtcctctc     32520
     ttaggaactt acaagacaaa atagaagtaa gaaagtcaat aatcgaccag aaggtgtata     32580
     caaaactttt tactaaaatt gcagaaggaa actacatagt cgtccaaaga gatagcaagc     32640
     ttttaaaata tcttgggaac actaatcctc tttcagatct ctatttaatc gggaaatatg     32700
     ggattccaaa acatatttct ttggaggaca ttccttatct tgaaactgaa gctcgatact     32760
     tctttataga aatcaaagat attccaatcc acaggatatt tgtgaagcag aaccttcatt     32820
     cttttatgta tataaagggt tttaatcttg gtccagacaa agatgaaatc gaccaaatgg     32880
     tgaagatttc ccaggaatgc ttgagggctt ttgatcgaat agggaatata gaaatggctg     32940
     ccaaagacat gatagtcaaa attcgtaagg taaacccttt cgaacttttc atcaaccatt     33000
     cagaaggttt caccataatg aaatcaatat tcaaccacag gaacgagttt ctggaagact     33060
     tgaaagttca ctttgtaaaa ttcatgagct cgatcttttt tggaatgaaa acatcctcct     33120
     tctgcgatgc ctatgtaaag agcattatca gctatttgga aagggaaaat atccttgcta     33180
     tagctccgtc aatcaaggaa tatccagaat taatccaccg cttatttcca tacaaaatca     33240
     tctcaacctc acctaatatt cttcacgagg aattgattgt gggaggaatc tccttggatg     33300
     gcattttgca agataagtat ctaagggagc tttttaatct tgggaagatc aaggaaataa     33360
     caagaggagg aagcaggttt atatttacag gccatatatc cattgacaac caaaaaggaa     33420
     aatacaacgt tagtttcgta tagggtcttg tttataaatc aattaaacta tcccattctc     33480
     gttgtgtttc ctcggtttat ttccttctca tctctttctt catctctctt caaaagctct     33540
     tctctcgaga gattgttgct tgaggagtct tcgggctctt cctctcgact agaagtggaa     33600
     ggtccttttt ccatccccag cattatcttt tctgcaaact catcaagtgt catcgtagga     33660
     ctgtttcttc tagctaaaaa gtctgaaatt cttccttgag aatcaacttt tatacattcg     33720
     attcccttct ttttgtaaga ttccttatcc ttcttttctt gaaggagcat gatttctctg     33780
     ttgagatgct caatattctt cattgacata atgtagaagt attccaacag tctcatgatc     33840
     cactctctat cttcccagtc tatgaagtca tatctaaact ctcggatctt tcgccacagc     33900
     tttattttat tgtctctccc gcttgtccta cacagctcta tagtttcttc ctcaacaagc     33960
     ttcagatatt cacagtcctc gcaatactcc ttaaaaagtt tcagtccctc atatttattc     34020
     cccaccttat catttacaac tcccctaata taaggagagg tgcagttcaa cagatctgat     34080
     gtagatagct catggaggtc ttctccatcc ccttctgtat attgcatttc cccaaccgct     34140
     tctatgtctc tgttttcaag taccctaaca ataagttcct ttatgttcat aatccaggga     34200
     ctaagatatc cacaaatctt gaaggtacat ccccaaaact ggatgtctca cgctaccata     34260
     tagatattaa gtttatttct cattaagtgt ggattcaatc tccttaacta tatcaggaat     34320
     catagagaaa agcctctcgt tcgccctcaa aaaatctcga acattcaaaa gaaatttgta     34380
     gttactttcc ccaacatctc cagaaaaccc aaattcctcg tggaaggaag cactaaaaag     34440
     ggacaagcct tgggaaaaca attccgaaag attcttattc aaaaccactt cgtacacttc     34500
     ctttatctct ttggcgcagt tcaacagcct gattgcacta acataatacc tcaatgttgg     34560
     gccgttgatg tttagtttct cttcgttgga cacttgtcta tggaaacaca atatcttcgg     34620
     aacgaagggt gcttccaact ctcccacttc aattgacatc aataaaagaa ttccaacaga     34680
     tgggtcaata tcctttgtta aagtcatgtc gggatgtata acatgaccaa aggattcttc     34740
     tgaacctaat ccttttccgg attccttttc tttctggcct tcgtttctca ctcttgataa     34800
     tgaagattct accagcttta taaattgagg atccttatct acgttcttta tctttcccat     34860
     aatttgtagt atgtctctag aaatcctgtt catgaacaaa gactcataga acccaggcgc     34920
     aagctttgct cctacaagtt tctccagatt ccgtggaaca tgatcctctg agtagggttg     34980
     cacgcatccc aagatcttca tcaccggaag atatgtcact agcataagac ctcggagaaa     35040
     ctggtctgtg tatttcttcc cacttccttc atcacaagtg tttttgatca tcttcagaag     35100
     gtcatccgac tcctttatca aactaaagac tgcattgaag ctaaagtcgg tagcacactt     35160
     tggcatagtc gggcaaaagt cgcatccgag aagaagacca agcgctgcaa acatctttgg     35220
     gctgaggtta aaaaattcga ggaatcggct cttatggaat acatccagac atggctttcc     35280
     agatccatcc gacatgtcga gtataatctt gtcaacacca tcaaatagaa ggacatccga     35340
     ctttccaaac acatatgagc atgcctcggc actcataaaa tatgcacatt gggctgttgc     35400
     agaataaggt gcagtgataa ccactacccc attctcctca agtattttat tagctatatc     35460
     catctcgttc ttttgtgtga taaaatttct ccaaagcttt cctgcctttc tatagttctc     35520
     ttgtttgtac tccctcaggc cttcattcaa cagagcatca gagtttccag ataaagctcc     35580
     ttgctgccta ttaaacccca ttccatccca aacccatatt aagtccactt cgttttcgtc     35640
     tctgaactcc aaaagtctta acaaaggttc cttaatggca tcttcggttc caagcaccaa     35700
     gcccttgcaa atgctcggta catcgacgta ctttcggaga aaccaatttc cgtcaatgca     35760
     tattctcatt ttcttgaatg ccttttgcgg gacttttaga aaaaaattct gtccggggtg     35820
     ctttcttacc tcttctagac ctcttatcgg catctttggg gtttctacga ttcagaaaga     35880
     agaaatcagg aaatactcag cataaagcta caccaattaa taatatttaa tggacacaca     35940
     gaactggaag gtctaccaac ccaaagagag aagttttcca ataacaaaga acattatctc     36000
     tacaaagctc atatacatgc aaaacctaga caaaattatc tttctgatgt gctttctcat     36060
     ccaaagaagt ttgctaagaa gatatatatc cacggcattg tctatcgcca cctctcttcc     36120
     tgagatatat ctattcatgg aatgttttag atagatggtt tcttttggaa tatttaaggg     36180
     aagctttact gctactactg catctttcca agagctcaca cgtaatacag caacatcgca     36240
     cagattagat atttttcttg ctacgtggga atagaaaccg tcacccctaa catccacaat     36300
     aactacccaa tttcccttgc tgagccttcc aaagcttcca tgatctataa aaacacactt     36360
     atgtggtttt ccggagatgt ctacttcagc aatggacaga gagtctggat tagagctctg     36420
     gagcatgtag actaccgcag ctgctaggca ttcaaaaaag cctttcttgt tgggcttaaa     36480
     gattttcatt tctgcttggg agggagaaaa taacaacctg aagaatgaag aagtcttctg     36540
     tacactctct actatggttg tgtacatgat gttaaattaa gtgatattct atatggatat     36600
     cctggctagg tgttatgtga gtaagaaaac aaaccccaag atggtggaag gagccactgc     36660
     agatgtatcc aaacaactga ctatcatagg ttctgcaaca tgtgggaaga caagcatcct     36720
     caccagacat gtgaaaagaa cctttggaac ggagataagc cctacggtgt tcaactcggt     36780
     tagtaacaca tataagcaca agaataatgt ggttgagtta agactctggg acacagcagg     36840
     acaggatgaa tatgcccggt tccggcatct tgctttacct tcagcggatt acattatgat     36900
     agtgtatgcc attgacgatc gatcttctta tgctgaagtt aagaatagcc tcattgggca     36960
     ggtgaaagaa aaggcaccac aagcaaaata ctttcttgtt ggagcaaagg tcgatctaag     37020
     agaagatagt aagaggcttg aggagcttgc taggaatgga aattccccaa taactacctc     37080
     tgagggactg gagctttctc agagcatcgg agcattagga tactttgaat gttctgcaaa     37140
     gaacaacatt gggatcgacg agatatttga gaagatttca agctatgctt tgaaagtata     37200
     tctgagagaa aacaagtcct tcatgggaag gatacttact tctctgtgga attttctttg     37260
     ctgccggaaa ataaattgat ttttattgga agtttgtatc tccttgtgaa tgaagctaga     37320
     gaaagttgat gcaaactgga caagaacaga ggatgaagtt ctcaaggctg gggtgatgaa     37380
     atatgggata aacaagtggt ccaaggtgtc ttctatgctt ccttcaaaga ctccatccca     37440
     gtgcagatta agatggctgg aatatgtcag tcctttagtg aatgatttgg tatggagttc     37500
     ggaagaagat gaaaagctta ttttgatggc gaagacattt cttccacagt ggagtttgat     37560
     tggacagacg atggggagga gcgggcagca atgctatgaa agatataatg agcttgtttt     37620
     tggaaagatt agtgttttca agtatgggga gctttctgga ccttgcgaag gaaaagacga     37680
     ggagattctg aagatggcaa gtgccaggat gtctgagtgc aagagcagaa agggcttaaa     37740
     gaagaaagct cttttggaca agaaagagaa aacactttca agaagctgtg aggcaaagga     37800
     aggaaccata ggtcctcata aacaaagagt atgccgtaag aatgatggta cacttcaatg     37860
     attgggttga agtgtctgta acatcaatgt tttacttcag ttttttaaga gttctgtaca     37920
     catctttgat ggagtcgaaa aatcgagcgt ctgcctctgc atttggattt atcggtgttt     37980
     ttattgctgt tctcttgtgt ctatcgattg ttgttgatat gatgtcgttc aaaagattat     38040
     cgtttctaga agttgcagaa agcagacacg gaataaaaat gaaagagata atgaggaaca     38100
     aagaggcttc ggaatgacct gcataagaac aaagttatgt aagtgaaatt aaacatgctt     38160
     gaatgtatag tccttaaaat ggatattttg gatctgctga agaagaagat aattgaagat     38220
     gtctttgagg tttatcccga cgctgagtgg agtgttcttg tatatgatag ttatggagct     38280
     agcattctaa agaatttttt tgtgaagtct gagtttatca gccacaacat agtgacttct     38340
     cagagaatcg aggagcagag ggaaagagtg gattttcctg tgatatattt tgtaagagga     38400
     gaagaaagta ttgtaaagat gataaacagg gattttgaaa acaggttata tccatcgtat     38460
     gctgtctgtg cattggagga atgtgagggt cttcagccgc ccatcaaggt gaagaaggta     38520
     gatgtggact ttcttccttt tgagcagagg gttttcaagg ctacggcaaa gcaattgtat     38580
     tctgtagcca agactttgaa tacggtgttt aatgtaagtt actcagggtc tgtgtgtaga     38640
     ggtcttgcag agattgttga gaagacaatg gggagtgaag aaaggaaagg agagctgatt     38700
     atactggaca ggagtattga tcttttcacg ccgttccttc attttttcac cttccgaacc     38760
     ttacttgaag acctctctgt ggaaaacatg gaggagtttg aaaagaaata catgagggac     38820
     aaagtatggg aaagtgtcaa gaatgcacat cttggagaag taaactccat tttaagaaac     38880
     caagcacaaa tactatcgaa agtagcccaa agactggata caaaggttga taacaaggat     38940
     ctgatgaaga tggttctcga ggcgccagca gcagcaaaga ccaaggagag cttaagtaag     39000
     attcttggac tggcacaaaa atgctatgat caatttgatt atctttccag gttcaacgaa     39060
     atcgagcaac tacttgctac aggatacgac aagtcaggaa gtaaatggaa aatgaaagtt     39120
     gaggatgtgt ttgagtatct tcggagtagt gggatagaaa ggtctgacaa gattcgaatc     39180
     ctactactgc tcaaagcgaa tgggtatcaa ttgcaagaca acgaggtaaa tcttcttaaa     39240
     ggaatggggt ttgaagactc tgagattgaa atttcttttg aaaaccacga gagttttgta     39300
     cctctccgtg gttcaggaaa ccacaagtat gaagtcagtc gatacgaacc tgtgcttggt     39360
     aatgtcctga ggagttttat agggaaacag aaagggcatc tccaaataaa tagattgaca     39420
     agtagcaggt cgcatctgaa gtctttaagg aagactcatc tcttatcggt gaaaaaggat     39480
     atctcctacc aaaagctata ctgcgtctac ataaccggag ggataacatt tgaagagata     39540
     agagttgcct atgaaattag cgagagcctt ggagttgaga ttattgtggg ctctgaagac     39600
     ataataacac ctaagtccta tgtggagtat ctgaagtcga aatgcatgtc aaagagttaa     39660
     agttttatat attccgagga ctaggggtcc catatggacc agaacttaga atcccaaacc     39720
     ttttataact tgagtgcccg tggatggaat ggcgaagaag ttaacttttc ggtatttaga     39780
     ggatgtgttt taataattgt caatgttgcg tcctcctgta agcttgccga aggaaactac     39840
     aagagctttg taggccttct cgagaaattc tataaaaaga atctgagaat tcttttgttt     39900
     ccttgtaacc agtatctagg gcaggagccg aagcctattg aaaggataca cagggaggta     39960
     tctgagaagt attccgacaa gtttgaagtc atggataagg ttgaggtctt tggagaaaat     40020
     gctcatccag tattcaaaca cctcaccagt accaagaatg ggaaggggac atttgggaac     40080
     ttcattaagt ggaacttcac caaatttctg gttgaccgtt cggggcatgt tgtcaagagg     40140
     tttggaccaa gtaatattat taaagaagac gaagaatgcc ttttaaacat cattggagat     40200
     gagggagagg agcagagtcc tctgatggga taaataaaaa aattactgta cccattgatg     40260
     tatgagttct acagacaact aatggttgga aaagccttag aaaagataat agacgagaag     40320
     gtgaattcta acatgctcag tccgaatcaa ggaaagtata tccttgaagc atttgatttg     40380
     agtgtgcctg tggtattcaa taagtcggtg acaaactcca tgagttttaa gggaaaggtg     40440
     gacttctaca accacgttga tggggtgtgg aggttccaga caaaggactt tgtgatgtct     40500
     ctgaacaacg agtacttcag cggaggagat gttaatattg ttgcatgtga tgcagacatc     40560
     aatatggatg cgggaagaag aaggagaagg agaggatgag tgccgtgtag ctatttccaa     40620
     ataaatgtta aatttgacga taccttgtaa tgttaccatt tgaatggttt gtctggaaat     40680
     ttttgaagtt gcaataagtt gaatggaaaa gaaagccctg aaaatggatc agaacaataa     40740
     catgaacaag ttcttcaact cgtcgttctt tgcacagaca ccccagaagg ataataagcc     40800
     ggggcagttt tccgggatac agcagccttc tatttttggg caaacacagt ctgggtttag     40860
     cggagcccag aatccttttc tccagggatc cggagggatg aagagtaaca cgtttgggac     40920
     ttcaacgccg tttggaggta cctctacatt tggaggagcg acttctaact ctgggggatt     40980
     tggacagcct ttttcgaccc aacagccttc aacttcattg acaagatttg ggactggagg     41040
     aacacttgga acaggaaata atatatttgg aggaacagct aacacaatag gaacgaatcc     41100
     aacgcagttt gggggatcgg gaaatacttc tacctttggg actcagcagc aagtcaataa     41160
     taacaccttt gggtctggag ttccaaattc attgcagcct ttttcgatgg gggcctcaac     41220
     agcaacacaa cccagcatat ggggacaaca aacaacctct tacaatccct ttggtagtag     41280
     ccaaaactcc tctttttcta acgacagaag taacgccttg ggaaagggat ttcctgggct     41340
     tggtggaggg aattctggaa cccgagatca tccctacatg caaaggaaga ttagggaaga     41400
     taatggagga gaagttacct tgatgcacat caacggtaac gagggttaca cacaaaagtc     41460
     tgtcgatgaa cttagggcag aagattatat acttggaaga aagccaccta ctggaagcag     41520
     cttagcagaa cccaagagca ttccaggatt tggatcgtct tttggaggtc cggtgccttc     41580
     ctctatagac agtaagcctc agagtagcaa tatttttgga gctactcctt caaacaattc     41640
     attccagcca tttatttcaa caggaaactc aaaagtctta caagggccta ctaatccagg     41700
     ttttggaaat acggttgcac aacagccatt tgcatcccaa gcaatttctc aaagtacgcc     41760
     gagccagccc tttggaacag cagcacaagc tcttccctca acaaactcaa atccatttct     41820
     tcagacacca cagcaacctc agtcattgtt cggatctgcc ggaacatccc cgcaaacgcc     41880
     agcttcgggt ggtctctcat ttatgcagcc acccacggca cctgtgcagc agccctttgg     41940
     aggtggaatg gcctctcttg ggacctgtgg gcaacagaat acacagcaga caaaaataga     42000
     tccatctgat ccctttctct tgaaagatat caagtttgag aagaccgaga aagaacatct     42060
     tccattgagc aaggtgcttc caaagcctat gtttaaggag gacttaaagc cacagaagat     42120
     atctctgaaa ttccgccctc caaagcctcc tgcaaaagag aagatatata ctattcctcc     42180
     gatagaagat atcaagcaca tgaaggaagt tcacaatttg attataggat ttgaagacaa     42240
     gggaaggata gagtatcttg acacagtgaa cggatccgat gtcaccatgg cgaatatcca     42300
     gtccaagatt tacttctcca aggaatctgt tgtggtcaac gatcctgttg gagtgggcct     42360
     taataggaga gcccgtgtat atgtagaagg agtgtttcca tatagtagaa gcttaggaga     42420
     ctatgttaga ggtgagcaga aacagtttcc gctaaaagga atccaggaaa ggtttctgta     42480
     tggtttgaag aatgacacgg ttaagaaatt tgttggatat gagtatgaaa gggggacata     42540
     cgtctacgat gttaaccatt tctgagaaat ggaataactt ctgaattaaa gaactagtgg     42600
     atgttttttg gttatcggac tgaaatccgt attttgatat atccctacct taaatgcaag     42660
     taagctacat agaaaaggag actatcgatg aactccggat aagcacaagt attggagata     42720
     agatattttt catccgggga atggagttgg taagcaaaag catctatgca tatgactcgg     42780
     agaagataca caaaacattt gaagacaggg tggactatat ttgctacttt aacgagatga     42840
     tattggctct gtgtgggaat attctataca aacacagagt actgggagaa gaggtgattt     42900
     tgtgcggtac ttgccaactg cttgagccgc ccatcaagat atgtgtgagt ggaggtccgg     42960
     aggaaaagga gggctatgca gtgtgttttc tgtatagaaa caaaagaatt gaagttttta     43020
     gcgatgatat cgaaagggtt gttgtgcgct gcaaagggga tgtcgcaaag gaagatgaaa     43080
     taatagactt tgccattgaa gacggggtat catggtttct gtcgcagtca gggaggattt     43140
     atcgcacaca ctcctttgtg atatcaagag tggttcttct gaataggcct gttcgaatga     43200
     tcccagaacc ttcctacttc gatggcacca ttaataaaat cctggctaag aggggaaggc     43260
     tgtatgtgtg ttatgaagag ggttttgaag tgtacgacat tggaaaagat gttttggtgc     43320
     tgaactatac atataagact cgtgactttg aactttatgc ttgggagaat gtctattgct     43380
     tagagtcaaa tctattgatt gtcgatgaga tgccgcgggt gattgcaagt gttcgtgttc     43440
     acaagatgtt tggagacatt gggatttcaa gagacagaat cctttttatt aaaagggtgg     43500
     aggaatgcaa aagagctgat gtgaagctgc tgaaggaaga agatgcagat aaaagaacaa     43560
     aggagatgtt tagaatagta gaaaacgaca tcaagatccc cgagattgaa ctttcggaaa     43620
     atggaaggga agtttctgaa aaaggttttc tcattgtaca gaagatgatt aatgagtttg     43680
     agagcaagat cctagatgta tacagaagaa tttactttga gcttgtgacg cttaatgaga     43740
     gctttggaga gaagataaca gggctgaatg ccgagaatga tttaatactc aggaaggtag     43800
     aggttcttga cagaagaaag aatgatcttg tggagcgtct tcaaaagctc agcgagaaaa     43860
     tggaggatgt tgtatccagg atccaaatag atggaagcaa gacgaggcgt ttggccaaga     43920
     tggttgacaa ggcaattgat gaaatttctt acaagaaata tgaaaagtat tcgagaatcc     43980
     ttaagttaca aagggaggtg ttgaacagga agatggttta aaatacacaa gggcttacca     44040
     agggcgatga taagttgtgt tggggaccgc tccattgaaa tttctttgca gaaacagttt     44100
     tatgcaatca gagatgaagg agccaatcct aaataaaata tttttggctt ttaaaaccca     44160
     tcaaatatgc aaacaataag gattctgccg aatataaagt ctcttctcaa ggatggaaag     44220
     gtgtctgagg caattgatgt tataaatatg catgtggatg tggtagctcc gtacataaaa     44280
     gacgatcttc agtacatcaa atctgatgat ccgaagacaa gcctgtgcct gagcaagatc     44340
     tattttgttc ttggggatta ccaaaaagct atagagtatg cactcctctc tggagacctc     44400
     ctagttgatg acgggtcatt ctactatact tcgatagtct atcacatgat ggattcggca     44460
     gatatgagca aagacagcag agcccgagat tttgttcttc gagccataag ctcggagact     44520
     gtggatggct ctcttattgg atatttattt tctgtaaagg aatatgcact actcaaggaa     44580
     gcacttgtga aatacataga tggaggaaat gattataaaa ggcttcttga tcttcttata     44640
     tctcttgggg aggagaaagg atgtctaaag gagatatatg ggatgattac agagattggc     44700
     ccaagaggta aaccatttct tttttatgtt atagatgcct acttctatct tgaggaaata     44760
     gaaaaggtca aggagctgat tgaaagactt acgaaggaag acattcttct gtgttatgag     44820
     gttgcattct acactgagga caactatagc ccagagattg aggtgtccaa ccaaaaagtc     44880
     atgtcaatac tcagtggaga attcaagaaa aaaatccttg gggagtttct ccttgaaagg     44940
     aatctcacaa gcttcaagtt tcttgaatct atagcaagaa ccaggactca ctatctgggg     45000
     ctggccaatt ccttgatgaa cttgggaacc tctaatgata cgttctacag aagtaacgca     45060
     gatattttca gccagtcgaa tgagtgggca aagttttgtg aggtttccag cattggaatg     45120
     attcatctat tcaattcaaa tccatatgaa atccttaaaa actatttgcc tagcgaggtc     45180
     agccagaagg aaggaggagc cctgatggcc ctaggtctta taaaggcagg aacattcagt     45240
     gaagaagaca ccgagtatct tctctatttt ttggacacgc aggacactct tacgcccgag     45300
     ctagcgtatg gtgtatgctt aggcctcgga cttatcaata tgggatcgac caacagcgag     45360
     atcttaggga aactcaagga actttcaaaa gttgaccgga cgttgttagt ggaagcttct     45420
     gtgtatggaa tagggatgct tggactcaac tcatggaatg ttgagattct ggaggattta     45480
     agggcaatag ctggggaaac agagttcgaa cgtgtgaaga gagctgtcgg catttccttt     45540
     tcattggttt tgatgttcag tgaagagatg ttctatgatg aagatgcaga aacagacgga     45600
     gatttcaaga attacataaa tgagtttctt tccgaaaagg actctattat gagggcaagc     45660
     ggggttcttt ctcttgggtc ttcattcgtc gggacaggaa ggcttagtgt gatttcaaca     45720
     cttcttccat acatcaacga cggagatgac gatgtcaaga gagctgcagt gatagccata     45780
     ggacttgtat gttgcgacga cagggacctt cttgtaggaa ccttggagcc tctttcggaa     45840
     aaccacaact tctttgtaag agcagctgtg gctgtggttc ttggattatt cctttctgga     45900
     acaggagacg aagtttgcac caacattcta gaagcactca tgtatgactc caacaacctt     45960
     gtcaggcagt cggcttgcat tgggattggg tttattacca tgcagtgcaa tcctacgctc     46020
     attccgaatt ataagcgtat catcgaaaga ttgaacaagc tggtagttga caagaaggag     46080
     agcggagcag tggaattagg agcggtattt ggcagggggc taagcgaggc agggggaaga     46140
     aacataatct tttcaataag aaacatgtct ggaattacat cggccgacag gattgcaggt     46200
     gcaattctgt tcttacacta ctggtattgg tatcctctta taagtatggt atccttgtgt     46260
     gctcttccaa ctgcagtttt ctgcttcaac gaggatcttg aggaggagga aatcgaaatt     46320
     ccaacatcca accgatatga caaccttctt atacgcctcc cagatatcaa gaagacaaga     46380
     aggttcaagc agagacctaa ggaagacaag gaagtcgtta cagaatcccc ttcggtgcta     46440
     acctcgggaa gtaggtgcac cattaagcaa agggaagaat gcggtcttga ttctcctgca     46500
     atcctttttg tgaagaagaa ataaatcata gttttggaaa tagaaaatcc ctgtattgtt     46560
     tagaatcctc aagagtacat ttattttctt ctaagaagta tttgctatct tatccatctt     46620
     gtccttggag tccttcgtct agatctgtgg aaaaagaaac cacttcacct ggctcataag     46680
     gaggtaatcc cagagaaggg catccactgc atcggaatgc atcccctttg tagcaatttc     46740
     cgcaagcaga cctcacctca acttcctgtt tttcttttaa gccgcaagta cagtctttgc     46800
     atgccctctt ttttgcaggc gttctcaaag ttttcgtttc ggctttatct tcatcagtta     46860
     gatattcatc tgatatcttt actcttggat cggtgttttt tcttattgtg cttctcagca     46920
     gctttcttag ttcttccttg tcttccattt ggggccttgg gtccagctca attaaaatct     46980
     ctgctcttga tgtgctcctc tcctaatcta taccatgcct cgagaattag tgggtgctca     47040
     aaatccacct gctccctcaa agctgagaga tccttttcca tctttgacag cacctcttgg     47100
     tccacacttc caagctctcc ttcctcaaac cctctatcta tccataggtt gttcatttcg     47160
     tttattctct ctttcaactc ctcgttctct cttaccagtc tttcattttc ttcttttaat     47220
     tgccctacat ccacttcccc agtgttgcta aagaacaatc cttcaaaaaa cctttcgagg     47280
     tccgaatcaa cctctgggct tccgtatttc tttatataca aaaacagagc tagtccatgt     47340
     atctcattga tgctataagt cctggatggt atgttgattc cataagtttc aaggtaatga     47400
     gcttctagcg ctttctccat gtttttataa aacaatatcc tgcagcccga gacttcgaag     47460
     gggattccca cctcttccag aagatgggca atgtcttcca gggacaaagt gctcttcttc     47520
     agaattttct tcagaaattg gctaatttcc attgttttgc caggggaggt gtctaaggac     47580
     tattattgat ggatcaaacc gatgtcaagg ctcaccctta aaggcctaga tggaagggat     47640
     cttcaatagt aaggatcttt acgaatacct cgaggagcaa aagcattcgg gaatatcaaa     47700
     gaccagaagg atatccttgt actacaaggc aacatcgaaa agtgtgggag acgacgaata     47760
     ctcattgagg atatggctgg attacatcca attgcttatg gatggaacaa aagatacaac     47820
     agaggccagg gagacattta agatgataaa gatgagattt tgtaagttct acaactattg     47880
     ggaagcttac atccgatttg agatagagac aggaaacgaa aatctcggga agattttgca     47940
     gcacagcatc gattttgtta aagtgaaaga gtttcccgaa aagaaaaatg tgctggatta     48000
     tttggagtgt gtgatatctt atgtccgtaa tcagcaagac ttgtctgtat tctgcagaag     48060
     cccagagaaa agtcttgatg cagacggaag gttcaccagt ctttttgaga cccaaatggg     48120
     agaccgtgga ggcaagattt tgaagaagga tcagaaagag cccaggtatg agtatgaagg     48180
     agggagaggg ctctttccaa gaaacgatga tatttactct acgcctggag aatgtaaaga     48240
     aaacctgagc aatagaagca agactgacag tagtagccag acattgctct ccagcttgga     48300
     tacaaagact ggaaatcacg gtagttcatt ctttgggaca atacctgtta gatttgagaa     48360
     ggaggattac tcccagggaa taactgcaga gataaatgca gctttgggaa aagcaggttc     48420
     ggaggaaagc agctcatctc ctcgatcggg aacgataaga gccagggaga agatatctgt     48480
     taaagggaag gatattgaaa tacttaagca aataggaaag ggaggaagta gcaaggtgta     48540
     caaaattctc ctgggaaaca gtgtgtacgc tttgaaaaga gtcgaacttg ttggagacga     48600
     aaagatgctt aactcctata tcaacgagat aaatctactt tacaagttca agggggcgcc     48660
     ggagatagtt gagatcatag accatgaggt aaatgaggac tatctacaca ttctactgga     48720
     atatggagaa accgatttat cccaaatcat aaaaagagga aacctaagca taaacttcat     48780
     taaggatgtg tgggagcaga tgctcctgat agtgaagagg gttcacatgg aaagaatcat     48840
     tcattgcgat cttaagcctg caaacttctt gtttgtcaaa ggacgtgtca agctcataga     48900
     cttcgggata tccaaggtca taagaaacga caccaccagc attctctctg aagagcaatg     48960
     tggaacagta aactacatgt ctccagaagc agttacgcaa aacaaatcaa aggtagcccg     49020
     aagctcggac atttggtctc taggatgcat actgtatgaa atggttcatt cgaagcctcc     49080
     gttgcatgaa tatcctaatt tgatccaaaa gatccagaaa ctgcaagagt actcggaatt     49140
     caaatattca agtgagaata aacttgccgt catggttatg aaggagtgtc ttgtccgaga     49200
     tccaaaaaaa aggccaacca tagacaatct tcttaaccac aggttcctca ccggggaaat     49260
     ccatctagag ccgctccgag agctggtaac aaaaatcctt agaatcagtg gaaaggacaa     49320
     ggctgaccca gcatatgttg acaagataac tgagcagctt tggaatgacc atggataatg     49380
     aaagacatta agacaaagcc tatcaccgca caagtaagta tactggaaac cataataaag     49440
     tgtttttaat caccgggatt attatcttct tgtagggagg atatcatcga tcttcaatat     49500
     catagagaca gtctctattg ccaaagtgac aatactaatg cttacttttg ccggttggac     49560
     tacagaatct tctttgacca tgtctcctgc atggccactt ctaacactaa ttcctgcaca     49620
     gtcattctgc tttagctcgc ttcttagctc ggaaactatt tccacaggat aaagcccagc     49680
     atttcttgca aggaagtaag ggactccctc aaacgccttt gctatctctc ttagcacata     49740
     gacattccct tctgtggatt ccgagagcat caatgaaatt cccatctcaa cagaccctcc     49800
     tcccggaact aggaatggaa gctcctcaag gcatttcaca acacatagtg catcatttaa     49860
     ggatctttct gcctcttcga caaccatatc gtcgcatcct cttagcagta tggtgcatcc     49920
     atgttccttg atctccagca ttccttccac ctctccaata tcgacatcaa ccagagagcc     49980
     cgggtttaac aaatctattt cagaaacagg ctggatccct attgtactgc agatgtagtc     50040
     tacgtccttt ctgtcgacag aattaactac aagaatattc aattgcttaa ggaagtggct     50100
     agcaaggtcg cttaaagatt cccttaatat gctcttttgg atcaccagaa gagtacaccc     50160
     gcttttcttt atctttttac acatctctag aatgtatttt ctttcgtcct gaataatctt     50220
     ttccatcaat gcagggtcgt tgaccagaat cttgctgtcc atattggtct ttggagcact     50280
     caggcaaaac tgagcaactc ctagctttgc cttctttgga atctccttga agtcgcattc     50340
     cagcaagatg cttttgtatg ccttcacatc gtccaagcct ccccccgtcc tcttgacaac     50400
     ccggatcttc ctcttatctc cattgacata ctccattccc ttgatggctg cttctgccat     50460
     ctctcccgta gaagatgcta tttttgagca tagtgctgtc gaaacattgt taataaaatc     50520
     tcttctgtcg cattccatct ttaccttgtc aatgtatttg aggccaatct tctttgaaat     50580
     ctccaggttg tcgcaaataa cagaagggtg aacattcctt tcaactaggt tgctgacact     50640
     ctccagtaaa caccctgcaa gaataacaac actcgttgtt ccatctccgc attcctcatc     50700
     ctgtgctgca gacatattcg atagaatccc gtggatcgga tgctgattca agtacttcag     50760
     aatagtagcc ccgtcattgg tcacaactgt cttcttgtcc ttcactatca tcttgtctaa     50820
     ccctctaggt ccaagagagg tcgagagagt ctggagaagg gactgggacg cctggaatat     50880
     ggatgtcctg acctgattga gtctttctgt agccattggg gatcaaaatt tttctctatt     50940
     catgtaaaac gtatccaaaa taatatcgat agtgacagga ttcgaacctg tggggacaga     51000
     gtccatcgat ttcgaatcga ttgccttaga ccactcggcc acactacctt ctagatcccc     51060
     gtctccggga cccatcatta taccttcccc ctttgcccca taactattgt tttcgcttca     51120
     tcataagccg gaacttatca aacggttgcc agtaccccac attcaaatac atgttgtcca     51180
     aataatatcc attcatccgt tttattgcct tcctagcccc agacactcgg tcgtaaacca     51240
     caaatgcact tcctgccgta ctcttctcca ctcctattct tatctgtatc actcttccat     51300
     agtctccaaa taactctatt atcttgtcct tggatatgtc ctttggcaag tttcgaacaa     51360
     acagaatctg tgtttcgatc tgctccatcc tagccctgtt tctttctgct catttatttc     51420
     tctttggaaa gaaagacata ccaaatcttt attctatctc tcacatgtcc tctaaggcta     51480
     tgccagcccc aggaatcaaa ttctaaggct tgttagttta gtggcaaaac gactgattcg     51540
     taatcagtag acgcgagttc gattctcgca cgagcctttt gttcaaccaa atattttcga     51600
     agatcatgtc tttctatctt cttatctcat acctcccact cgccatgctg tatctaatcc     51660
     aaaaacacac ccctggattt tcaacacatt cagccctttc cactcttact tttgaatcct     51720
     tccactcctt tatgtagaag ttcaccatta taggccgcag atcctcatat tcctcaaaca     51780
     gatccacccg ataatctatc ctttctcttc ttataacctg ctttgtgaaa gtccatctta     51840
     gtaaatcatt ctcttcgtca tagatgcttt ttcccgacct atggctcttc acaaccttag     51900
     atgccatttt tggaatcggg aaacacactt cgagcctgtc aaatcttgta ggacttggac     51960
     agcttagaat gtaccctcca tcaatcttgc taatcatcac aagaggatct tttgcatccg     52020
     aagaccaata cctaactgct tcgagtttac ttccctggac ctttgcactc actcttatac     52080
     cttcaagccc ctcagaaact tgctggtagt tcttgtaggc aattgtacat ggtttcaggc     52140
     tacaaacatc aaactccaca gttctttcct ccccaaatga tgcattcaag tagcaccttc     52200
     catcaattct gttcaggatt gtcttttcct tctcgattat ggcactcaga tcctcagaca     52260
     catcgagata tacattgtta ctggttatag acggaataag tttctttcca ccatcaaata     52320
     atacaacact ctcctgctta tttattatcc taagcagact aaaataattc tctagaacgt     52380
     tcttctcatt aatctcccct aacttcttct cgagtttctt gcatagcctt tggatgtatt     52440
     ctagcaccga gaagtcacat ccaaggctgt gtaagattcc tatcttgaca tcattcatcc     52500
     ccacttgcac catccgagct cctccaacat catccacagg atatcgggcc tctttcttat     52560
     atctgctagg atctccgtac aagactcggt ccccttctcc aactataaat atctcctcta     52620
     tcatcggttt tatttacttc ccgaaaatta agatatctcc gctgtttaca tgttttgttt     52680
     caggccatct agagcccatc gcggattccc cggaagaagg agcatattct tttcaagtag     52740
     tgtttaagat tctgaggaag tctgttgtcg attggaaaaa ctctctcttt gtaccggacc     52800
     ataagatctt cacatagaac ctcaaatctt tctccatcgt tcatcaaaaa caggaaactc     52860
     agtccatttc ttatgcacca tcctgtgttt tcgatgtaat catagagtgt tctgtttctg     52920
     atgctcatct cactcacttg agatatgtat gacatcgaaa attgctggtg tgaggaacag     52980
     tccaccagta caggtgattc cctcaaaaac caacatacct ccctgtctat tgcctcacat     53040
     ctggctttca tccccataat ggtttcgtat aagaagtctg gaatcttttc cgaatacttc     53100
     ttttccccag ccaaataaat cacttcatac cctttgcctc gagttttcaa agtaaactct     53160
     ctcgtaacat acacaaaccc tccggaaaac atgtaataga acttgtttcc accattgtcg     53220
     attattatct tgggaattct ttccctcatc attttcacat gtcctgtgag gagacttaag     53280
     gccttcaaac ctccatttgt gacaaataca ggctcggttt cttcgttccc aataaacaca     53340
     gagtatataa actcctcccc acataaacac ttttcctccc catgtcttct tccacttcca     53400
     tgcctttctt tttttctagc cactatccgg gcatctccta gttcaaccag atctctggtc     53460
     ttcttcataa ctccatatct tgtattcttc tcaaagttgg ggagatctct gaaatcttcg     53520
     catctaggta taaacctact aaagctttca tgcataagcg cctcgcttgc actaatcctc     53580
     ttgttggcat ccttctcaag caactttcca agaagatctt taagttcctt agaacactcc     53640
     aaagaactca aggattcata aaactttttc ttcgtaagaa gtacataaaa cactattccc     53700
     gcagaccata tatcaacccc ctgggagtat ttccttccct caatcacttc aggtgcaagg     53760
     tagtccattg tcccacagaa ttcattgctg ttttcctccg catagcagga gagcccaaag     53820
     tcacaaattt tcactgtatt tccctttaga agtatatttc ccagcttcaa gtctctgtgg     53880
     ataactccca tggaatgtat gtgtctcaat ccgcacagta tcatcctcaa tatcttcaag     53940
     gctacatctt catcaacctc atactcattg agaaacgaga caagattcag atcgcacagc     54000
     tcttcaacta tatacacatg gtttgcagat tcaaacttgt caacaacctt aacaatattt     54060
     tcgtggtgga atgagcttag cattttcatt tctctgtaca ccattcctcc cgaccttcct     54120
     cggcgggatg ccaccttcac agctacctcc tccccaattg cagatacccc gccatatact     54180
     gtgcttgatg ccccttctcc aatcactcgg tgaagcttgt acttcttcat ccccttcagt     54240
     ccctcattcc aaataaaaaa tctgctttcc gatactctcg acatcaaata cagaataaaa     54300
     tcatttatta cactcagccc aaattctata cagaaaataa tcatcggaaa tgcttttcgt     54360
     aatcaactaa tgctattcgg gtgtgtcttc taaacttcac atcgagttca cagtcttggg     54420
     ctttcttttt ctcgctctct atctcttcca ttctcttttc ggtgtccaaa tcataaggct     54480
     ctaatgcttc acagccaaac tcaccaaata gcacctcgga aacatttaag taccggccct     54540
     tgtacatttc cttaacaagt tcctcgttca gaatcttctt agccccgaag agacacaaaa     54600
     tcttgtagtg gctatctttc gagactccat ctccaacaag atccattaga agatactgta     54660
     tgtctctgtt ttccgtttca cagaagagca cacggagtct cctcattact ctttccttta     54720
     caaaaggctt gagagctcgg cccataaagt aatctttggc tagatacaat atcttgcagc     54780
     aaaatcccgc agattccccc gttcccgctc ccaggaggag cgtcataaat tttggattgg     54840
     gaatccaatc ggaatgaaca acaaaatacc tttggatttc atcaaatatc gtggtcctga     54900
     ggtcttctgt gtacccgcta acttctttgt cctgaagaat cttcttaagg aacctgtaaa     54960
     atacatcgga tatcggctta catttctcaa aatactttct tacgtaagga ataatgaatg     55020
     gaagtttact atcgtcccta gaaaagaaca tctcaaggat gctgaaaaag cttaccacta     55080
     tttccttctg attcaagtgc agcacttcat attcattcaa aacacctagt gcttctctaa     55140
     caagaaactc gcattctcca actgccttgc ttcttccaat cttcttgtct ctatgcaccc     55200
     tttttcctct ttccaaaatg ttcatattgg cctgaagaat tatctgtgga taaagatcag     55260
     gcccaagata ttccgtcagg gttcccacac aggacttccc catccaactt gcattcttca     55320
     gtacatagta gatgaggcta tttccactaa tgatatttgc ctttcctgcc acagccttaa     55380
     atatctccat tctcttggaa ctgttcactt ctccatgctt catgagagat cctacaagcc     55440
     atttgtactt ctcatcatag tcgatcctca gaatgtcctc catccccata agtgtgtgta     55500
     taatctccag gaagaaatac tcaaacctag catttgatat ctcccctcct tgttcatctc     55560
     catgcatcct aaagtcccct gcctgcctcc cctcatcttt ccagacattg gtagtttcga     55620
     gtacattctt ttcattgtat tccgcttcat catccaagga cagaccttct gctattccat     55680
     cggaattttt aacatccttc gctgcctggg tagcaataaa aagaatcttt cggatgtacc     55740
     tctcactctc gtatgctcgg atcggtactg tcttaaagaa atacgtaaac acatccagaa     55800
     actcctgatg gtccgaatac tcgaaatccc cttttctttt cagctgcagg atctcccgaa     55860
     tcaccccaac aaatatcctt attatccgag actcatagca gatcgaaact cctctcaact     55920
     gatcgataat tagtcttagg actttcgatc cagttttcag tctgtgtgtg ctgtatacct     55980
     cctctcctgc ccttatcttc aggtagtcga gtgtgcttgg tatggtggat gtcctcgact     56040
     tcaagtatgt tatgagttta gacaatttct cctcacttcc actcctcccc ttgtatacat     56100
     cgtcaaccat ctgaaagtgt ttttcgtagc caaacagtgc tcttaacatt ccggggcaaa     56160
     ttatttagtt actaatgact gtgctttcgt ctgcatttcc ctcttacaaa atacgcttgt     56220
     tctttctctc atatctttgg atacataagc ttaccttcct ccgcttcctt gtatattgct     56280
     tttaccttat cctgcaaatc cttgtttact ttgtctaatc ctgccgctgt tttctcaatc     56340
     gactcctcta tctccttata cttatgcttg atttcttcta gcagttcact ctcgaccatt     56400
     ccaatcatct tctcagactc gcttagccgg tcagattcca ttaagggtag gcagagttct     56460
     tcaaattcag atatcctgga agcccttgat gaccttgatc aaacggatta tttccagaaa     56520
     taagtcttgc tacatcctcc aggcaaatga acaaacattc ctcttcgact atccatcgag     56580
     tatttacgga acacattttt cgtttccttc ctttgccaaa gcaccaaaac ccctaaagct     56640
     catctttccg aagtttgtgg acaacatcga tcatattctg atcactcggt cagactcatt     56700
     gggtgtactt tttcttgaaa aagacattcc catatacatt acagagcctg tgtttgaaca     56760
     gattttgata aagtacaaaa gtcttctcaa gatcccggcc tattatgaag atgaggagga     56820
     cgagggtgtt tccgtagaag acgcagacgt cgaaagattc agaagaaacg ctagatttgt     56880
     cagatttaac gagagatgtt acttcgataa tgttttgatc actccgcacc ccgcaggaac     56940
     atttattggc tggacgaact acttgattga tattggagat aaaagaacca tatactacct     57000
     cacctccttg gctagcaaga ccagactttc tttggaggct ggaggtatct cctcagacta     57060
     cttgatcatc aatacggatt tccctcctcc ctctcatgac attgaggagt tttctactta     57120
     cattaatgac ctagggtctg atgttgcgat cgtgccttta gagatgacaa caatgcttat     57180
     cgaagttctc ctccacacgc tgtttgtgac ccaagcaaag ggcacaattc caatatacgt     57240
     tgtatcatcg gagttcggcc gccttcacac aaccatcagc atagaaaacg aatggctaag     57300
     taaaccgttt tcatcggcta aggagccttt tccaatcagg tcatatagaa ggttctatgc     57360
     cgtagacacc atcgatgaat tatctgagat ttctgggccc gcagtagtat tttgtgaccc     57420
     attagagttt agtctttatt cccatccgat ctttgacaac cagaagatta tctctattaa     57480
     taattcggtg ccatttgcgg atgctaacta caatctcaag ctggagctgg accccgagga     57540
     gatttcatca attcatacag gaacaataat acacaaccca aaccctggag agtatcttta     57600
     catcgaggcc atgcctggtc attactgtct tgctgtggat gctcgtagta tccaagtata     57660
     caccaatgaa atatatttga acgggaagtt gaagtttagc gacaaacatg gctttggaaa     57720
     gaagatggta ttttctcaga aaaagtgtaa gctaagcgat ttattcagcg ccaacagatt     57780
     cttctttagt gaaggctcat attactttcc ccaaaagggt cttaaggtta ccatagacaa     57840
     caaaaaagcc aagataaaga aaattattgg gctgaacaaa gctaaaagga cttccaaata     57900
     aaagacaatt cactttacac cacgtgaaat gcatgtcaca ttcgattgaa gtagtccttt     57960
     cttcggcgca gttccctcat tctctctgat tccgagtctt cggtcagtat tttccccaga     58020
     ttaaagaagg gattgtattc catttcgtct ctcagcctta ggaatctctt tctctttatc     58080
     tctggaggta tgcaatagaa ctcctcggtg aactgaatat tctgtttgtt atagtcatgt     58140
     ccatatagta aaatggcatt ctggtctact ctttccatta tcttcttgat ggcttgaacc     58200
     atttgttccg gtgttccttc aaagaacttt ccacagccta ggaagaacaa tgtatcccct     58260
     gtagcaagga attccccgcc aatgtagtag caaaaactat ctacagtatg gcagggtgta     58320
     tacaggcatt ctatctccac ttctccaaac ttgaatctgt ctccgcattt acatatgctt     58380
     ccttcaaatc cagatattct tttggtctca gggctatttt ctgctatata cggaatccca     58440
     tgcgaatggt cttgatgtct gtgtgtggta aagaggtaga caagctttct tctcttttcc     58500
     aaatcctctt ccatgcctag aatctcgctt tcgctatata tcttcttttt gaaatccact     58560
     ccaagagctt tcagaagtac ccgagggtta catgcatcta tgcagaatgc agaatccccc     58620
     tcgtagaata gatgcatgta gttgtctcct ataactatgc ttacaacttc aatacccatg     58680
     gccttaggaa cttctctatt tttaaatata agaatgctta ggcttcaaag cctcgtaagg     58740
     atcagccgca tctatgtctt ttcagatagt tgaggtgtgt aaattaaatg tggttcctta     58800
     aatcctcgga aaattctcct tccctgactt atgtacataa tcttcgagtg ctttgtccac     58860
     acacaatggc aacagaacac cccgatccca agattcgcaa tccgagacgc cttgttgagc     58920
     acagggccat aaaaccttac atggttgttc attatccttg tatagaaggt cccgcatgtt     58980
     atccctattc caacatcaat ccctagacac ctgagcattt cttgaatcct tattccccac     59040
     agacaagcct ctactctgtc atgaaatgca acaatccata ttcttgagaa aaactcaatc     59100
     cgagttccag aaaacacatt gctcatcatt ctcattatat tcataacatt cccaataaca     59160
     tatctgtagc ttgtgtcttt tggaataagc ttgcagaatg caaaaatagg atttggatta     59220
     aggagaagag taccgtagaa ttgccttgtg ctgctttttc tcgcaaagtt atagttttca     59280
     cttccctgaa ctccattttc gttccctttt ttcctaagaa tgcttctgat aaccgtctca     59340
     tatgatatct tacttggaag gtcaattctg gatattagct ctacacttgc ctttgagttt     59400
     ttgggtagtt tggatgtgtt tgagattgcc attactgcag agagagggca ttggtggcct     59460
     atgaaatcta atacaaggcc cagatcattc ctgaccgtat ccaatatgtc aaatcttgca     59520
     atacttcctt tgaagctgca gaatagaggg ataaaatgcc agtttccaat gttgtcatac     59580
     acctcgacaa catcggggcc ttcgagaatc ttaatctccg caaagttgga aaacacaacc     59640
     tcaatccctc ttccgttaag gataacatgc ttgggcgtca ccatgcacaa tgcatatcct     59700
     attctggctc ctcttgcaaa aatcatcttc cgaagaagag agcaaaactt ctgaaaatat     59760
     tcataggaat tagaggtttc ctgtattctt acctggatag tttcaagtat ttcaaagaca     59820
     ccagcctcaa agtcccccat agatataacg aggagtcttc cattgattcc tttaggatgg     59880
     actataaatc gttcgatctc ctttttcttc tctaagcatt tgtgtacatt cttttctatt     59940
     ctattccctc taaaatcttt tataacattt gtacctttta gattgaggaa cttcaattcc     60000
     atttctccgt aattctcaag gctgacaagc gggttgtacg aaagattcag gtgctccaga     60060
     tttttccatt ttgcaaggtt aaaaaccatt atctgattct tggaggcatc gaggaacctg     60120
     actcctttgc ttgctattcc atgtataagg tttccagaaa tatccaagta ctcaagaaat     60180
     ggaaaaaagg gaacttcctc tataaaattg tttctggcct tcaggactct taacttcctt     60240
     gcattaaacg acaagagacg taggctgcag aaatttacac tcaggaatac aagattttca     60300
     aatgttccga gacggatttc ctttgtccca tctacaatca gcttctttgt tatttgtgat     60360
     tccaatgact ttagcattgt gtgggataga tttagtaccc tggcttctgc attgtagtgt     60420
     tccagggggt tgtggctcag gttcaagttc tgatatgtag attcttggaa gaatctggtt     60480
     atctcgttat acgaaatgtc cagattcgac gccttcatcc taatgactct ggttattttg     60540
     ttatgcgaaa gattgacagt gttgaattgg ccacaaacat acactactcc ggatatgttg     60600
     ttatggctta gatctaaatg tgtaagcttc atcatcgaaa gatctgggat cttcttgata     60660
     ttgcaattca ccattctaag tttcttgagt gctgcaaatt tggattggtc ttgtaacacc     60720
     atccttgtaa aggtcacatt tgctacagag ctccttggct caaccaccac caatcttcgt     60780
     aaactgcata tccttatcaa atccccgtcc ttgtaaagac atcgaagaat gggtctgtca     60840
     aggcccttca gaacttccat tcggtcttcg tagagtaccc ctaagactcc tttccctcca     60900
     atctttccca acaagtcttt tgttctagag aaaatggatc cggtatattc atattccttg     60960
     tctttaaaac cataaacagg gatggttatg gtgaagtcat ccaagtaaac aagctccgaa     61020
     gaaaagacat gtctaatctt tgtggaagtt atcctttttt ggctctcaac tcttcgaacc     61080
     tccagctcaa tctccataaa gggtctcgca aaaatcaatt gataatagag atcttcatta     61140
     atatttaggt catctaagga aagtctattt tggtgtattt gcctcctttt aaaaacatcc     61200
     atttctagat tctctgggcc caaaatctat ctacccacag ctgtttcaag gagtgcttgg     61260
     atgccgtctt taaggggtca ggcgcttgcc aatccctaca aatcactttt gttttgagcc     61320
     cctgcatgga caagttccac tcgctggcca taaaagcatt acttacattt attctcacaa     61380
     ccggagtatt tgtgaatgag ggctcattca agatgccctt atggattggt ctgttaccgg     61440
     ctgttttgtt taatccagct gtggctgtat acttttacgt aaaaaggatg gaatataaaa     61500
     agaggttttt gagaaaaaca tataatcccg ggaacagagc actcttgggg tttgccttcg     61560
     gtgaggtttt gtctataatg ccattttatt gcatatcgga gtactggaaa accatgctgt     61620
     tgaacatcac tttggtggcc atactcagca ttcttccaat ggttgattcc tctggaagaa     61680
     gaacaataca gctggagcga aatgaggagt ttttcaaaat aggcttcctt agagtggaac     61740
     atgtcgaggg tggagatgtg tgccttaaca aaggcgaagt cgtccagatt ctggatcatt     61800
     ctggaggaag caccacagta agaaagtccg acggaagggt ctttacaata gaagactcct     61860
     atatcgacga tggaatcgac attgtcctgt agcaatatca atatgattag taatcagaca     61920
     aatctttcaa ataaaatagt actagatttt cgaaagttat aggaatagca tgcgagcata     61980
     gttcatccaa ccacgtttat tcaactagaa tgccctcgaa gttctcaaca aaccacttct     62040
     tggcatcttc tgcatagacc ctctgcttat ttccaacctt tgatctgcat cttctccttt     62100
     tcgataccct atctcctggt cttgaaagaa ctacaaagaa gtccattccg aagattccga     62160
     tgtttggatc atacttcaga ccaaggtcaa tgtgctcttc aattccaaat ccaaagcatc     62220
     cgttattgct gaagcaactc tccttaagtt cgtattcctt gaccttcaat gctgtgttga     62280
     gaagctcgta agccttcttc ccagatacat tgacatggac agcaatcttc tcgtttctcc     62340
     taattccgaa gttcctgatg gtcattcttg ccttcgaggc cacgggcttc tgtccagtca     62400
     actgctcgag aacctttgct gccctgtcaa gcttcgctcc gctttcccgt gcacaaatgt     62460
     ggatggaaag tttcttaatg cttatctctc tcattgggtt tatcttaaat tagcccgttt     62520
     caacttactt tcttcgatgc catgttgggg atcaaatttt tttcgctcaa aactattaca     62580
     atcaaagacc tccagttgtc tagaaatctc aacggtatcc cccaggatct ctagctatct     62640
     ttccgaagac ttgtccatct tgataaacca tttcttgtct agaatctcac ggatgtatac     62700
     aacatttccg tctttggccc ccactccaac ttctctcttc gaggccacag gctttaaaga     62760
     aaacatctga cttccattct tcaagtacca agacccatcc tcaaacttca caagctttgt     62820
     gttagaacag gattccttgt gtctaacctg gaatgttcgg acctcttcat ctccatactc     62880
     attaggatca aaaacaagcc atccaggctt cttcaccaaa aaatgcatag atagggtctt     62940
     gacatgcaaa tttaaattct gccatttgca ggaggctaaa gaggaaggtt gtttcttgct     63000
     tggtggtaca gatgcatagt acttcctgtt agttgcaaga tacttctaat ttacatactg     63060
     gtgaaatgcc caaccccata aaatggagca tctactgaac gacattctgc agaatcccca     63120
     agggccttct gtaaagcatg ttgaagagcg cttggacgga attgacgggc aacgtgaatt     63180
     tgtggagctt ctcaagagcg gaaacggaat cgcatttact tacatgaaga caagatgtaa     63240
     ggagtggacc gagaacccga aacgcattga gatgatacac agaattcacg atgttctgtt     63300
     ctcactgata ttcacatctt ccgagcagaa cttcgggatc ctatgcttct ttttcgagac     63360
     cttgtatctt tgcggaaacg gatggagcag cctagttgag gacttatgtg caaatccaaa     63420
     tggaagaagt gtaagagttc tgaatcacat gttcaacaag tacagggttt gctcaagaag     63480
     caatgccctg tatggcgaaa taataaggaa catagagctg tgccaggaca tatttaggaa     63540
     agcatacttc gaatctcttt ctgaagacga aaacatcctt gggatgttcc actccctggt     63600
     atttcaggac atccatccct tctttgagaa caatgcagat aggtttctag gatcattttg     63660
     caagttgcta cgtaagcaag ttctcgaaaa ggatgtatgc gagatcttca acttgtttgt     63720
     aacaaagtat cccgagtgtg ttgacatgac aaggattcta ggagtggtgc tgacaactat     63780
     aacaggattc gattatctta agtatactgt tctgctcaac attgtgaaga gaaaaagcca     63840
     tcctgtcctt tctaagttct ccgatgcgct ttcaaatgca gtgaagatgg gcgcatttgt     63900
     gtctgagaac gaaatcatgg aaatgaatga ggatgtgctg ctgtattcaa gaaatctcct     63960
     aaaaggttac gatgtaaata gaggaataat tatcgagatg atcgggcatc ttcggaaggt     64020
     ttttggagaa ggatggggaa gcatgcttat tgaaggaaca gtggcaacac caatagagga     64080
     agagagatta atatttttgt gcatggcttt ggggatccga ctggaagagg ctgttaggaa     64140
     gtgcagtggg atagttcagg atagcaagtc tataggatat ctgggagttg tttcctttcg     64200
     atatctgctg tctattggcc actacactgt cattgatccg ggatacatta acagaggaaa     64260
     ccctggatca tttcttgcaa tggtgtatct aagcagatgt attgataaca gtggtgcttt     64320
     ggagtctctt gagtcctatt caacaagata tggagagggg aacccggaag catgcaggaa     64380
     gattggaggt cctgagaatt gcgcaaagat catgagccat ctaatgaagt ttcttagaga     64440
     taacatcgaa gatgaatttt cttcacaatt ggttcagaaa gtggttagaa tctgcccttc     64500
     ttctgtaagt cccgaggtcg tgaggtttat cgatgaattt gtatggaaaa atgtcaggaa     64560
     tatcaattca cctcaagctt atggatatct acttgatgtg caaggacttg tttttctgaa     64620
     gacaggagac aatacctgga ttctgaatct tgtgcaggtt gtgctaagcg aagagatatt     64680
     cgaaatatat tcctcttcac tatttcttct tgccattgtt gttctgcact catctggaga     64740
     cttctcacct gttgtagaaa taataagaca ggagagcctg tggaaaacta aggagcttct     64800
     tctaagtatg gtttgcctta cagtatccct tttcaagacg gggaattgca gcaaggagca     64860
     ggtggactac attgttgagt atctgctagg agtcagcatt catcatgcct atgttcttct     64920
     caccaacaca gttgtttcgg gagattatct gaagtggatc aagggagaaa acatagaaga     64980
     ggaatttgtg ctagcttgtg cactgaagaa aaggggcttg atcagcgaag agatgtacaa     65040
     ggagatatac accaggagtc ttcagtattt tgaaaagaat tttgtgtcga aaagaaatgc     65100
     ccggcgggtt ctgagagggc tgggatatgg gatggaaagc tttgggagga gtgaagctta     65160
     cggggtaatg gaaagaaaca aacacagtat aggctatgaa aacattcctt tcagtgtagc     65220
     cgttgccttt gagctctaaa gtcctgtttt ccttttggca tgttctttta ttttatggca     65280
     ataaaccaga tttgattctc tagatatatt ttttccaccc accatctgag atgaattatt     65340
     tttctgagta gcaagccctt atttacgatg tttcagccag ggattgaggc atacctggat     65400
     gccataaaac agcagtacga tacggttatg gcagaaaata ggtctctgcg gaaggagaac     65460
     attcgtcttg ttgaagcaaa tgggcaatat gcaaggaaaa tccagtacta cacgagtatt     65520
     ttaaacagac agaagcatat gtctctggag accgaggggt cgtttataag acctccaaag     65580
     tatttgaaga gaggaagcga ttggagtgtt gatggagata agctgtgcat agtgagcgtt     65640
     cgggacaaga taatggtggg aggaaagata acgaatgctg ttataagcaa gtgcgggaag     65700
     tttgtagcat ttggatgtgg atacaaagta tttattgtaa tggagaagac tatttggttt     65760
     ttggacacct cttccgagaa gatggagaga tacgaagaag gaatgtttga aggagagaca     65820
     caggaataca ggatatgccc catggacttc acttgtgatt ctctttatct gtatgcggca     65880
     gatgggaaag gagcagtgag gatatggagt ctgaagagta aggctcaaga aggattactg     65940
     aggccttgtg atcctgttgc actcaagata accaacaact tggtgtttac gattgaatgg     66000
     gacaagacca tgaatgtgta tgattcaaac aacaaggttc ttactctaag ctctgaagag     66060
     gagtttagtg ggcccatggc agtaagtcca gacgggagct tcgtatatgc agttgtggga     66120
     agaaccaaga ttcttgtttt tgacatcaaa acagagatgg ttcatctagc aaacaccaac     66180
     gaggatcgaa ttctggcgat agcaacctct ccagaacacg cgataatgtc gataggaggc     66240
     catggacgaa atgcctatct ttacaggata aagaaggaaa agcccttacc cagggtgcag     66300
     gattctatcg atcagagagg cactgtcttc tctctaggat tcataggaaa ccatttgctt     66360
     gtaggacagc ccgaaggtgt tatgatctgg gatctgtcgg agaaaagaag catgaggata     66420
     caactccaag agtcaaatgt gattggaata tccacatgca aggactcttt tgccaccgta     66480
     gacaacaatg gagtcttacg tgtatggaga tattacaatt ctgtggaatg ggataatagc     66540
     tcttgacgag catccaattt aaaatgcaat cccctagaga ctttattatt aaaatgtttt     66600
     ttggcctatt ggcacttcta tgctatccgt agagaagata attggcaaaa tgtcttcttt     66660
     attgttagag cctggagatg tattccttta tatccgaaac ccaagcgtct ctttcctttt     66720
     cacaggtggt gtataactcc actccctctc cagatctttc aagacagaag ccgacttggc     66780
     caatgggcaa aacattacag ttactaagaa gaaagatctt gtagactctg ctcttctcat     66840
     aacatataag agcctttcca acaaacttaa aaaggtatgc cttccatcca tccttgtcca     66900
     tcaagagata cgaagatctg agcagatggg tactggaaat gtctgagaga atgaaaggct     66960
     gtagctgctt atcggtcatc tccgagttta gcgcgatttc tattgctcta tctcttgctc     67020
     ttctatcttg tggagacatt gcgtttgcta gtgttgcaca tcggataccg gggaaaagtg     67080
     tagaaatatc ctttatggtc ttgcatatta tccattttat gtccgactca actgtgatgt     67140
     agtacttggt tgtttcggct gaaccttcgt aacatagtac agtgttagag atcctgattt     67200
     gaggatagat tgttagtttg cggccaggag cataaagatt tgaagccatt tgggagttcc     67260
     gagtttctga ccagctgtga gaagccccct ttagattacc ttcgggtttt tcgatcgtat     67320
     tctctggctt ggacatggac tttacataca tcacatcgat aggagcaaag gttggagact     67380
     tccctgttct agtatacaaa aagctgggtc cttgatacga ggttttgctc gacaagctaa     67440
     gagaacttgc gtttgataag ggattactaa atacagattt ggagacagag aggtcttctt     67500
     cttgggcttc ctttttgcca aaaggacttg gcgaagttcg gtttcttcta tttccaaagc     67560
     tgccggaatt ggatggagct tctctattga aaatagagct gctcgctatt gatcttacat     67620
     agcccacttt ggatcctcga ttgatggaat cctcaacgct tcccttattc ataccatacg     67680
     agctgaagtc tatagacgat tttttgtaaa gatccattcc caccatcgat cccttggata     67740
     tgtctttatg ggccgggctc ctattcatag ctccagaaga gtttactttc catggaatca     67800
     ctcctccaat aaatccatcc ctcatctttg tactatttac atcaccagaa ttgttttttg     67860
     gaatgccatc tgcagctcca ttctcatttg aaaagtcctt gctcttgcca aagtagtttg     67920
     caggagattc tagcttaaca tttctgttga atacaaatcc acttccaaca caagcccttg     67980
     ccttaaactc ctcattgatc cttcttagct tctcatccat cgatcccatc gacaaccctc     68040
     ttgcatccct aaactttcct tccggttctt ctgcagcagg agacaggtat gagttcaaag     68100
     agtcttttcc catgtttagg gctcaagtaa atatcaatat tcaaaagcct ttaataaaac     68160
     cttgaaaatt cacgcgcgca taagtaaaac aaaattcttt aatattcttt cgctgttgtt     68220
     aacagtctac agatatcctc aacagggtct acaaatatct ttctcctata cacttcgtgg     68280
     caaagctctt caaagagctc tcttgtatcg tcgtccacaa ccatgttcag gacagaagtt     68340
     ctgagataat cgattgcctt ctcttcgtcg atcccaagaa gatagaggta tttatgtttc     68400
     ctaaccagaa actttgagag atggcgtatc tctttgtttg tcttcttttc aagcctaaac     68460
     acccacatgt catttacgcg ccggtctacc ttttcggaga tattccctcc aaacaagtaa     68520
     aaccatccat ccatctctac aaactggtgt gcggaccttg gcgccggttt gatatccact     68580
     ccggcttctg ttcttgactt caccaccact tcagtccatt tcttcttaat cagagaaaag     68640
     gtatatacat ctatgttttc aaatcttcct tccttctctt ttccatggca gaaaagaaca     68700
     acaatctcat tcaagtacag aaggcccctc tggacaactc ttccctctcc actgattggg     68760
     aatggcacac tttggaaaac agtgtctgtg tccagtctgt aaaagaccat ttctctcatc     68820
     gagcttttgt tcttctgccc tcctatgact acaaggctat tgttgtagat gctaccctcg     68880
     atatagtcag ggggaataaa caccatacta tgctccagtc ttgacttcag agagggagtg     68940
     cttgaaggtt gcattgtatc cgaccttatt accatccacc tgctcctaaa caaactcgac     69000
     gacgatgttg aaggttcatg gcgggagttg gattcatcta gcatattttc ctgggagatc     69060
     cctgttccaa atgatggaga aatctcagcc ataccgggag atctcttctc ttttccgccg     69120
     aattggccgc aagtcctgta ccttccatct gtctctgaga tgggctttcc aacttcattt     69180
     gttcttccac actttcccaa gacctccatc ccatagccca gggatctttc gtcaagtgaa     69240
     aacatgtaaa gtccagagta tgtgtcttcc ttctctgtag atcttcctcc gaacacatat     69300
     aatttatctc ccacaacaac catctgatga tcatatatgt ttcccggtcc tccctcttcg     69360
     tccgagttaa tcaccctcca gtttccatcg aagacccata tgtctgattt ccctgaaaag     69420
     accttgcgag aggataagca gatatatttc cccatcagat aaagtttcga cccgtatgaa     69480
     accattcggt ggcaacttct tttccctggt gatactgtat tcatcttaat ctcactccat     69540
     tctccgcctc tgtatctcca gaagtcctct agttcttcca ctccgttcca tcccccgtaa     69600
     agatacaaac tcccatccat ttcaaccatt tgatgtcctc ctctttcgca aggccatacc     69660
     tcggctcttg gtatctctgt ccacaccaat gaatagggag aactatctat gaatccttgg     69720
     aagacacacg gatctaacct atccagtact tcttctgtat cctcgtactt atggctttcc     69780
     agcaggtgcc ttatgtgctt tacaatttcg tcttctattt tatcggagct tcttttctcg     69840
     agaatctcat aaacatctct aaatccacag tctctcagga atttcaggca gtttctcatg     69900
     gatttcccaa aaataaccat ttcattgtat cttgcaaatt tctcgacatc ggctattcct     69960
     ctcagctcga caaaccataa agagtagctg aagttgactc cccatgcagc aagaggctca     70020
     atcttcacat actgggcaat gtaatatgtc tcatccttta caaggagatt aaaggtctcc     70080
     atttcagaat cgttttttag gcctccgcac aagacctctt tgtactcgac gccatctccg     70140
     gaaacgctta ttctcatctt tttaacattc gatacatgca tcttgttgta ctttccaaat     70200
     gtaatggtca ccacaaggct tggagggatc tttaagatga tatattggag atgatcgtta     70260
     gttgatgtcg accatcttga gtttggatcc atggggtcat tctttttgat attgcttggc     70320
     atgtatacag aggcatatgt tgaatagctg tgtatctcat agggaatcac ggtgtaagac     70380
     cttctatcat tcaacatttc tcaggggcaa ctttgtcaac attttgatgt accttgattt     70440
     tgattcattc tcagataata aaagaatgat tagggttcat cataagattg cctgagacca     70500
     atgagattgt tacagtatgt atataaacca gagatttttt tatcccatga aattggaatt     70560
     acatatggta gatgaagggg gaagaaatga gtctgttgga tttgatagag gaaaagcgtc     70620
     gaagaggctt ctgtgggtag gaagtgattc tgaagttcgg ggaaggtcga gtcttcggaa     70680
     ggagaaggga gggattgcca ggggcccaga gaaaagtaat cagcactctg gaaatgacaa     70740
     gaacgagacg gtatctcaag actccaagga agaagagaag gcgattgcaa cagaggatgg     70800
     agacagcaag gttaggacga gtgagaaagt gaaaacatta aattcgttca aggacctctc     70860
     ctctccatct ctggtaaagg tgcttggaag agaatacact gcgcccacag tcatacagaa     70920
     gtactgtata ccatcgatgg ttgatggaag aaatctcctc tgtagagcac cgacgggaat     70980
     gggaaagacg atgtgtttcc taatcccgat catagaaaga tatcaacaaa tgaacaagcc     71040
     acaggcatgt attatctcgc caacgagaga actatgcgaa caaattcgaa cggaggcttc     71100
     caaacttgtg gttgggagta agattcgggt ggtgtctatc tacggcaaga agcaggatct     71160
     tcctagctat gctggagtcg acattatagt tgcaacacct ggaaggctga tagatctatt     71220
     gcacaaagat aaggtggatc tttctgaagt aaggatgttt gtcctcgacg aggcggacaa     71280
     gcttctggac atgggatttg agatgcctat aagggagatc cacaaatttg ttcctaaaaa     71340
     cacacagaca tgtctcttca gtgccacgta ttcaccaaag cttacgagga tgataaacta     71400
     ctttctccct gacgacaaag tctcgataga aattccctct gagactctta agaacatccg     71460
     gcaggacatt gtggaggtaa ggaataagaa gaaaatgctt cttaatatct taaggagctc     71520
     ggagatcaat ctcaaggggt catggaggat ggaagtgcaa cccgataaag tgcttgtttt     71580
     tgttgaaaga aagagcgaat gcggggaggt tgagaagacc ctaaagaaaa atgggatcct     71640
     ctgtgttact ctgcatggag ataaggagca gtcagataga aacgaggcat tgaaagggtt     71700
     ccgtaatgga agattccctg tgatggttgc aacctcggtg gcagcccggg gtatagatat     71760
     caaggatgta aaactggtga taaattacga cattccgaaa gacataaagg aatacatcca     71820
     tcggatagga cgtaccggac gagaagggaa gtctgggagg tcgatatcgt tttatgatgg     71880
     gggaatgagt gctgatttca agaaagcatt gatagaggtc ttgaaagagt ccaagaaccc     71940
     cattccttcg tttctgagcg atactgctga agactttgat gccaggcttc aaagattgaa     72000
     ggtaagtgct gataaggaga tgtcggatga cgaagaagtc gggctgtggg gatgatgttt     72060
     cttttggtta atgggataat aaatactggt tggcaattta tgttaggaaa actggccttg     72120
     tgttttccaa tctatgttgt ggacagaaaa gtacaggcct aagtctgtgg acacatttga     72180
     gggtcctgag catctcaaga gcattttaag aaactccagc gagagaggac atccgaacct     72240
     ccttctgtat ggaccacctg ggacaggaaa gacgaccttt gcccatctct tggcaaccag     72300
     gaagctggag cttaatgcat ctgacgaaag aggcatatct gtgataagag aaaagatcaa     72360
     agtgtatgca tctacactgg aaaaggacaa aacagtaata ctcgatgagt gcgaaaatct     72420
     cacgtcggat gcacagcatt gcctgaggag agttattgaa gattctgtga acacccgctt     72480
     catatttatt acaaactatc catcgaagat catcgggccc ttgagaagta gattggtagg     72540
     agtgaagttt acacttgcag ataatagggt tcttgagggc ataggaggca acgaaggact     72600
     aggctacgac aaggagctat atcgcagact ttttaagctc tgtggaaacg acttaagaaa     72660
     ggcaatcaat gtgcttcaag gcattgctcc cctgagcagc ttctgcattg aagaggccgt     72720
     tggaagtatt cctcaaaaga cggtggatga gttttggaaa gtaggaaggg cagaagttat     72780
     ggattactcg aagatgttcc tgagagacgg atactctgca cttcaattgg ttcggcagct     72840
     ggctgggtgc tggaaaggaa gcgatgccca gtctgcaaag tttcatcttc tgctctcgtc     72900
     gcttgaagag aaagcggtct tgggatgttc ggatgagtta gtcttatata atctcctggg     72960
     aggaaaggtt gagattttta gccaataaat ggagttgttg atatttaatg aacataagct     73020
     cagtccggct accttttgtt caacattttc attagtcttg cataatatcc ccatcttgct     73080
     agatattccc cacttggatt gcgcttgcac tgatcaatct ttttctccaa gtcctctttg     73140
     attctgtttc tatcttcatt gttcttggca ttcgaaatcg cttgctcgta gtccagcacg     73200
     tcgatcaaaa actccttccc gacatcgata tttcctggat tgttcaagta tcttgccctg     73260
     gagagatcgt tttttaatgt gtcgtaagct ttgtttattt cctccattga tatgtcttct     73320
     cctgaaggac ttgctttgtc tggatggaat tttcgactca tcttgtagta tctctccttc     73380
     aagacattct ggtcgatggc gaacgaaggc ttgagtccaa agatgtcgaa gtatcttgat     73440
     ggacttccca tctgtgtggg tgatagtaga gttgaaatgg gatgttcgaa tattcttctg     73500
     ggatggagct acccttgaag atggggaaat ccaagggaga tgatagaaag aaggaaggta     73560
     ggaagtcttc tcggcacaaa cttccgggga aggaaggaaa gacaggaagt aaaaagattg     73620
     ttctgagaaa aaagccatgt cccatccaag gaatagagtt acaagatgcc acaaagatag     73680
     agaaggatct tttaatgcat gggaccatca aggacaagat cgatgttctt acgttgctag     73740
     ttgagaggaa tccatctcca gaaaactata aggcccttct tgcattttgc gaaaatcaga     73800
     gaaacgatgt tcactactac gtcctcaaga acattcaaga tcttcttata tccaagaggg     73860
     aagttgaaaa tccttacatt aagcaaagaa tcataaagtc gtttgatgtc aatctccgga     73920
     accagtacat taagaagaag gttgcaagac tggtgcacaa actgcttgag gaaggagttt     73980
     tatttgtgaa tctggttcat ctgttcatca acaagctggg agacaagaga gacatgtcgg     74040
     actatgtgat tgataagcta aatctgttgg ttcctgggaa tgaggagatg attctcgacg     74100
     ggatagaaga cttctacttc aaaaacgatc aatttaggtc gaggcatgtt gttctaaagt     74160
     tcctggcaaa catagactgg gagaacaagg taaaggcttt tgaagtattc gacaccatcc     74220
     tcagagattt caacgaaaat atccccgagg aacatcggaa cattctactg gaggacctaa     74280
     ttgtcgggct gggaaaaaac atgacagaca agaatgtctg caggacagac ataataagaa     74340
     aatcagtaca taccgagaag atgatattct atggggcaaa ggcattgtct aattccaagg     74400
     accccgaaat actcgtgttc ttcaaaaatg caatcaagtc gcatagaatg agaggttcga     74460
     aacttctacc ggagttcctt aatatgatcc atgagactgc atctatgcac agagatatcg     74520
     agttctatag atttctcttg gaaacatctc tcttatacac tccggagtat ataatatcga     74580
     tattgattat atgttctgag gctaggaagg agggactagg aggattcgac aacatttata     74640
     gtctccgggt gcttgcctta cactatcatg acgtggtgcg gaagcttagt cttcagctta     74700
     ttggcaacga gatgattctt ccatttgatc cattcgacag gatgagcctt ttaaatgccg     74760
     agatgatgtg tggggatctg tgatagcaca catggggatg aagagtcctg ttgacaggcc     74820
     ttggattgat ggagccagga ttggaatgtg ttttgaatat cctctagcct tctgataccg     74880
     attggtccat gtcttcacaa gtagatcgaa gtctaggaca cagatgggtg aaaataaaca     74940
     aaggaaagat acaggtagtc gtttccatat ccatcgtaga gctcttgggt ggatgcaaaa     75000
     gatatactac agatactctg tggagacggg aatctgtgtt ttggaatggt gggagtctgt     75060
     tcttgtcaac atttactttt tattgctgct gtcttcgcta atcaaacaga tagtaagaat     75120
     aggaatttat ttagccgata cattgatgaa gtggcatttc ctgggtagac cttagcaaga     75180
     aataaagctt atatttttcc tatctcctta agcattttaa acacaaacgg ctgtaatgca     75240
     taattggtat tcatcttttc gagaaccctg atggctttgg tcctttctcc cgatcccaag     75300
     agtatcctaa tgacgttctt cagtttgaac tctatgaagt cccccatctt tcttatttta     75360
     caagcagccc ttgtgatgtc ctttacgacc ctcatcaacc ttctcttatc acctccaaag     75420
     tgtgatataa gaaactcgtt ttccaagtgt gctagtgttt catcgtgatc gagtgttagg     75480
     tcagtgtctt ctgtccaaat gctgttgtat acaggtgtcc ggagaaacca aactcctgat     75540
     ttctttccaa ggaagtattc ctcacttggg aatgcagcaa caagaaagta ttttctgtct     75600
     aatctcagag atagcaaccc atcggtcctt ggaattactc ctttgaaagt cactttgcac     75660
     ttgtttatca gaagtattgt aaatgatccg tcggcttgga gatacatcag cttgctacca     75720
     aggacatcta ttgccacgac gtctccagca cagacaaacg gcatcgcaag gatcccagta     75780
     ttgagatggt acagctgtat ctttcctgtg tacagacata aatatttctt gtttatgcaa     75840
     agcatgtcta tgcttccgtg tatcctgtaa aactccttag gacctctttt gacagacaca     75900
     tgtgttcggt cttttccaac ttcgacttta aaatctccaa aggatttcgg catttggctt     75960
     cttgttgcca tcttggccaa cttcttgcag ctgtagttaa atatcgcaag atatgaatgg     76020
     ttggtttcaa cttccacccc ttctattttg tccttctcct cgggagtatc cgatgatatc     76080
     aatacaggtc ttacaacctt cttggagctt ttggccagac catccttact attgctttct     76140
     gcaggttctt tttttgctct ctcaaacata tctttgtttt ccatggagaa gaagacttca     76200
     ccagaaacat cctcttcttc ctcataaact ttgccaaact ctccctcctc cacatttatc     76260
     tgaaccacct ctcctccata cgaacataca aatagttttg tgccgctctc attccaacac     76320
     atgtcaagaa ccggtagctc tgttagattc ttgactaaga gaaacggctt tgaatacaat     76380
     gaacaccaca gagaaagact caaatcctga gatgatacag ctgcaacata gtatcttcta     76440
     tcttctttgt agagccttgg attaaaggct acaacttcgc atggggctgc atggccaata     76500
     aacgaacact cgttcttcaa atccttactg aaaacctcaa cagtgttgta atttctgttg     76560
     aatgacagtc ctgatgcaaa gaattctccg tcgggagtcc agcttgtacg ggaaaaaaaa     76620
     gactccagaa tcactccttc cgaagcatct attttcccca cctcctcaaa ctcttcatat     76680
     agaacaattc catcatctcc ttgtgtacac atgtacctga aactcctatc tgcagaaacc     76740
     ccctttatct gcccctcatg gggcttcatt ttcttaacaa cctcaaatga cttcaggtcg     76800
     taaaacacaa catatccatc atatccaaca ctcacaagaa acctatctgt ccacagcaca     76860
     ttgctgacat cactttcatg ctcacatgca gatgcaacaa catctccatc tattctgtac     76920
     acaaagacca ttccatcatc tcctccagaa gcaagcagtt tcccatcaac actaaatcta     76980
     acacacagaa cagttccttg gtgcttctta accgtcctga catgctcgtg cttttcgttc     77040
     cacagcttta tctccccatc aagagatgct gtagccatca atgttccaga aacatctatg     77100
     gaaaatatag gctttggcct cttcgtgcca tggccaatgt ctgtcctcga aatcttcatc     77160
     tcgatatagg gagacctaac tcatctttag ttaaaaaccc atcacaaaga aaccaaaaag     77220
     tttaatacca aattagaaac attcagtctc ttgaacctcc cttcttgcta gacacagaaa     77280
     agtcccctgg ggaaatatat gatttcattc ctccattctt tatcagccag tcatgtccga     77340
     caaagtgaag ctccgtatca ttgcaaattg catggtttat gtgcttgggg atgaccttct     77400
     tcttaccatc ggtgtttgcc acattctttg ccccatccgt gatctcactt atcaagtaca     77460
     tcacacatgc cgaaacacca ataagggcat cctttgatat cctcattctg gttctgtcct     77520
     tcatgatctt cttgatctgg cttaacttta caatgctttt ctgatgttct tcatctttcc     77580
     ccataactcg tggatctgcc tttcctcctt ttccttgtac cattgccatt ccttggggca     77640
     ctctctttgt ttatatattt tccttttgga gggaaataga tcttttggag ggaagttgtc     77700
     atcaaccttt tttacccaat cattcaaccc ttctcctttt tccagtctca tcactcgtca     77760
     ggttctcctt tccatagaaa accctcagga agttctgaac atccttcttc ttcagactgt     77820
     tgatttcaat cctcatggat ctttccttcc cctcgtactc attcataaaa tccacaaact     77880
     ccttaacctg ctgctccact accaccttct tccccttcac aggaatgaca tcaattgcaa     77940
     taaagaatgc cgtacacttc tttaagtcct gcattccata cttgatcttt ccaatgttct     78000
     cctctgcaac tctgaatgcc tttggaaacg gaatggcata gagtatgtcg tcaacagctt     78060
     caaacttaga cgcaaggatt cggactttcg actccacata tccttcccac tttggaaagc     78120
     cctcctcctc ggtggacatg gccaatatct cggcaaagag cttatacctg gagaagaaat     78180
     cagatagatc aaatatcttt ctgaagtcgt ttttctcggg acttgacaaa atctcatgag     78240
     cccgtgcaaa ctccatggaa atcacatgct gggtactgtt cgacacatta tgcgttgcac     78300
     acatcgaagg atatgcagga gttatcaccg gcatcctgtg atacttgtca gagggataca     78360
     cctttgggtc ccataccttc agattatagt tgagatccac cactggacgt aggaccacag     78420
     gtgtgggcca tttccatgat gaaaacaact caaagaactt gcagacaatg gaaaaggacg     78480
     acgcattcgg atatagctgg cagactctag ccacacacag cgaaaacgca actcccccaa     78540
     agtatccata gggatttcca tatacacacc ttctcttggc ccaatacttg atgcatctca     78600
     gtgccgaatg gaaagtattt acatttggaa caaggttcag catttcatct gtaactctag     78660
     aaccgttcag tgacaaaatg catttctcat ccatgctctt caggagcgtg tcgttgagca     78720
     agttgattcc atcctttaca acgggaacat taagcctagc aaagactaaa tcaattggaa     78780
     tcccttgaaa ctcgaattta attattggta caaatgcatc ctctatcttt gtaacttcct     78840
     ttatattcgg gtctcctttc aattcctcat agaagtgagt gaagaagtcg tttcttgtca     78900
     catgtctagg tacaatgcac aaggcgtcga tgtctgttcc ctttccatgc actcccaatc     78960
     tatagcttcc aaatgtaaat atctttcccc catatgcttt ttcgccgtcc ccacttcccc     79020
     tgccttttcc catcctcgcc acaaactctc tcaccatgaa gttgagcttt ccaagcaccc     79080
     tctcccttgt ctggccctcc ttgtcatcct caaagaatcc ccgctcctgc agatacatgt     79140
     ccatctcctc cgatagcttc atttccttct cggtactttc cttcatcgaa agaggaccag     79200
     tcactccgta cttgtagttc ctttcggata tctccatttt agaacccctc catctgcttt     79260
     ctttttatcc cttcccattc aagaggatcc aggcccgtct ttcaatcccc cctacacaca     79320
     atattaaaag acataaaaaa ctaaacactt taatatcctc ctctcagcct aaggaccaag     79380
     tggagagtag attccttttg gatgttgtag tcagacaagg ttcttccatc ctctagctgc     79440
     ttgcctgcaa aaataagcct ctgctgatct ggcggtatcc cttctttgtc ctgtatcttt     79500
     gcctttacat tctcaatact atccgatggc tcgacctcta gtgtgattgt ctttcctgtt     79560
     agggttttca cgaatatttg catttgtttg gggtattcaa acaaagcatt tttatatttt     79620
     gatgcaccaa tcacatcaag ttcttctgat gccatcatct aaccagaatt cttcggcacc     79680
     agacgaaaat gaagagatct gtagccgtct taaacatctg gacttcaaca gaccccttgt     79740
     gccggccata cacatcggag ctccatggat actcctctct gcctccatac aatgcaccca     79800
     caccttcctg cctgttacaa agtacagtta agagacaaaa aattttaccc tcaaatggtg     79860
     ctaggaaagg taaaaaagat cccggccatg gctccaaagc tgacgaagga acagaagatg     79920
     gagagagagc ttttgataaa aaagaagata agcaagctgg ccaatgcaat cagaattccc     79980
     ccggccatca atcagttcaa aaccttccta tcggaggatg atactaaaaa gttcgttgat     80040
     ctgttcatga agtacagacc ggaaaataag aaagagaaga tagctaggct aagttccgaa     80100
     gacccgaaga agggcccaaa gcccattctt gttaagtttg gtctgaagca cgtgacaagt     80160
     cttatcgaaa gcaaaaaggc aaagcttgtt cttatctccg catctgtcga tcccattgag     80220
     gttgtgatct tccttccaac gctgtgcaga aagatgggtg tgtcctatgc aattgtcgaa     80280
     aactccacca ttcttggaag gctcgtcaac ctgaagtcca catcatgtgt ctgtctgtgc     80340
     gacgcaaggc cagaagatga ggctgctttc aaggagatac aaggaattgc aaatgcaatc     80400
     ttcctcgaca actatgaaac ccatctgaga acctggggag gaggcccaaa gaagcaaaca     80460
     agtgaagagc aatgaaataa aacatttctt tattcaggaa ctcatgccag ccctcactcc     80520
     tcccgagtaa acaaaactga cattcctaca gctgccagga ttgcaaactt cactcctgga     80580
     atggtattga tccagagatt gatccatccg aaaaacggga tatatccaac aacaatggac     80640
     ttgatctctc ccctcgtaag gtaatttctc cctctcggat aaagagaaac atcgtcatca     80700
     agattgttgt ctccctttgt tagatatctt tctccaaact gcttgataca ccgatgaaca     80760
     catggaatct cccttccaaa cttaaaaaca gtcatatccc caacactaaa gtccttgttg     80820
     gcaagccaca gtatatcccc cttctcaaat cccggagaca tgctttcgct cagcacaaca     80880
     acaatgggac tgtcgttatt cagaagaatc gaaaacatct tccatatcat atatgtcccc     80940
     atcacagaat atgctgcatt cacaaactga acaagcttct gccgaatgct cattcttttc     81000
     agcattctga tgtccttctc ggaaataaga tactcaagca tcagggtgtg caaggttcac     81060
     tatttctctt tcctaatcct tacacaataa acaaaccata gaatgataga ataatttatt     81120
     attcctgctc ctgcctcaca ccccataaat cttgaagttc ccctcgtatc cgtacctctt     81180
     tatcatctcc atcgtcacat tatcaacctc gacactatcg acatcaagaa tcgactcctt     81240
     tggaatcaca ttctccttcc tttctctctc ttcttcgtgg ctcttgatgt agaccttgtt     81300
     gtacgttccc ttcaaaatct tcttgtaaag ggacgtgaga tatcctgcaa tctcattctt     81360
     cagcttcttc gactgcacaa cagccacgtc ttgcaccaca agcagattat ggtcaaacgt     81420
     gttgtcaagc ctctggaaat acttttctgc aatcgttcgc gctgccctct tgactatctt     81480
     gttcctaaca cagccctaaa attaaagctt ccacctacca ttcttggggt gaaaattttt     81540
     tctgcacaaa tctccctgca aaacacttca ctacctgtac tcaggcctca gctcatatgc     81600
     atttttcaag tccttcttgt tcagcacaca aatgtcagac acaatctcct ggataaatgc     81660
     aacaggctgc ccacagaagt ctgcaagatc cttcaccgtc catgacggat acttctcaaa     81720
     tgccttgaac accatgtcta tcacttcgtt ctttccaagt ctctctctct tcttatccat     81780
     tagcatcttc tttctcttgc gagcaagata ctcaagctct ctcaagcttc caaacttctc     81840
     tcctctcttc ccctccttaa gataatcaat gacttgtaca tcgctcttct tcgcatcgct     81900
     tttaaacccc gcttcttttt tgtacctcag atactcccca ttaatctccg gtgttatgta     81960
     gcattcgttg ttaatcactc cctcaacatc tgcattgttc tcataagccc ggattacata     82020
     catgctgtta tctctaggct tcaccttcac ctcaaacgaa gaaggaaatc ccccctcgca     82080
     aaattccttg gacagcttca agcttaaaac cgccggctcc gtggatgttg cttttgttat     82140
     gtcaagctct ccaattgtcg tctctccacc caaactcaat attctctctg ctagaaataa     82200
     agggaccttt gcaagccaaa tctttgtgtt tttgttgttt gtgttcaact ccatagaggg     82260
     cttgcctcat caagcattaa cttggtctat tccaaaatat ttatgaaatg attgatggta     82320
     cctatcaagt ttattaactc ctcccaaagc agctacttaa gacactactg gcggcggtaa     82380
     caagatcacc aagagcacca caatcacaac tgcaactaca cattctttcg gtggtctctg     82440
     ttccgttctc attagtagtg cttgtagaag caacgataac ttcggcactc aaaccaccat     82500
     cggtgccatc agacgggcca ggctgttctg taacaggatc ttggccacca gacccgctat     82560
     cagtaggttg atctccgtct tgaacggggc catgagacga accatcctgt gggctttgac     82620
     ctgaatcatt tcctccatca tgttgttctt cattatctgt aaatccagga ttacaacgac     82680
     caagtgatcc atcttcatta cttccataaa ctggtacctg aaaaattagt agcattattg     82740
     agattgacag aatgataccc ttcattgcaa atttttggag acgacttctt aaataccaat     82800
     taaaaatttt atccctaatg aagattttgg tcacaagaac agtaaagatc ccagagggct     82860
     gcattgtgaa gcaggagggg aaagtcttta cattcgaggg cccgaaggga aggatagtcg     82920
     aggactgtac tcgacatccg ctaacatttg atatctatga ggggaatgtc cgaatccgac     82980
     tctggaatgg aaagagaaag gctgcagctc ttgcaataac ggtcgagtct cttttgaaaa     83040
     atgcagtcaa ggccgtcaca gttggatttg catacactct gaaagcagca tacaaccatt     83100
     tttctataaa catggaggtc aaggaagatg gaaaagtcct ccttgtgaag aactttcttg     83160
     gagagaagaa catcaaggtg tttaggatgc gtggagtggc aagggttaga ctggacgaaa     83220
     ggaaggatac aatagtgatt gagggcccat ctctgccgga tgtttcccag agtgcaggga     83280
     caatctccaa cgaatgcaag gctaagaacc gagacagcag agtgttcctt gacggaatct     83340
     ttgttacaga gagaggcatc atggcttgag taaaggtcgt actttatttt atatttagtt     83400
     tttgaaatgc tattttttct gagcctattc tttaagatct caaccctctc agttggcctg     83460
     ggcttctttt ttcttggcct ttgtggtgtg gctttcgaag gaaacttcac tttcaagcag     83520
     ggttgcgtgt ctttcgatgt attccagatc gctttccttg tttgcctcct gtcctgtcag     83580
     gattctgtct ttgatgaaga agtcttctct tctcttcctt atatcaagta tctttggaat     83640
     gctggaaagc gtcttttgca cctctttgcg gtcgtatatg cgcggctcgt tgaggcggtg     83700
     ctcgaactcc aggatggggt cgttacaaag ctccttgttg gccatctttc tcgatatctt     83760
     tgtccatttg actttccttg gattgacacg tctctcaaag agttttctgc actttgatct     83820
     gcagaatcta aagacttttg catcgttccg gacatagact gttccatggc cttggtatat     83880
     atttgacgag cagaaccagc acttttcaat cctcatttta cccctccatc catctggaat     83940
     ttctatacag ttgtcccaaa tattttaatt aaacagcaat agaagacacc tctccagtct     84000
     tcgtctttac cttggcaata atctcaaaga gctcattcct attcattacc acatatcccc     84060
     cgagtctttc tctcctgtgg aagagctcag aggagattgg agggtcgtct gttgtcacga     84120
     taaatctatc ctcgagatat ccctgaaaaa taatcatctg cctgaaagag ggactgtacc     84180
     ttcttcttat gtacatgtcg aaatagtgct cgaaaaggtg taccagaacg cctattgcca     84240
     ttcccttcag agtctcggaa atgttgatcc tgaagaggag gatatttcca agtttccgga     84300
     tgttggcaag gctgtctctg tatatccaga taagttcgtg gtgaatctta atactttctt     84360
     tcattcccag aacctctcta cttgacagac acagaaaagc gtctactcta gcgcctttta     84420
     gcagatgatg gcatatcaga aagaagtttt ctatggggga tacctcgatg ccatatccaa     84480
     tcttttttac aaagcatttc ctttttcgga agtgtgactc tatcaatgct tttgtgctgt     84540
     atccaaggtt cccatacagt tcatatgagg cctctctgga aatccctttt cttgcaaggt     84600
     actcacagat tctttgggcc tcagcgcttt tgttcttctt gtagtatatc ttgttgctga     84660
     caacaaatgg aatatcattc tgaagtgctg aaaacaggga cgtaaagttc agaaaggaaa     84720
     tacaaggtct ttcgacgtaa tacagcccat cggtgtctgt caaaacaccg gccctttgga     84780
     tctcaaacac gagatctgca tgtagctctc gacaacctgc acatatgctg tctgagaagt     84840
     tgctttcatt ctctagatca tcgaccggcg tgaggtcctt tgtaaatatt ctgtggaacc     84900
     caaagcacac gatcatggcc catagaacat cggtagtgac gtagttcata gcctttgcta     84960
     gggagtatgc cagcatgcat gaatgaatcc agttgggctt gcaggtgcat acaaaccagg     85020
     agccttggag cgaagagttt tcttggccac aaagagaaag gaaattctta cattctctgg     85080
     gatccaggtc tatgaacaca tttaaatctt ggtcggagtg gtgctctacc ttttcaggct     85140
     gaaaatccat ttcaaatctg ataagttctt tgtggaggat ttctgtaata atcttagctg     85200
     cacatacact cgaaggaatg tctgggatga atatccttac cgacctgtat gacttgaact     85260
     tgttgatgat gccaatagga ttccctatat caagcatctg ccctgaattg tggatatttt     85320
     ttattgaatg actgaatagg attgtaaagc cataaaggct gttcaaaggt gtgtgtggga     85380
     gagcatcagg ggttttccac ggattagcaa cccttctgaa tgaatagata cttctgccgg     85440
     gagattttgc ttcttgaaga gataacaaca gagctcttgg gatccaagga aatggatgag     85500
     gagacaaccc acaaggccaa gctgctgcta acaataaagg acaagctcaa tgagaagatg     85560
     atggagatgg aggagtacta tatgaagaga atagagttct acagggaaaa tgatgggaca     85620
     agggcaaagg aattggagaa acagacagaa gaatgcaacg agaagtatct agggcttctg     85680
     atacgagcaa aggagctcgg acatcagata gaaagacttg agataaaggg ccttcgaaat     85740
     aaatcttgtg ccggaaatga gttgtgagag gctatcttgc aattttccta tattggaata     85800
     aggggaagag cgaagcaggg taagagagtc cttcggcgca gaagtgagta aaacaagtga     85860
     ttttgagcag aaaactttga ttctgcctgt ctacggttct ttgggggaag ccaagagaag     85920
     ggtctccttt tacccttttg caccctgtga taaaatataa aaagaagagg gaaagagggg     85980
     ttgaatggca ggcgagaggg ccgaatacgg cgggattgcc ggtggacaag aattaattta     86040
     tcatttccaa gaagacagcg atgatcttgg ggttgagaag gagtatgagg agaacgagcc     86100
     caactctctt aggctccgaa attttgtaga ggacgagctg tatcagtctg acggacaaat     86160
     gcagtataga ggggaggacg aaatgaggct tcggtatggg cgcaagaaga aggagaagag     86220
     aaagaagaag aagaatgatg aaaacaaaag gccatcgaat aggaagatag tgaatcttcc     86280
     tgcgtctcct ccttatgtac ggtttgtaga cggagaggaa agactatgct tcaagtatgt     86340
     aacgaaggtc agcgagtcgg cacgtgatgc gatgcccaag acagatctgg aggataatga     86400
     gttctgtgta agatttgatc ttgacagcgt ggacatcagc aaattgaacg aaaagttcaa     86460
     agcagacaac tgtgtgtatc ccagggcaaa tctcccctat gagatgtata ctggaaacag     86520
     atggggattt gagacggaat gcaaccgact ggcatggcag tttgtttcgt tgaatcctgt     86580
     tcttctgtat ggaaagaagg gacttatcca gagagccgtc gactcttaca gaacaatcaa     86640
     caagcagagc agaaataaga ggattgtcaa ggaagatcgg tttcctagcg acattgagaa     86700
     gaggaagcat gtttctggag caccctcgac gatcacgatt caatggacca acagagggat     86760
     tttgaaaaaa tgtaaaatcc aagttaacat cgaaaacata aactatggga agatcgacga     86820
     tgaattcaag tcgaggtttt ctgtatttat ggacgatttt gatgacaagt cgtttgggaa     86880
     gagcaagtgg gaaagccaca acgtagataa cgagcttgca gtaaagatag cttttctcaa     86940
     tgttgagaac acgtcgtttt ggaatgccat caaggcgctt gataagacaa ctgtgctcaa     87000
     gaaggcaatt gaagcatata aacaaaagag agatgagtat gcaagctccg atgatgacac     87060
     cgagatgtct gatgttattg caagcgcgct tgggagcagt ctgggaaact caaagagctg     87120
     taatgttgag aatttttatt ttgataatta gtcatgaatt tgtcttgaat aaatgatatt     87180
     gtggagaatg tgcattcaat tgttatgaaa ctgtgtttta agatgtttat agtttttggt     87240
     ataaaggctt ttcttgctgt aaacaatact atgctacttg tgtatcttct gggctgcctt     87300
     gccgagatag tggagcaatg caagcctatc aacgagggat atgtactcag taagtacttt     87360
     gctcagtggt gcccggcgtg ccaaaacatg gggccgctta tagaggagat cagtaacaag     87420
     atagacaggc acgaagcaaa tctaaaaata agaagtgttg actgtgatga atgttcttgt     87480
     ccaaatgtca aaagttaccc gacgctggag atgtctaagg atggagagac tcttggaaag     87540
     ctggagggtc ctcaggatta tgacgaaata attgagttta ttgtaaacca tactggaatc     87600
     gagagaagcg tgtttgaagg acatgccgca cagaaggagg ccgaggttag gaggttgaat     87660
     aagaatgact tcctcagtgg gtttgatggt cctcatattg ttctgttcta ttccagagag     87720
     gacgacaaat acagagaaat atttaaggag attgcaaaga tctataatgg aaagctgaat     87780
     gtcggggaga tcgacagtgc agagtctgca gagtttgtca atagatatga catcaggtct     87840
     tatccctcga tatctggaat ctataacgga ttggttgttc ctttcataga gaaagggaaa     87900
     gagcccagca tgcccaactt gattgagttc tgcgacaagc tcatcgaaca gtcgttcgcc     87960
     aatctgaccc ttgccaagtt tggagagcta gcatcgaagc ttgagcctgg agagcctatc     88020
     tatgtggtct tccataagaa ccttgcgctg gccaatgcat acttccagag gatggcccac     88080
     atgtacaagt tccgggccag tatatacagg tcagatgacc aggctctatt tgaaaaggca     88140
     tccatattcc ctaaggagct aggctctggc tcagacacaa cctccagccc caaccatgaa     88200
     gatgttgtca ttctctctgt gtataagaac ggggtctttt acagatactc agataccttt     88260
     ggagatgaga caaagataac agattggata ttccacaccc actacaggta tttaacaaga     88320
     atcgacaatc acaacttcta ctccatattc catggcctca agcctgtaat gatacttctg     88380
     acaagaggag aggagctagt aaacaagatg aacgagttta gtgcagacag acacctaggg     88440
     gttccataca cagacatgat atttgctacc atggagatcg acgagtatcc tctctttgtc     88500
     ccgacacttc tcccaagact ttccactcct gcattgattg tgtttgaacc ctggagaaat     88560
     ctattccgcc acaaaaaggc caagctcaca gaagacaact tcatttctac agcaatggat     88620
     acctacactc tgtaccaaaa caaccgcctt ccgctttacc cgccaaaatc acacaatgtt     88680
     ttgaagtact gtttgctcgg tgggctagtt ctcggagtcg gattgtacta ctcctccaag     88740
     gctggctttg caaagaagaa caaataaaac ctctttgaca tatattattt tgagagaaaa     88800
     acaaaacgga gaagcctcgt ccatcgatga agttgattta cattctagga gatctgctta     88860
     tctcgtattg gaaagacatc ctaaaggtag tcatagaaac actcgtaatt tacctagtgg     88920
     ttcgatttag atatcgctcc aataaggatg ttatcatttt tccacagaat gtaattgata     88980
     aacttgtggc tgagtttgat cccgacgact tggtgaaaga cgtccccagc gatgtgatgc     89040
     tgcccagcgt gtacaaggaa gggatggttg atctggcaaa cttcgatgtg tttgggttgg     89100
     caatggaaaa caagaaagag attgtcgagg ccataagaaa atatggagtt gggacttgtg     89160
     ggcctcgggg attctatggg actctggaca ttcacctgga ccttgagagg accattagca     89220
     gggagcttgg tgcagaggct tccattgtgt atccaaacag cttcatagct gtcaacagta     89280
     tcattgcgtg cttctgcaag cagcaggaca ttgtgtttta ccacgaggac tgtaacgagg     89340
     ctattcttag ggggatcggg ctgtcgaagt cgaagaatat tgaatttgca agcatctcgg     89400
     acctggagat aaagctggag tatttcacga ggccgaaggt aaggaacttt gtgattattg     89460
     aaggcctttc aaaaaacaca ggaaagattg tagacattaa aaagatattg gaactcagag     89520
     acaaatacaa gttcaggatt atcttggatg agtcctatgc cattcccctg ctcaacaaaa     89580
     gaggagtctg cggggcaaat ggagtaagta ttaaggagat cgacattacc attggatctc     89640
     tgtccggggg actctgttgt ggtggagcat tctccttagg gacttatcac gctgtagatt     89700
     accagaagct gtctggatct tcctactgtt tctcggcgtc tctgccagga gccttagcta     89760
     aggctgcaat cctgaacatt cagagggagt tcgactatga gggattgaga aacagagtgg     89820
     agttgtttca tgcaactttt gagtccaaga catatgagat tatgtcttct cctctatcac     89880
     ccatagtgat tgttgtaaag aagagagaag taaggaggcc aatgtctagg gaggcactgc     89940
     taaaggaagt cctagatata agaagtgagc ttttaaagaa tggaattatt gttggattca     90000
     accacaatcc atatccttcc ctaagaattt gtctgaaggc caagatccca agggacgatg     90060
     ttacaaggct cgcagtcatg ttgaataaat ggtaaccaaa atctgtttta tttcttggaa     90120
     catacatctg tgtcatacca tggccttctt ggcagggaac tttataagat ccacaatctt     90180
     caacatcttc gatgctagag aagacatctc tgtgtctaac agaatttcca tcagccccgt     90240
     gaaaatagtc atctgggagt ggtcgtactg gcctaagatg tcatagagac acctatcagc     90300
     tgcctccgga acctcagaaa ggttgctgct gaatatcaag gagttcagat ggaccagact     90360
     gctatgcatc cacaaggggt ggtgagagta gaataaagaa atatttgcag tatgaatcct     90420
     taaatgggaa tctgcaggaa caaggacttt gtaatagtct ctgagaaaaa cgaaattcta     90480
     atgatggata ttatgacact ctctgtgttc cacagaagag aatgtggagt taactcacct     90540
     gtggcatgca gcaacgagta tgtatttatt ggagatggat gtggggttat ggcactgggt     90600
     cttctcgatc tgaaggaaag ggaggtatgc agaatgaaaa cacctgtaac tgccattttc     90660
     cacctggatg ggtttatata ttgtggaagt gaagagggaa ctatctatgt ttatggagga     90720
     gggagaaaag aagatggaga tgtgggtgag ggaaaggatt ccatggattt tctagggtct     90780
     gagctttcaa acgagatgtt ttctatggat gacgggggat ttaagcttgt gaaaaccatg     90840
     aaacatcctg ggccggtgac tcaaatttgt agtgatggga cagaagtgtt tgtggcggat     90900
     atgaggaaca aagtaacggt ctatccatcc aagaaaacct atgacatcaa aaaccctaag     90960
     cttgcttaca agaattacat atttgcaagc gaaaggaaca tgctttattg caaaacgcga     91020
     aatgcatttg caacctacct gacaacggag aaaccgataa gtggctacac cttcagcatg     91080
     aatggaggag ttttatttgc acagtgtaga gataccgtgg atgttgttga cttcaatacc     91140
     aagaaagttg taaagaaggt ggaggttgca gggaagtttg tatatgatga tgttagagac     91200
     aggttggtgt ggtttgatgg aaaaagactt gtagctgttg agaatgttct cgagagggaa     91260
     tataagggga tggatgggat aatgtttaga gaggatggac ttgtcgagaa gaagatcaag     91320
     attgatgaag aaatggatga gaatattgta gagaaataca gagaagatgg attgtggaag     91380
     aagcctccga aaaggaagta ttttagagca tcgtcggagg gagagaatgg attaggagaa     91440
     ggaggggaag agaaaaaaga agtggttgat cctgacgaat gggtggaaga agcgaagaca     91500
     aaaggaaagg atagtcttgg gagatccaag ttagaagcag aacctgggag tcttctatgc     91560
     tataataccg agggctatat gacttgtatt ggggatgaag aaagaggtag aatagaaatc     91620
     aactaccatg atgtttctcg aagaagaatc gaggtggatg gtatccaggg atgtactata     91680
     ggaagttttt gccaagataa cattatagta ggaaatggga agaagatctt ttatatcggg     91740
     ccatcctctc gatgggagaa agaagttgag gcaagtattg tttccgtgtc tgagaagatg     91800
     gtggtttcct tctctggaga gcttcgggtc tttggccttg acgggtccga gatgcttaac     91860
     tgtcttattc cagatgtaag tgccatatgt tgccgttccg atatcattgt ggtgttttca     91920
     cgagagataa ttgtgattga tctgtttaaa tcaaccgaaa gattctttct tccatctcca     91980
     gtggactttg cttgcttcga tgaaggtgaa aaggtttttt acagaatcaa cgggaaaatg     92040
     taccagcttt ataagggact ttctgttagg gtgtgtgaag ccccgaaaca accgctagct     92100
     gtgttcaagg ggaatgtgat ttccttaggg ccttccagaa ggttgtttcc atctccacat     92160
     gttgaataca cccaattcga tgtatttgat ccatgcaggt ccaaggagcc gatgggttct     92220
     actgaagatg aagaagtcct ctgcagtgaa gattatgaga acaagaatgt agaggtgagt     92280
     aagagcaaga ggtacaaccc ccttaagaaa taaatggctt taaattctct atgaaccagg     92340
     atgcaaggtc tgtatgtggt gttggttatt ggaggactta taaggtggta tggtctagtg     92400
     gtatgacgct tgcttagggt gcaagaggtc ttgggttcga gtcccaatac cgcccttttg     92460
     cttgtgcttc caaacacagg ggaaagaatt cttctgttct ctctaaaata tccaattaat     92520
     ttattttcga gtctccttgg acttcttgtt aaacttctcg gtatagaact tcagctcgct     92580
     tccctgcaga acatgtccca gagctgctcc tgcctgccca ggtcttgagg tgatgattcc     92640
     atatagatgt cctttttcaa aattctcatg caactcagga tcagtgctgc ttcctatcgt     92700
     ctcgatatcc tctttgaatg gttctgcctc aatcttaaca acagagctct tcgttagagt     92760
     attggtacga acaagatcgt tggagctggg atggtacaca acctgcagaa gcttggatgc     92820
     tctagtcttc ccagtgctgg ggaatcgaaa gtacccaaca tccagcctca aagccttata     92880
     tttcttgttt ccacctctca ctctaacagg aatcaccctc ctttccccta tctttgttgc     92940
     actcggctga gatcctgccc tgttgttgcg cttcttgcgg ctgattacag cctttgctcc     93000
     cgtcttccta cgcttgtggt ctcctcgatg gtttattcct aaaattaatc ttccttcgga     93060
     gatcacttac ccatttcagg gcaaattttt tctgctctct ttattggagt ctgcctcgct     93120
     ttcattcggc tcctcagggt tctgagatgt gctgggcaca agtacttcca tagtcttctt     93180
     tccaagttct gccatctcat ttccagttgc ttccatcgcc tccttgatgg tttccatgtc     93240
     aagcttcaat atcttgtctc tacgcagtcc catgataaag gcagtaagag acgctaagaa     93300
     cacggttgtt ataaaagcca tcttcagcgt catcaaaaaa aatatacctt ccaaagataa     93360
     atacttccta tccaatcatt tttctctgtt tcttacacca gaggtctctg aaacagactc     93420
     atctgacttc aagaacaaag atttctttta tggcaaggct cggtggattc agaaagtaga     93480
     aggaatatca gatgttattg tatgttgggc accgaagatc tttgcatgct acgcttgtga     93540
     gtattggttc tataccatct gctgcagctt ttttagtaat tctgaccaaa gaatatcaaa     93600
     gggaggattc cattgtttct actgccgtgg agttcattac aaagaccttc ccgatccttt     93660
     tccaggagga ttcttggggc agtctacaga aggaagttcc aaaacaagga atagttcttt     93720
     accaggctga ggatgaccga gcagcaatcc ataaagcact ctagggaaat ggatgaagga     93780
     agatccatcc aagtcgtgga aaggagtaga gccatgtcct acgagatgac aaaaacccag     93840
     gggacaaagg ctaagaggca ttcggtaatt aatcaaagat aaaatataaa aattgcatag     93900
     aataaagtgg tttatatctc atcggcctca accttgtaga gcttgacaaa cacatgggtc     93960
     ccgagctgct ttgggttcaa gttccttgtg aatttagcac ggaccgctcc agaattcccg     94020
     tgtatcctgg ttactactcc atggacaggg tatttttccc cttcagtgct tgtcttgaag     94080
     cagacaactc cgttgcccac atacttctca gcctcaatct tgcttcccac gttgttgatc     94140
     ttcagaagag catatcttgg atgaagtctc ctcagccctc tcttgaagga aacaaatgtt     94200
     gcagggatcg ttgtacggct caacacctct tcactcatta ttggtttaga cataacgagg     94260
     gatcaaaatt tttgttttca aatgattact ggaaggacag agtatttgta attgaataca     94320
     ggttgcacac aagccctttc tcttctgtgc ttttgttagg aacatacttc ttcttaacct     94380
     cctcaagagc tgccttaagg atccttggct taacctcctt gggaaggtcc ttcttcgaga     94440
     acttagtctt tgtgaagttg aagaagaatg catgttcata cactgccagc atggcatcat     94500
     caacatactc tagggtgtcg atgttcttgg ccttgtacct gagatattct cttttaatcc     94560
     tttcgtagtc gcagacaagg tgctttgtgg agagctcctg gatgtagttc ctcttcattt     94620
     aatgttgggc tggcgttatg gccactgaat ttgttacatg atggaaaccc ctagaatgga     94680
     ggagctgtat aggaaatttt cagagactct aagagaaaac acatcgctaa gacatcagat     94740
     tgtcgatctc gaatctgcct tgagctcgaa ggagcaggag ctattgatgg ccaaagaatc     94800
     ttcaggctta ggtcaatact tgaggaggat agagtctttg gagcgagaaa ataagaggtt     94860
     gaaagacatg gtagagaggg cagggcagga caactgtgag ggtgagaata taaacccaaa     94920
     cgcgatcatg agtgaagaga aaacagagaa tggaacccat agaagtgaga ctaaagatcc     94980
     tagtggagag ctgcgccaat accttaagac aataagagaa tatgtcacag gccttacagg     95040
     gtacaaaatg gaattccggg atggggaaat catcttccat tccctctatg cctttgacag     95100
     cgaggatgtt tttatcttcc gatacaagtc tggaaacatg gagctcgtta acaacgactt     95160
     tgccgcttca tgggccacag aggtacaaaa ctacctgatt gcaggaaagt ccattcctgc     95220
     attccttgca gcggtcaccc tagaactctt caacaagaag acatttggat agagcaatgt     95280
     gttttaattc aaataaaaac taaccgctaa agcatccggc cgcttattgg atacacttga     95340
     ggagatccac tattttgtcg ggcttcaagt tggagaggac gttgttttgt tggcttatct     95400
     tcgggaggct ttccataaac tcgtccagga gccttgagtt gtctttgatc ttcagatcga     95460
     ggaagttgaa tgaattaagg aagcaatggt atcttccaag aatcccttcc atttgtatat     95520
     ccttctccct ctcgggaaga gcaggaagaa ttgcattgtc cttaatcgag ctcatcttct     95580
     ggtcaacgag ctctctgaac agctccatgc tcccgatcat aaactcgtat tctatcatcg     95640
     agtcccacat tcgggacgtc ttctcaagcc tcttaaacaa ggctcttgca ttttcctcat     95700
     ctcctatccg gagcagaaac aagaaaaatt gctcctttag caaggtggag tctggatgct     95760
     tcaggagacc cgaggagaag atattgtagg gtgttgttcg gcttcctgtt gcataatact     95820
     cgacaaatgc gcagtatatg aagacatgag gccctattcc ctcgttccca acttcaataa     95880
     ataacttcct gaaagattca agaccccttt tcttcaggac atagttcaga tggttgattc     95940
     ttaacagatc cgcttctctt ccagaagact tcccgccatc ctcattctcc tggtagaaat     96000
     acttcttttt cagatctcca taaacttcct cctcatccat cacaagccca tagtaaagag     96060
     acagaaacat cccatcgctc atctcaatcc ctctctgaat caccttcttg gccttctctt     96120
     tctgtccaat gcctatcaga tattcactat agaagaagta ggcttcttct gcataataga     96180
     atgaatctag gatgtaattg tatataaagt gcatcctaga ctcatgagtt cttcccccaa     96240
     gcttcattcc gttttccatc tccagatcta ttagctttgc tgcattcttc acactccagg     96300
     accttatcag cggttgcatc tgctgatacc tttggaacga actctggaaa ataggaaggg     96360
     tgtcgcttac tatcttcttt cctgtaattt tgttgagctc tagctcaaag ttctcaaagt     96420
     ccttccatag ctcgcttaag gaactcatcg gcgtttgcag cgctctcatg tatccatttc     96480
     ttatcttttc tatccttgtc tgttcatcct cgatctttcc aagctcttca atgtattcct     96540
     tgtacagtcc atacgagtcc cagtaattct caaactgccc taacgtaaac tcatacacct     96600
     catacaactt aaatttcttc tggctgacct ttcggacata ctcgatgtat agcatccaga     96660
     gctccaagtt gtatgacttc ttcaaacact ttccaaacag actttcaaga ctcctatagt     96720
     ccttcgatgt atacagatct cttgcatgct ccataatagc tgaaggactg cccatttcaa     96780
     tccctgtttt ctcttctaca tccatccggg gtcaaaattc ccccaatata actcttgttc     96840
     taaaatcatt ggaaaaggaa tcatttattc ttgtccaaaa actccatggc ctttatcccg     96900
     catatggccc ctgaagctgc agccgtcaca gcctggcggt acttcctatc gcagacatct     96960
     cctgctgcaa aaaggcccgg aacacttgtg catgcatcgt ccttcacaac aatgtatccg     97020
     ttggaatcca gatctacatt tacactcttc agaaacgaag tgttcggatc atggcctatt     97080
     ccaaagaaca ccccatccat cggaattgtc tttgtctccc ccgtctcggt attgcggaca     97140
     acaatctctt taatcttgtt ggttccctct gcacgctcca gaacataggg cgtcattatc     97200
     tcgatgttct ctgtgttcct agccttctca atcatgtcgc tccttgcacg gaactcattc     97260
     cttcggtgga tgatgtagac tttcttggca atgtttgaaa gataaagccc ctcctccatg     97320
     gctgcatctc cccctccaat cacacaggtg actttgttta cgtaaataaa cccatcgcac     97380
     actgcacacg agctcacacc tttctgccag aactcgtcat ctcctgttcc aggtacaaaa     97440
     agccgtcttg cagaggcccc tgtggcaaca ataacaatcc ttgccttttt ctctcctttc     97500
     tcactggaaa ccacaaacca ctcatcctcc ttcctcacgt ccgaaaccgt ctccttgaca     97560
     acccggagtc ccctcgagac tgcatgttct ttcatcagct gggtgagttc tggcccctca     97620
     attccccccg gaaaccctgg atagttatct accgacgttg ttgtggtaag ttggcctcct     97680
     ggcccattat ttcctatgta ccctccctca aaaagcaaag ggtttcccct catcgtatac     97740
     agtgctgcat tataggctgc tggcccactt cctataataa caatgttttc cattggggct     97800
     tgatcccgtc cgaacaatat ctcgctaggt cttccaataa ttaaggctag atcattctac     97860
     cttcttcagc tccttgtctg tttccctaat cacctttgag gatctttcat taatcatcga     97920
     tatgtcgttc acaatgctct tatgcctggc tgcttcctta ttctgcttgt ctgcctctac     97980
     ccttatctgc ctcaccgtgt tcaacactcc aaccatctcc cggtcagttt tgttctgccc     98040
     ttttatgtac tcttctcctt cttcaaactc cacgtgcttg ggtgcttgct ctacatcgtt     98100
     ttcttcctcc tgccccctat tcacaatatc atcaattcct cctctatctc ttcgaaacca     98160
     tctctttatc gcacgcacac atggaagttc acagctgaac actcttcctt ctcgctcaat     98220
     gtcctccgta atctcagatc ccctcctagc attcacattt atcccaaccg ccgctctctt     98280
     tgcattctcc agggtctctc cttgcctcat aagctcctcc gtcgtagcct tctgcttgag     98340
     agcagactcg tcaagctgca ttcgaacccc ttttgccctt tcgtagttct gctcctcaat     98400
     cctttccgcc tcttcaatca catcctgtgg gacccccttc ttcttcttgc tcttcacagc     98460
     cttgtccagt gagtagacat ctcctcccat cggattgttt atttctacgt tttaaaaact     98520
     atcctccaag gaaaacatct tagtagccta aacatagaaa acaaacattt aatctcatat     98580
     catcttcttc ttctggaaaa acttcttgag agagtacagc tcgtatgaat tcactccgaa     98640
     gtagataaca agagttatca ccgaaaacac cgtcacaaag gaaaacatcc ttctgtgctc     98700
     gtagtcaaca ctccccatcc tgtgtgcaag atactcagac tcgttgttga gctcgtaaag     98760
     caggttgtcc agctttgtca ttgctgccat ggctggctcc acactgactt tctttgcaac     98820
     gtccttcttg aatgtgtcaa actgagcact aaagttgagc tctatctctc caaacgtatg     98880
     gggctgcgtc tcatcaatca caataggcgt taataccatc gacagcacct ttggctcgct     98940
     tatattgaat gaaaaatgtg tctctgtatc cacaggaagg ttttcgtttg acaggtagac     99000
     acttccactc tcagatgcca atacagcctt aaagctagag tttttacaat tgatcggctt     99060
     gagatatcct ttgcagatct tgttttcaat cacatcaaac tcaacctcga tgtttctttt     99120
     ccgccttaca gagaagatct ctgcaaatat tatcccaaga tataggacaa aaatcatggg     99180
     ttgtttgggt ataaggtatt tctatctcat tccttatttg gcaagggata cacaaggttc     99240
     atatgatgat ctagatttcc ctgaactccc cctccctaag ccttactgca gagggtcctt     99300
     cgacatgctc tccatctctc accactatac agtgttctcc cttgtacttc atggcttcaa     99360
     acctaatccc atccttggac acatatccat acacactttg tagaattcca cagatcattt     99420
     ccaggcattc ctcttctttt cctgtgtact gaagtaacgg gagccttccc agactgatga     99480
     taccttgatt gtgtgtgggg tggaacgaga agtagtatgg aaagaaagac tccgatatgt     99540
     cttttgatac ttctcctaaa cccataggct tttccggctt gccagtgaag aaaaagtcgt     99600
     ctgccatcct ttcaccgatc ctctttccaa ttgtaaataa cctctctcta cttccttctg     99660
     gcccatcctt tatgactttg ttgatgaatg atgtatacat caatccaaag acgtcatggt     99720
     tcactttctg gccatcctcc ctagacattc agggctagtc tgcaaaccct caatacaaga     99780
     tgcagagcag tagccacagg gccggaaaag acgcctccca ggaaggtctg gagtctgtgg     99840
     agtttctcga ccatcttgca gatatccaaa tgcattgcac ggcaaccagc cttccggctc     99900
     tgtatgaggt ggctgtgaaa gggatgatga gctatgcagt aagaatacca ccggcggccc     99960
     aagggaccgg aagagttgag ctacaggaag gatcttccga aatgaacatg gtgggacttc    100020
     taacatattt cattgatatg atgtatggag aaggccttgt tgtctccgaa gtctctgtac    100080
     agctaaagga tggccatctt ttttgcgact attccgtggc aagcggatcc gaatgccaaa    100140
     gcctctgtga aatcaaagca gttactttat gtggtttgaa aatatttgag gaggagaatg    100200
     tgttccatct ctactgcatc ttcgatgttt gacttcctct tggtcggagg acaaaagaag    100260
     taaatccttt attaatgatt aaataaaccc aagggaattg gtcatttctt ctccggttgc    100320
     ccagtctctg taacctctat gaagttgtag ttcaggagat ctgtaggagg ctttgtctct    100380
     ttctcttcct tttcagggcc ctggagtctt ttcaaagttg tctggaatcg gctccttaga    100440
     gactccagat cctttgagat cttctccaag gctttaagtt cttctcctat ctcttttatc    100500
     tcggcgcggg ttagagagat ctctttcttc gggctcaacg gcttgaggag aaatgatgca    100560
     gagatcggag tttcaaaagt aagctccgac tggacttcag gcttgggggc atcatccgag    100620
     actgtttttg actcgtgata cctcgaagga gttgtttttt tctcgacttc gctaagaata    100680
     ctcggcagct tctgctccgc atttgaattc aagaccacat ttttcttccc agagtcctcc    100740
     tcaaccacta tcacagtctt cttcctgggg gcgggattct ctaaatcttt ggaatgagat    100800
     ggactgtgct ttcccttggt aggcaggagt ctgtgatgct catccttcac agcaacctcc    100860
     aaaaactttt tgaagatgtt atctgtggac ttggtggaag agtcctctgc actgcagaac    100920
     acactaaagg tcaaggtcat cgagaccatc agaagcctca ttatttacaa actgtctttt    100980
     gaatttgtag cttaatcaaa aacctgtttc aaagggtggt tgggatgttg atatgtaagc    101040
     agcagtagac ccacgataat ggattttgtt cctccagcca agcagagaga gctgaggtct    101100
     gcactcgaga agatagagtc cggcatagtg gtggtccacg ggcctccggg gtcttcgaag    101160
     acttacagca tagagaggac ggctcagggc ttgggcttgt ccatagaata tatcgaagat    101220
     gtcgggatgt acaaaagtat gcttcccatc cggaatgcca tatgtcttac agacatggat    101280
     gactatgaat acttgtccag gcatagaaaa agactggaga aaatgaagaa cttggtgatt    101340
     gagactagaa cattgttctc cattgggaaa atacttccaa atgccaccat tgtgaatttc    101400
     ggaaagatct caagtaggaa gatccagaag ttttacaatc taaatgaaaa ggaggctttg    101460
     aaggtgggag aaaacctcca tgctgttggg ttctgtaagt atggtataag aagcgagact    101520
     gtttcaatat tccatctact tggaaagctg ttccactcga aagaaacaga tgtcccaaag    101580
     gctgccgaaa tgatcaatgt gtatgggcga gaccgattta ttgggtattt gatcgagaac    101640
     tgcacatctt tcatgtctat taaagacatt cacaagctta tcgatggaat tagccttgag    101700
     gacataggag aaatgcatct ggagcatttg atttgggtgg ttttgagctc ggtgaaggta    101760
     ggcccaagga ggtttttcag cttccggtcg tggaaggggg ccgtcttaag tgagcacaca    101820
     tgtagcaacc tttgcatgaa cagatagtgt acatttgtac ccaaggctgg ggaggactaa    101880
     agataacttg taaacaatga tccctggcaa tgagtttttc caagatcaag ccgaagtctt    101940
     acgagggaaa aatggaagag tggttgtctg caatcagcat gaaggttact gacctgaaca    102000
     gtctggttct cgactacctg gtccatgagg gactagggga tattgcagca gagtttgcaa    102060
     gagatgttgg attgcctttt actgcatctt catttctgag ccatagaaca cggataagag    102120
     atgcaattga agagggagat atcaagaaag ccatatcgag gataaacgat ctgaacacgg    102180
     agataattga tgggaatatt gagctgtact atttccttat ggaacagaag gcatgcgaac    102240
     aagcacaagc gataagaagc gaaggagaaa gcacagagga gcagaaggtg tttattctcc    102300
     ttgaagaagt tcttgagttt atacgttctg agctgtcgcc gattgttgag gaaaacccag    102360
     ccttggggcc gcactttgag gacctccttg agtttgttgt gttcaactct cggaaagagg    102420
     ctgtggtgga gaggaggagg aggttggcag agtatatcaa caggaatata ctggagaagt    102480
     acgaagtaac ggaaaacgag ctaaagaaag ttcttgacgg aattgtaaag ggcgaaagat    102540
     tgctgacgga gaagtacaag ttccccacat tcaacgagtc atttatatga caagagcaaa    102600
     agagacaaaa ataaaacatt acaataaaag actagtcgga acacagcaaa gccttgttcc    102660
     aaagggaaca tctgtcatca atgagatgaa gaaacatctc ggcttccatt tggcttgctg    102720
     ccacaactcg tcattctagc ctcgtgggaa tgcaattgct gcattgtgac gtttctggtt    102780
     aactaaacaa atgattctga atagtatcct cgacgcaagg gcataaggct cctcggaatt    102840
     tatctaccat tcaaaacgtt tttctacgtt caggaggcag aattgcttct tctgcagtaa    102900
     ctccttaaaa gcgaaaagaa cacccagagc atgggtgggg aaccgaaaag tatattgcct    102960
     cttgagaaga tatatgcctt tttgtcgagg gctgccgatg tagagatatg ggagaaggac    103020
     atcggagttc ggcacaaagg aagaatcgtt ggttttgacg agtacatgaa cattgtgatg    103080
     gatagtgggg caaaaagata cttgctgaag ggagactgca tatctgtggt gtttggaaag    103140
     gacatagact aggataaaat gtaagctggc cgcaatgggc caggtattgt tctacttctc    103200
     gggaacgaat agtgcaaaga gttgcaccac cagtaaagag aagtgggggt gggagcaaaa    103260
     atatttctta aacctttctg gagatctaga acaggggtgc acgagcagag agtccctgtg    103320
     gaaatactgg caggtcttaa ggacaggcca aggaataata aaaaaagttt tgtctctgag    103380
     ggctaatgtt tgttttacac cttgtggtta ctctgtgttc atctctggaa agagctctgc    103440
     tagaggaagg agatatagag catgcaaccc gcctctgcgg aacaagggag ggcccactgg    103500
     actatttcta tagctacttt gtcaagaagg tgtttatggg gaaggagaag gaagcccttc    103560
     ttgacattgt ggagtccgac aactatggag atgcccgaaa cattgttcta gggataatgt    103620
     ccatggagtc tggaaaaaca aatgaaaagg caaagcttgc agccgatctg ctttggaatg    103680
     tggcaacaaa agtttccaga aggtacctga agaaccctca tgtatttctt gccacagagc    103740
     cttttgggaa gcttgagaga aacttcttgt cgaaaaaggg agtggaaaac attgtcacaa    103800
     tggtttattc gggagacgac atatctgcaa ggctttttct atcgttattg gacaaccgca    103860
     agatatacat tggcgattat gtcgatgtga tagagttcct tgcaaaaaac gatcatgcaa    103920
     gagcgtttgg atatcttggg gagatatatt atcatgggat tcggatgaag aagtctttgg    103980
     acgaagccat gtacttcttc tcacgaggga gagagatgca ggacacggtg ggggcctgcg    104040
     gtgttggaaa ggtacttatg tccgacgagt acagagatta caagaacgca aagtctgcac    104100
     tgttgctggc aaacaagctt gggcagtctg gagaggccga gtatctgatg tatctactta    104160
     tgagtaggag gcctgagtac atgcacaagg ccagctcaca catggactct gcccttatgt    104220
     atggatatct tccggctata tgcagggatg gaatgaacta ctacacaagc ggacagtata    104280
     tgaatgcttg cattcggttc cacccaatca tcgagtactc ggacattgta tacaatctgc    104340
     gaagaagggc agaagccagc tttgtgtctc gacgatacag acaatgtgtg attgcattgc    104400
     tcatgtgtgc agaacttgga tctgtctcct ctatgagaaa tgcagtatac gtccttcaaa    104460
     ggcattcggt cttcgagagg cagaaggaaa tgctctttgg gctatacatg agactccttt    104520
     cgaaagaaga taaggatgct ataaacagga taggggatgc ctatttttac ggagaggggg    104580
     ttgagaagtc gtacaacgat gcattcgcat tctacatgtc tgcagctctt actggagatc    104640
     ccgagggata ctacaatgtc agttatatgt atgagcacgg gtatggaata aaaaagagcc    104700
     tgttgcttgc cttcaagtac attctgaaga tcagtcccgg ggacgacaca tatttgctcc    104760
     tcttgtacac acacatcaga ctcttttcca agtttgttac ctatctcctg tttaacaagt    104820
     actcgatttc tgtatggata ggagctctgg ttgtaagaaa gatgtacata tccaaaagga    104880
     gcacaaagga tttgaaggac tgatatgttt tactagtaat aaaatgttag aattgttttg    104940
     tggtggagaa gggaagagta gacgacattt ggctgtctat tgtctgttct ggttatcccg    105000
     gacaaagggt agatccaaat tatttcgatt gcgttttcca taaagactgg cacatttaat    105060
     agaagggaaa tagctagtac cagtagatgt cgaatggaaa gtcctcatgg gtctcttgag    105120
     actccattgt ctttggtgaa ttcttgaggc atctctcttc cagaaagcta agctttttct    105180
     ttatcttgat gtctgttggg aaatcaattc ctttgtaaag aatagacaca gatggaagca    105240
     gggtgtgatg ggaatggatt tgaagatatc ccactatgtg aaagcttctg tctccacatg    105300
     ttgcagagta tgttctcttc atcattgggc tgctgcttaa aagctgcttg tacactagga    105360
     aaacgccctg aactcttgat ggagtccagg acatgtcatc ggtccatctc ttgattctgc    105420
     tctcctcctc gcaatataca aatatgcttc cgtgtcctat cttctttctc tctctcgacg    105480
     tgagtcttct ctggatccta ggaatgaggc ctctccttgc aagatcgatt agaacaaggc    105540
     agtctgattc gttttcaatt ctaccatgaa aggattcgat gtctgccatg gagacacaag    105600
     cccatgcttt gatgaagaca tggagataat cttacttaaa ggaatggaga tgaccagatg    105660
     caggggattg gaaggagcaa agaaaaatgg agttgccagg aatcgaaccc gggccaactg    105720
     cgtgcaaagc aggtatcatc ccactagacc acaacccctc gcttggtccc cctttcaaaa    105780
     acacatccct ccatccgccc cccttctaaa accacggatt ccctcaaccc acataggatg    105840
     tccaggacac tcgcccccga cgagctgcac atccacaaaa ctattgcatc gaaggtggat    105900
     ttggaagaga tggaaagtgt tgaaagcgtg tccgtcattg caatgaacat gaggcattca    105960
     attgtgagtc cggcggtgta caagataaaa ggaaccgact ctctccttat atttggaagc    106020
     atagggaatt caatcgatct tcgtgaactt cagaagatgt atgaaaacag tgttaaaagt    106080
     tcggagacag aggagcatgc tggcctttat agcagtatcg gtgacaatct gcagaaggag    106140
     gatgagcaaa aacctgagga agtacccgtc gaggttgaca acgagcggtt gtccgaagag    106200
     gatataaaac taataagcca acaagttaag gcttcgagga gcgaaataat tagggcacta    106260
     gccgagtctg attatgatgt tgtcaatgca atgataaagc taactaaata aaaggacttt    106320
     attcgatggg tgttccctct atctctggaa catatacaca atagaagttt tctttcaggg    106380
     tatcatagta accccttcta atcggatcca gacttgcaat cctttcaatt atggcaattc    106440
     tttctgcctc ctcctcggtg taatccagaa gcaccagtag cgcctcgtag cattcaggct    106500
     cttcctcaag aatctcacgc acaaatctga agctttcctc ttcagggatg aacctcatct    106560
     cctctccatt tattaccacc ttccatctct ccgaggtcct tatagactcg tctatcacaa    106620
     caatccgggt gtgaagttca aaggccatcg tcttcctggt tccaccgctt tcaaaagaaa    106680
     gctcaccaca aaaaggctta tcaagtagaa tctccagcct attcctgaat ctcctgatgt    106740
     acattccatg tcttatcctt ttcctctccc tccataggta gaagtattcc caggaggttg    106800
     gatccatagg atctgtgtaa atgatggtaa ggggatcctc cgagtctggg tggtgatgga    106860
     gataggagta gttaaacaca tctctcccag tcttggtttt gaggaagaac atcctgtagc    106920
     tccaacaatg gaagttcctt ggatccgagt caagtagaag ctttgttaag aagtcttctc    106980
     tgccaagata tttttctctt tgttctttga agttttccat cataaacttc ctatggtacc    107040
     aaggctggta ggacttggga tttccttgga gagcgttctc acagaccttg agctggcttc    107100
     ggaagtcgga gggattcaat agaagatagt ccttaagctt gttccaggag taatagtcat    107160
     ctgctacaac ctggacaatt gctttgtgtt tttctatcga ctcctcctgc agcctcaggt    107220
     tcaataaacc ctccaatgcc tccttatcct caatgtattc cccttcctcg atgttgtgga    107280
     taatcattta gggccctgtt cccagtggga aatccatttg tctgaaatgg tgttgggatt    107340
     gaagaaagta ccctttccaa gatggataga atcgaaagat ttctggggag aaggccagtg    107400
     aaaggccgac gcaaagtcca gtcccaaggc aaggagttct tgataacaaa agaggatgtg    107460
     aagctcataa ggagctacaa gaagaacatc tgcatggatc cagatgtcga tctgtacagg    107520
     ccgttgaact taagtttcag cagaaagacg atgaacgaag gaatggaaac aaggaagaaa    107580
     gtggtggtac cgagagccgg aggaaggcca aagaagaaag aaagaagcat ccgaaaagaa    107640
     gttaagaaaa gggataagaa cgagattgtg gacatttggg aggaagaggg tcttgaggag    107700
     ctgaatagtt atgaacagga catggttgta aaagtggggg atgcatacac aggggctgtg    107760
     gaggcactaa gatatggaag agaagatctt gaaggcagcc taagaaggat atacttgagg    107820
     ctctacgagc cacgagatgg aaagaattac aggctaagag atcttatcaa ggaactgcct    107880
     aagacagaga ccctaaggcc gtttccagag gagattggat tgtcgtttaa gttttcgaag    107940
     gcaatccgtg ttggaatcag ccaagatttc aagaaatttg gagtgggaga aggaaggaag    108000
     cttgggattt acgagtttaa aaactttgta aagctgagac atatcctctt tgattcggag    108060
     atacggaaga taatgtttgc aaggaatggg tctatatgta cgttgctagc agacaacacc    108120
     atctgtgttg tggacgatat ttatggagga gatgcggaga gttccaagga atcttttatt    108180
     tccaaggaat ttcctgcgtg gagcagaaag gaggcagaag agggagcaga aaggaatgca    108240
     tttgtgtgca cggtgataaa tcccgaggga aagataaatg atatagaagc ccatgaagat    108300
     ggtaagcata ttattgcagt ttgtggaaag aagattatgg tctacaatct caaggaacgg    108360
     atagggcggg aagttctaag ggtccgggga gccacgcctt tgaaggccaa gttccataga    108420
     tctttgagca caatgattgt ttccacaaca aattcgttaa tcatctacga tcttgtgtcc    108480
     aaggaaatag taagggaagc caaggagttt tcgtttgtcc ttgacttctt tagtgttgag    108540
     gaaagtaagg tggctgtggt aaacaacacg aacaaaataa ttctgtacga ttggttgaaa    108600
     aacaatgtgc aaagaaccat gcttcaagag gatgtgggga tggaggtggt gcagcatgga    108660
     agactcaatc tgatgtgtgt tgcatatccc acggagatgg ttgttttcta caacgacgta    108720
     acaaacgacc tggtggttcc tgtaaaaagg attccgggaa ggtatagaga tatttcattc    108780
     catccgcatc ttccctggct gtatggagtc ggaggaaata gactggatgt gtttacgtga    108840
     gatcttaggt ggatggggtg tggaaagcct aattcagcca gattgaatta taagtaaatt    108900
     ttttaaccca ggaagtcaga tatgcagatc tttgtgaaga cactaacagg aaagactata    108960
     acgctggagg tagagccggg agatacaatt gagaatgtta aggcgaagat ccaagacaaa    109020
     gaaggaattc cgccagatca acagagattg atctttgcag gaaagcagct tgaggacgga    109080
     aggactctat ctgattacaa catacaaaag gagtctacac tccacctggt gctaaggctc    109140
     cggggaggag gggcaaagaa gaagaagaaa gacttttcaa caccaaagaa agttaaggcg    109200
     ccccacgcaa agaaagggct gtcatggctg gacaacttca cggtcacgga agataaggtt    109260
     aaggtgaatc tggtctcgtg cgaggcatgt ggggtggaga ttttctgcag aaagacggcg    109320
     tctggcctca agtgtggaaa gtgcaaccgg gtttacagcg agggcgttac tagcaattaa    109380
     atgagtcttt aattttatta tgttgctttg aatttccttg ggagtatagg gatggaagat    109440
     ctcttgcctg acggaaatct tttgaaacgg cataccctac aatggcccga attaagataa    109500
     gcggagttcc tatcgagatg ccgtttgagc cgtatcctgc acagatagtg acgatgacaa    109560
     agcttatatc ctgtctgacg acaggaacaa gcggactggt ggagagtccg acagggactg    109620
     gaaagagcct atctataata tgtgcagtgc tgggatatag tgaatacttg aagagaggag    109680
     ccaagagcat caatgtcaag agaagagagg gggggagttt gaaaggagaa gaggcaaagg    109740
     aggagaagct gaagataatt atatgctcgc gcacacacaa acaacttgac caattgattg    109800
     aacagcttag gaaaacacat tacaggccaa ggatctcgat cttggcaagc aggagccagt    109860
     attgcatatc acctaagcta ggggatgtta cagacaagaa cacagggtgc aacgagttgg    109920
     tgaagagcgg gagttgtgct tacttcacgg gaaaggacag gcttgcaaaa agggttggag    109980
     acaggatatt tgacatagag gagttgaaag gggagggccg gagatgtggt ggatgtccct    110040
     actatgcatc gaggatcttg aatgaggatg cagaagtcat atttgctcca tataactatc    110100
     tgattgattc cagaataaga gaaaacacag gaattagcct tgaaaacagt gtggtcattg    110160
     ttgatgaggc acacaacata gaggatgtat gccgatcgtc gggctcgatt gaacttagct    110220
     cgcggactat cgagataatc caaaacgaga ttctaggggc aataaggagg agcgggatgc    110280
     taggagagat caaactggac tttgtcaacc tcatggactt ctttaggaag cttcgagagg    110340
     gggcagagag cacagacggg tttgacagaa ctacgtttgg agggaagctc cggataagga    110400
     aggggaaaga gataaaggat gagcttgaga agatgggaat aactaaggag tttgttttaa    110460
     agatcaagaa ttcaatatac gcaatccaga agaatgaaga tgcaaaggac ctgctgaaca    110520
     tgagtacatt ccatgtactg gaaggtcttg actctgtctt gtctgcaatt catttcagcg    110580
     gatgcgatgc gtattcgttt gtgttccaga agacgaacga cgaaaacata agaaactcga    110640
     ggttatccaa gttttcctac aacttctggc tactggatgc gggttataca ttccgatcgt    110700
     ttgttgggaa ggtgcggtcg attgtacttc tgtctggaac cttgacacct ttttcttcgt    110760
     tttcatcgga gttggggcat gactttactc attcgattgt tgcacctcat ctagttacgg    110820
     aaaaacaagt atttgcttcg tgtgttcgga aaggacatct gctgaaggac ctgactggaa    110880
     cctatggggt ttcggacaca ccccaatatc tggaccaact ttctagaatc atagtggatg    110940
     tgtcgaacaa ggtcaagagc catgggggaa cattggtgtt tgtaccgagc tatagcttct    111000
     tggagaatct gcagaagaga atgggaggag agagttcggg gttgttgatt gaaccaaaaa    111060
     gcgggggagg aaatgagttt gaaaaggtga tgaaaagata taagaacaga atagcaacaa    111120
     agcagagggc aatattcatg tgtgtctacc gtgggaaggc gagtgaagga atcgacttca    111180
     aggattcctt tgcaagggct gttattgctg ttggaattcc ctatccaagc ctacatgatc    111240
     cgcaggtaga acttaagaag gagtttaacg acagatacaa aagcttcaat ggacggctct    111300
     ggtacgaggc acaggcgttt cgagcagtga atcaagcact tggacgagca atccgtcaca    111360
     aagacgattg ggggattgtg atgctccttg acagcagata ttcggagaag agagtacaga    111420
     ctcacctgtc caagtgggtt acagacaaca tcagggttca tgactcgtat gacacctgtg    111480
     cctctgagct ctctggattt ctgtctttga ttaaatagaa gggacttaaa ataaaattgt    111540
     gaaagcaatg cttcaacgtt tttctagatt tttccggctg tttcgaggaa aacgaaaata    111600
     tttaacggga aattccctag caattaatgt cgtccaaaca agaatcattg gcagaaggca    111660
     ctataaaaga caagcatcct gagacacatg gatttgaggt tgatgtgaat cagatgatgg    111720
     acactatgat caagagtgtg tactcatcca aggagctctt tcttagggag ctagtatcga    111780
     actccagcga tgcatgcgac aagcttaagt cgctgtacta tgaactgaat tccaagggat    111840
     gtgatctgga cccggttaca tctctaagta ttgagataat cccgaacaag acgaacagaa    111900
     ctttgaccat caaggataat gggattggga tgacgaagcc ggacctgatg aacttcatcg    111960
     gaactattgc aagcagtgga accaagaagt tccgagagga gatgaaggag aaggggaatg    112020
     cagcagatgc ctccaacctg attgggcagt ttggtcttgg attctactcg tcataccttg    112080
     tagcggacag ggttgatgtg ataacaaagc atcctgagga tgaggctctt gtgtggacat    112140
     ctactggaag agatgtgtac actatagaag agtacactgg agattctttc tctcacggaa    112200
     catcattggt gctttatatc aaggagggag aggaggaatt cttggatcca aagaagatta    112260
     gtgagatagt gaagaagtac tctctgtttg tgttctatcc aatatacaca tatgttgaga    112320
     aggagattga agagccttct gaggaaaagg aagaagagaa ggaagaaaaa gcaaccgagg    112380
     aaacaactga gccaaaggtt gaagaggcga aggagaagag actgaagaag gttacacaga    112440
     gggagcagat caatgcggaa aagcccttgt ggaagagaaa tataaaggaa gttcccgagg    112500
     aggagctgaa gagcttctac aagacgattt ccgaggactg ggatgacttc cttgcagttg    112560
     acttctggcg tgttgagggg cttctatcga ttgatcttct tatgtttatt ccgaagagag    112620
     ccaggtttga tatgttcaac aggaacaaga agaacaacaa cattaagctg tactgtaaga    112680
     atgtgtttgt gactgatgat ttcggagatt ctattcccga gtggatgtcg tttgtcagtg    112740
     gtgtgattgc ttctgatgac attcctatga acatcagccg agagatgatc cagggaacaa    112800
     atgtaatgaa gcttgtcaag aagattcttc cacagaagat tttcgagatg attggaaagc    112860
     ttgccatgga tgctgagaag tacaagactt tctacaagga gtttggaaac tgcatcaaga    112920
     tggcgattgg agaggcaagc gaaggacagc aggatggcta tgcaaaatgt cttcgatatt    112980
     tcactacaaa gagtggagag gagatggtgt ctttggatac atatgtggag aggatggcag    113040
     ccaaccagaa gcagatctat gtgataacag ggcttggaaa ggatcaggtc aaatcaaatc    113100
     cagctctaga tgcattccag aagtacgagg taatctacat gtacgatgtg atggatgagg    113160
     tcatgctccg aggactcaag aaatacaagg gacatgctat tcagaggata acaagtgaag    113220
     gagtagagct tcccgaagat gaagaaaaca atgaggaaat tgtcaagtcg ttcgaggagt    113280
     tctgcaagaa ggcaaaggat cttctctcaa acaaggtgga gaaagttacg gtgaatccaa    113340
     ggcttgtgag tgcaccggca gttatctcga caactaagta ctctctatct ggaacgatgg    113400
     aaaacataat gaggtcccag cctgtcacag aggcaaatcc gtttgcagca atgactgcag    113460
     tcagcaagaa gatcttcgag atgaatcccc accataaact tgtcaagaat cttaagacac    113520
     ttttcgataa caacgaaatt gaaaagatgg gtaagatgct ggagctgttc tttgagacgg    113580
     ttcttatcca caatggattc atgctgtcag atcctaagac attctgtgcc aatgtctttg    113640
     agttcctttg ctcctcggaa gtaaagagtg aggagcttgt ggaagaggtc cagtgaatct    113700
     tattaaataa ttctctcaac acttgtaaca tttgtgtttc tgttaattgg cccaaaaaaa    113760
     ttgctgggga tggaagtgaa attatgcgaa gatgcttgga aagttctaag tgcaataaag    113820
     cagacaattg tttcggaaag aatgaaagat acgccagaga acgttacgga ggcagcgatt    113880
     gagacgtttc tggagatgag ccgaagaaat gatcattcga aagtggaaga gcttcttcag    113940
     ataatcctgg cacataagaa ctacatcacc gagaaaagta gcacagagct tgtgagaaga    114000
     attcttctct cctttaagga gaagaaggtt tatctccaag gactccgggt aatcaagcat    114060
     tttgtgaaaa gcgggagata tcacatgtcg cacttcaaga ttcttgtcga agactgtttt    114120
     ggccggaagt cactaaaaac aaggtctgtg gaacttgcaa agagatatct ggaacttgag    114180
     gagtttagaa aggaacttct agggtatata tcgaagctcg aaggaaccga cttgataaga    114240
     cacatcaact gtttcttcga ctctattgca gatggaattg atgttgtaga gaaacttgac    114300
     tcatttgtga atccggatgt ttttgagggg atggagaccg gcgaggcaag ggcactgtac    114360
     tctgaatgct gtgatatgct ctacaaatat acgttgatgg agatggaggt tggaattccg    114420
     gatgaaaagg tttttgaata catagtgaag aagcttcaga tcctgtttga aattcctttt    114480
     cccaggggag gaaagctctt ggaaactctt tcattacttg cagaaaagga cttggttgtt    114540
     tctttaagga gcaagcagca tttgatgaga tgggataaga atctgaagag agaggttgtg    114600
     aaagagctct gtgagtcgaa tttgaagaat gacaaaatat acgagtttat aagatctgta    114660
     aggcacgtcc ttgttcccga gttcatggat ctaataagac acatggcaag gaactttgtg    114720
     gaaggagatg ataaatatcg atttgccctt ggggcagtag caggaattat aggaatcgag    114780
     gatctatttc tggtactaga agacatggaa atagagatta ggacatgggc accaattatc    114840
     cgatgttctt caaatggaga catatcgttt ttcataaaga ttctccggga tgtggaggaa    114900
     agaaaaggtg tggaatctat cgacagaacg attctcttga actgtattcc tgcattctgc    114960
     aactatgcaa ctgatcgtac gggttcaatt gaaggtctcc tacaaatcat gaaagccaac    115020
     ctagggaatt caaacgtttt taattcgata tgcacaggac taaggaagtt gatgcattcc    115080
     cacgagaaca acatcaagaa caacttgatt cttcgaaacc cgattcctcc tggggagtcg    115140
     gagagaatcc tccactcaat caggaaatcc gagattgctt tggacattct ttctgtagga    115200
     attgggaagt gctctgatga gctggatcag acattgttca agctactgga aaccgatgat    115260
     tttggactat cgagcaggat attccagtat atcctactct accctcagat tgagtctgtt    115320
     acagtcggaa agtggaatct atcggggatt tcggatgtaa tgaaggttgc aaggtacttt    115380
     gttccaaaga tgaacagcga tttcgagatt tatagcaagc tcatggagtt ctgtctttct    115440
     gaggacgggg gagcacagaa aagagcatat cagcttctgt atcacatgaa gaagcatcaa    115500
     aagattgatc tgtgcatctg cgacacttta ttttcccacg aaaccgatga gaagacaaag    115560
     gactgctccc agaaatggag gattgctctt atttattctg tttatacagt cggatgcaaa    115620
     tgcttttccg agcggaagaa agaatatctc aacaggatgc ttccagtgct tgtgctaggt    115680
     ctgaagacag gaaatgctaa ggcccgaaag gtttgtcagg aaaatttgga tgaacttgta    115740
     tctgggtttt catcttccga atttgatttc tattgtaggc taatggttgc aggaacagca    115800
     tcggaaaatg tagttctcag atgcggaata ctggaagcct ctgttgcact aatagagagc    115860
     cacagagaaa gactttccca agaattcatc cagtcgatgt acgatggctg cctctcgaca    115920
     agtagactag gaagggaaac tgttccccat gttctcaaat tcttaaatat ccttgttagc    115980
     acctatgcag tgaaccctca gggatgtctg gaagttttag agctatatgc agacaaattc    116040
     aaaagaagat atgcagaaga cgtcaagtcg attgtatcaa gactgattag aagagatgtg    116100
     gagatcccca agagtctccg ccttttcttg aaggaaagaa aaagaaaagg tcctcgggca    116160
     accttacaga taacgaagaa aaacaacgtg atgatcacac aaggaaaaca gaaacaggag    116220
     agcattccgt tttcgggcca cagaagaacc gtcaagcgga acaagagaca caagaaataa    116280
     aacttcattt aattttggtc ttcaaaataa ttctatctgt ttttttattt atctcttctg    116340
     tagcactaga agtcatgcat aggaccgtac aaagttaagc tcctcgtcaa aactgtcatc    116400
     gtagtccatt gttggagcct ccattccgat gctttcgcag aaattagtaa aaaggatctt    116460
     taggtcgaga gattcctcct tgtttacgca atctctgagt acagagaagt attgtctttg    116520
     catgtctata ggcatttttt ggaggagcat catggcaatc ttgcatctaa aggatgcacc    116580
     caccttaagc tgaagtgccc tgtcaacaag ataagcccaa gtatctttat tctcaagcag    116640
     cattaggctt gagtacagcc ttgcaaggga aatagacttg tgtttcgaat atccatacat    116700
     aatctctatg ctaggaatta ttacattcat cacttgcatg cttatctcgg ccttgtgcac    116760
     aacagaagcc agaaagtcaa tatcctcaaa aacccatgga tgcagaaaga tcgacataag    116820
     tgtggccttg ctcttgataa gacaagacca aagtaaagag tctccgtcaa aggcctcctt    116880
     cctgaaaaag tatctgaaaa atcctgtgta atctgcacag agtatagatt gggaagggga    116940
     aaagagtctt gagagacagt tgtttacatg tacaaagtct accttcgaag ccctgtagtt    117000
     cctgattctt tctataaact cgcgaattct atggctggtt gcctcgttca agaggaaata    117060
     ccgtcctatc ccattgagac acatacagta tgcttcaatg ttcttggtct tgaagagata    117120
     atccaagagc ccaaacatct catcagaaga aacctctctg aacttacaca tctcggatat    117180
     aagtaagcaa ttcgatatca catcgttgtg gcttgggttc tttgcctgat atatttctct    117240
     gaagagaact gctacaactt ttcttgcaac agctcccatg tttttaagta tcctggctat    117300
     gcttgatatg aagttagggt tgagcttcaa ctgcataagc atgaaaacaa cctccttctg    117360
     gttgtttacg ttttttatgg atttcgataa tgcatccaac ttctctgtat ctccagaatg    117420
     cataatgatg tagtccctta tctcttttat gtccaggccc ccatcataac attccaatga    117480
     ggcagtacgc ccggtgtaat agtggaactc ctcgttctcc acatcggcca tcttcttaag    117540
     gtcatatccc tcgtcacaca cctttatccc aagagacctt gctacaacat caagcctccc    117600
     acccctgtct tcactagtct gcggatctat ccttttagct tggttagaaa cctctgcttg    117660
     gcttagttca tccttatagt tttccattat gtatccgaga aagaggattc taggtttttc    117720
     acttatcttg ttgcatagat ctctgatcag attttctctt ctctcctctt tatccacagt    117780
     ccttcttgat agagtctgca aatcaaagaa aaaggctgca agccagtact tctccgtctc    117840
     ctcaattcca tgatttatga tctttcctaa ttccgacatc aacagcctca tgaagtcgct    117900
     gcatgatgta agtgcagacg tcacccggac aacactcttg atgtcgtctg tagattgtac    117960
     ttttgataga agtatcgaag taactatctc ggaggtgaac ttgctcatgt cttccttctc    118020
     aagatcactt ttaatcgctt ctacactttc tgaatttatg tttttaagct tctttatgat    118080
     cgaaagcttt tttctaagcg gagagtttct ctttctttct gtataaggaa ctcccaaagc    118140
     cataagctca tcttcccaat tcatagaagg gactttcctc ccaaaggatt tattacactg    118200
     ggggcttctt gaagcccttg gacatgaacc ggaactattt gaagaacctc tatctccagc    118260
     aactcgaatc ggaacggtat tcagatgtat tccgagaaag cctacatagc ctagtgtctg    118320
     tggaaataat gaataccgtt atactcttgg ctgttaagga tgatgacgag gatgcactca    118380
     tcgatcttct ggagttgttt ctgcaacatc tagagaccaa ccctatattt tatgagaaac    118440
     ttgggaaatc aaaccttcac ttacttctgt tggaacgtcc actgaggatg cagagctaca    118500
     caaaactaaa gttggtttat gataaggtta ggcccaagag aactccacta agctttgagc    118560
     atacagagtt tctcgccaaa aacttttaca attactgtct ctacaagtac gcatacaatg    118620
     attatcagtt cgaccttgag atgtctgtgg aaggatttgg gccggtggag atgaatttgt    118680
     tcaaagatct ccttaggaag atatgcattg aaaatagaga gaacgagcat cttgctaatt    118740
     atgtaagaac tcttcccatg gacacaaatg tctttcttgc tatagtggag ccggatttca    118800
     aggtagatgc atcgaagctt gagccagagg atttatttgt tgtgtaccca gctcaggtcc    118860
     aaagatgtaa cctgggcttg tttacaaagc catttctttg cagtttgaac tctaaggagg    118920
     gtctttgcag agtttgtggg agaagagttc tagaatacca ctttgaggag atcgaccacg    118980
     aagaatacct ggaaagtata gcaggaaata tcaaagagat atgttttgct gtaagtcatt    119040
     gggaaaaggc cagaacgcct cgggtgctta taactgttct caggtctctg ttcaaaggat    119100
     gcgaagatct cgaatgttac aaatccctaa agtactttcc ggtgaaagag gagagcgata    119160
     tggaggatat agttgtaaag ttcttaagat atgcagcaag cacattgaac attgagaaca    119220
     tccaggtatc cctcaggatg cttccgttta caagccacac cccaaaagta atattttcat    119280
     actttgttat tttatttgaa agcttacgaa agtatccgga aaatgggttt ttgagaagca    119340
     tagtaaagaa tgtggtgatg aggaacaagg acaaatttat gaagataaga gcaatgatat    119400
     ttgaatacta tatgaagggg gacgaagagt cggtgtttga cattccaaat agagaaaaag    119460
     agggaagagg cttgaaggat ggaaaggact ttaatacaag cataagcgat agacttgaac    119520
     gtagacttgc accgttgtct gaattcttca gcgaggagtg cggatctttc gttaaaaaca    119580
     acatgttcta catatatcct atcatatact cactatggct tcctcgttgc acccaggatc    119640
     ttggatttac tcaggcaaat aaccactttc tagtaatatc gctttgcctc caaggggaag    119700
     aaagcagaat agatgaaata ggatatgaaa aagacgaact gtatggaatg ggggttgatg    119760
     taattgttcc ccttttgtgc aacggatact tcaaatatga tattctggaa aggttttttg    119820
     gggatactcg gaagtatata agcatccact taccgaagtt tttatttgca ttgaagaagg    119880
     tgtatgtaga aagacctttt gagtttcgag tatgtgtgtt taaggttctg aagtgcatta    119940
     tagatgcaat ttccaacaat gtgaagatgt tgttcaacta tctatttccg tttgtggagt    120000
     tctttatgag aaaacatgaa gactcgtgtg gaatggattg caagatgatt ttcattgagt    120060
     attattcatc attttttgag aacgattgtt ttatccgaaa catgcccagg atatttccat    120120
     atttagacgt tgaaaagata gtgaagtgga gcaatgcaaa gaatgaggaa gactacctgg    120180
     atatagtcct tgggcttttg aacaccaaag ggcacttttc acaggaaatg gccacctcta    120240
     aagcggtgga acttcttaca agggtctttg gaagtataga taaagatgga gtgcttgatg    120300
     aagaaagctt tgtggaaaac attcttaccc gattctttaa gagccctacg tttagaatta    120360
     aggttgggag tatctacagg cgacttagag aagtggaaag tgatgcagca ttcctgattg    120420
     gatgtatatc acaggagttt ctggaaccag agatccatcc ctctgtctgt gacgttccta    120480
     ttatggggaa tactccggaa gcaattgcta gagtgatgat tgaaaggtat ctactcgaga    120540
     tagatcctgg aaaacaagat cttcattttt tcataataca ggagacttta aagtttatta    120600
     gagggccttt aagcgacagt atagaagaag ttgttgatca gtttagaaac acacagtatc    120660
     tctatgagca cgtgcctaca tattcaacgg agaagttgta tgaaaagaca catacattta    120720
     agaagttcct cgaaaggctg tatcggcaca ccctctcaga agttgaaagg aggaacaaaa    120780
     aggaatattt taatcttctt agatatggag atctgcttgg gattccgttt ctggagttcc    120840
     attgcttgtc cctgtgcagg ctacttctag attcgggaga cagcagagtt gcagggattg    120900
     cacagaatat atcccaggac ctcgaggggg gagtggacag aaagattgca aggtttgttc    120960
     tgaaactaca caggttcaca gaagggaagt atgttccaga tcttgtgata ctcaggatat    121020
     ctatttttct caaggaccat tataacgcta tccaggtttt agagaagatg ataagaaaag    121080
     aaaggagaag ggatctcttt gatctcctcc aatacaacta ctattggatc aaggactatg    121140
     acaaagtact aggaataaac tcggtatttg ggagaccaac actgatcaac cttttttttg    121200
     ggttctgtgt tgataaaaac ttcgcagcag caaggagatg cttagagcca gaagtgattc    121260
     ttgggaattg taccacggag tcggatgacg aagaaaaagg gaaggactta ataattcaat    121320
     cactggacat gaaagaccgt ctatcggaaa tcatagatga atgccaagac gatgaagtta    121380
     tgaagtttat gaatgactgc aagagaattg agaaggattt ttccgaatgg agaaacttgg    121440
     agagtagaaa tgaggtcttc aagcattttg taaaagactg cgagcttgta tctaagagca    121500
     agaatctact caagaccctt gatctgatag ctgggagaag agagatggct ggggacgata    121560
     gaatgcttct ggaatgccat gaaagtctta tggcaggaat tagatccatg gtggatggaa    121620
     gagatgatat atcatgtgat gaaatgtttg agtctctttt cactttatca aaggagaatg    121680
     tcggggaaag ccaggatgta ggtcttgagc acagagaata ctttgacgac tttgcatctg    121740
     tggatatggt ccgagctgaa aggcatcatg aaaggatagg atacatagat agaagtaggt    121800
     tcggaaagac aagcggatac aattctttgg atgaatttga aagagattta aagcttggga    121860
     tgataagaag ctacatggga gataatgatt ttaataagtg cattcaggag attggaagca    121920
     tgcttctcaa gagggagtgg agcgcactat atgaactggc caagctaaat gttctgcagg    121980
     ggaaagtagg agatgcaaag acgtccctca aaaaggtttt ggaattgttt cctagaacat    122040
     cgatattcca taaaagagct ttggccagat atgcagagat agtggataca aagacaggat    122100
     atgactctgc attgtcagtc ttaaaggatt ctggaaagct ttttcttctt ggagccaaga    122160
     aatttgaaag cacagagccg gtgaaggcaa tggagatgta tattaacagt gtagtgcatg    122220
     atagtcaata ttcagacgaa gcaattccta gaatatttca tctgttttcc gagatgacac    122280
     ctccaggaga catcaatgcg agtagtgcct tgattaagaa gttcttagaa tcttgccttt    122340
     ctctgcttcc cccatactac aatcaaattc tctcccgatt aagtcatcca aaccgagatg    122400
     tggtggatgt agtgtccaat attgtgcttg agctcatgga aaattatcct agcaagactt    122460
     tttggagatc tctgatcatg atgaactccc aggttccaaa cactaggaag cgcatggagg    122520
     gaatcatctc cgagcttaca ttggataaca aggtggttct gtccaacatc aggaagatat    122580
     cagagggcct tatggaaata tcaaaatcta aaaagaacga gctagccatg gaggaagact    122640
     ttccgggatt cattagaatg tttccaacta atgtcatggt tcctaatacc gggatattga    122700
     taaacggagt gaaaaatgag ataaaggtct tcaattcttt gcagaggcct aaaagaatat    122760
     gctttgtagg aaatgatgga aaaaactact actggctttg caagaaccag gacgatttaa    122820
     ggaaagatag caggtttatg gacctgaacc tcataattaa cagcatactt aggaagcaaa    122880
     gcaacaaaaa gtacattcga acctatgctg tgataccgtt tagccatgag agcggaatca    122940
     tagaatggat caaggggttg aactccctta aggttatatg cgattcctac tattcaaaag    123000
     atgggatatc aatctcggag actgcatgtc ggtttgtaca aaacaagaag atagggcctc    123060
     gagaatggca taaggttatc tctaagttcg gcccgaagtt tcatctttgg ttcagcgaca    123120
     actttccgca tccatatagt tggctatcag ctagaaacaa ttacaccagg acgtatgcaa    123180
     taatgaacat tgtgggatgg tttatgggtc tgggagacag gcatgcagag aacattcttt    123240
     ttgattccaa cactggcgac acagtccatg tcgatttgaa ctgtatcttt ggaaagggaa    123300
     gagagctgca agttccagaa aaggttccat atagactcac tcaaaatata gtggatgcat    123360
     ttggagtact tgggcttgaa ggttcataca atgcctctct ttgttcaacg ctggacctat    123420
     ttctcaagaa caaaaacatc cttgtgtcta acctcctatc ttttgtttat gatcctttat    123480
     ttgaatggag aaggaaatcc accaccactc caaagaggat catcgaagat ctgtgccgca    123540
     agatggatga tttggatgtc agcagtaagt gtgatgtttt gaatgaggag gcaacaaaaa    123600
     gtgagaacct gtgtatgatg tacataggat ggcttccatt catttagcct cactataaaa    123660
     gagattccaa tggcagtcca ttagattatc tatccaaaat aacttaaaat atacttagaa    123720
     tactctcaag actatttact tttcaaaaga ccttgaagat cgtcgagaaa ctcctcatgg    123780
     ataagccttc cgttggaatc aaagaggtca aacatcgatt tggtgtactt actaggaatg    123840
     agcttgtttt tgttgtagac cattattaca tatgtgggat caggtgcact cacacttgtg    123900
     gaaaccaccc ggtccttgaa taccattgaa gagcctgtcc atcgaaagta gatttctcca    123960
     agaatgttga ttacgaaata gattagagtt aatatagtta tgacttgttt gtgatactca    124020
     aactccgatg tcaaggaaaa atatgcaact gctgaggcaa tgacagtcga aatcagccct    124080
     attgctattt taatgtctgt agagacctta gactgcttgg aattccccac attttccatg    124140
     aagtctcgga tgacatcatc gagaataatc ttcagctcgc ttaggttgta tatgtctcct    124200
     ctgagcgggt ttttgttgta cttggctttt aagttatcca tagagggtaa atattttaca    124260
     aaggtgttaa ctaggatagg agacacccca aatggattcc gatcaacagt cctctgcatt    124320
     ttcgttctat gatgctagtc aggagaatct gttgaatttt acgccttcgc aaggagacct    124380
     cagttctact atccttccta tagtggagac agagagagta aaggtgatct ggggtactac    124440
     gataaacatc caagagacat ccgagcggtt caaggagttt attagaaaga atagagacta    124500
     tcatgacgtt cttgagcaaa tggatcttac tcaagagttt gtgtttgatc tcaattgtga    124560
     agatcttgat ccagatcttc gaagtcagct tgcaacatat cctcaggaga tgcttccgat    124620
     tctccaggga tcattacagg aaatatatgt ggagaacttt ccaagcttca atgggaccat    124680
     cagaatcaga ccctttggaa taggaaaggc tctctcaata agaaacatca atccaaatga    124740
     tatcgacagg attgtgcaga ttacgggaat ggtcatcagg tcgtcgtctg tgattcccga    124800
     gattgtaagg gcttttttcc gatgctcaaa gtgcatggat gagtgttttg tagaaagcat    124860
     aaggaatgtg attgaggagc caagcaagtg caagtgtgga gggaagtatt ctcagcagtt    124920
     agttcacaat tcaagtgaat ttgaagacaa gcagatatcc aggatacaag aactccctga    124980
     gggtattcct gatggaacaa cacccatggc tatgacaata gtctgcagaa acgagtttgt    125040
     tgacgggctt gttccaggag atagagttaa ggtgatagga attttgaaag caacaccggt    125100
     gagactcaac cctgtgatga agaaaatcaa gagtacattc aggacttatc tcgatcttct    125160
     cagctacgag gtaatgaata agaaggtcaa ggaacgggat cccatttaca agattgatga    125220
     gcttcgaaaa aaccctaaag tatatgaggt gttggcgaat tctatagcac cctctgtgtg    125280
     tggaatggaa gacacaaaga aggcgttgct ccttcaacta tttggaggag ttcgaaaaga    125340
     attgggcagt tcaaggctta gaggagacat aaatatactt cttgcagggg atccaggaat    125400
     atcgaaatca cagctactga gctttataca tagaacgtct gaaagaggga tgtacaccag    125460
     tggaagagga tcaagtgcag ttggactgac ggctagtgtg gctaaggatc cagatagtgg    125520
     gcaatttatc ctggagtctg gggctcttgt cttatctgat aacggagtgt gttgtatcga    125580
     tgaattcgac aagatgagcg atagcacaag aagtgtattg catgaggtaa tggagcagca    125640
     gacggtgtcg gttgcaaagg cgggaattat aaccacatta aatgcaagat gttccattct    125700
     tgcaagctgc aatcctattg aaagcaagta caatcctcgg aaaagcataa ttgaaaacat    125760
     caatcttcct cccaccttgc taagcagatt tgatgttgtg tgtttgttaa tagatagatc    125820
     tgatgaattc caggacagaa ccataggaga ccatattgtg tctctatatt ccgaggagag    125880
     gggaaaaacg gaatgtgttg atgccgacct tcttaaggca tatgtgaagg aagcaaggaa    125940
     gatagttcca cgattgacgg ccgaaagtat gaggttgctg acgcaagcat atgtggatct    126000
     taggcaaatg gacaatggaa aaacaataac cgcaacaaca agacaattgg aaagtttaat    126060
     ccgcctgagt gaggcacatg caaggatgag gttttcaagc actgtcgagg caaaggatgt    126120
     taaagaggca gtgagaataa taagagaaag ccttcttatg tatgcgattg atccatctac    126180
     tggaaaggta gatatggata tgataattac aggaagaagt acatttagaa acaagatgct    126240
     ggagagcctg aaggatgcaa tccttctaat gatgcgagac cgaatcgagg tctctgaaat    126300
     agttaggaag acaggtgcaa atgaaaagat ggtgaaagag gccctagagg agcttgcaca    126360
     ggaagataaa ataatgactt ctggacacga gtcttgttac gaaaggataa gagactagaa    126420
     tgggtttgca agggactagt cttcctccta ggtttgattt aaataaaatg gtgtcttaat    126480
     ctacttcctt ctggattttg ttatggaaat accaccagta gtaaaacttt tcccaatcgg    126540
     taaggcgtct acccgaatct cccttacttc ccttcattgc ctggagctga gacgacttta    126600
     gtttgcagct gccaaagagt atggagtctt ctattaaatt ttcgataacg gcacttgcat    126660
     tcattaagtt ttcctgtgta tctgcactta tataacaatg caagggttcg gcatatttgt    126720
     ccttgtagga tcctcttatg tatatcctgg cttttgtaat cctttcaagc tgcctttggg    126780
     tggatccttt tggacctatt atcaagccca caaaattgct ttcggggaat tcctggacag    126840
     gaatgtagat tttatttgta tacatatttc cagatatcga aacatttccc tgtatttgga    126900
     ggcctagaat ctgttgtttt cttgatttca gccattggac cagttgttga ttgttggatg    126960
     caactgcatt tctaaggcgt ctatctattt cctcagaacg catggaacag agcagtttct    127020
     tcaactcgga tttacttttt acatcttttg ggaatgggac cttctctggg tgtcggaaca    127080
     gctccatcag atggtctacc aaaaaaatgc aaatttttcc tccccgatgg caagtattcc    127140
     taagtcgaac gaagtaatct ttgtaaagaa ttattatagc atgctctgca acaggccatc    127200
     ggtcatccac caatactaca tgaaggattc tcagctaaca atctccaagg aggcgagcaa    127260
     gcccgaaata tgcaccgagg actttgggaa atacatcaaa tcgaagatat ccagcccagt    127320
     ttccaaagta ttcatatctc acctgtcttt tcaaaagata gacaacctga aatcggctat    127380
     aagtgtcatc gggcaatttg tttacaacga ctcgtcgcaa gtgagaatat ctcatcagtt    127440
     cattgtctcg aggatagatt ctgttctata catcaagaac gagattctga cgttcctaga    127500
     cgaagagatt gcttatgatc tggaccatga tgccaagaag gttgtggttg ttgaatatgg    127560
     aaagaacgaa atgttacagg ccatcaatgc tatttctgag tttggaaaga ttaaatctat    127620
     gaagtctgag gacgatggca aggttgtcat gacattcgac agtatagagg atgtggagaa    127680
     tatcaagaag aatgttccaa agatagtctc gcagggatat aagttggagt ttgatgggct    127740
     gaaagtgtga ggaatcaaag aactttttga aataaattct tatgggcatt ttgttttgca    127800
     tggttctttg caaatgatgt ttcttgtcta ataaaggccc tacaaaggat aatggaagaa    127860
     gaaggaaaac tggcagagag atttgtaaag gcgtataata gacgtgtaga gttgtacaga    127920
     cagagatatg ctctggaaga ttctataaat gcaaagcttg tcgaccagtg tgcattgaaa    127980
     aaagcaatag aaatgaataa agagctagac aaaaaggatc agccaagacc acctgaccag    128040
     ggaacaatgt ttgggactgg aatgcacaga ttgtctcttg ttgacatagg tagacttcct    128100
     acagagaatc tggacatgtt ccataccgaa acagcaatct accctgtagg atatatgtgc    128160
     agaaagaagt ataagaagca cgacgcttat aaaaagaagg caaaagacag gatcctgtat    128220
     atatgtagtg tggatcctca aaagggtccg ataataactg ccgatgacgg aaggaaatgg    128280
     tacgggccaa gtatgtggaa agattttgta gagagcatcg aaggagggac agaatacaaa    128340
     agtgttgaag aattttttgg gctaggaaat tctgcgcttg ccagaaaaat tgaatctctt    128400
     ggagacttat ctgctttcaa aaagtatatt ccgttgaaca aaagatctta aatatggtgt    128460
     tttctgattt caaattaaaa gaatttattg aagtggtaaa aaccagattg ctttttattt    128520
     ttagaagaca atcttaagaa gcacgaaaac tccaaccaga gagaataaaa gtagcagaat    128580
     cgattggata atcttggctt tccaaagctt tcttcttcta gtaatactca gctgctcgtt    128640
     gacgagcatt ccatactgct caccttcttc aagatgttcc ataacattat caatgggaaa    128700
     tctggcgtcg ttgattgcat agtttatgta gttcgagaca gcgacaacct cttgaacact    128760
     tctagtaatc tcatctatcg agctcttccg actcagtgcc tccatatgca ttttacatgc    128820
     agatatctca ttatctagtt ctttataggg acttgaaatg catttgtatc tattcttcag    128880
     ttcgttatag cgtttcacaa gccttggagg ctgctgtcca cattcaacaa gacgatcaca    128940
     aatctgaaac atagcaggca gcttggactc gtcctctctg tgagtacctc tctccaattc    129000
     cttgatgctg ttatccagca tgtctatcct cctggaaaag gtcatttcat tcatctagag    129060
     acttgtttat cctgtcttac ctccagatga gtttgatgat ctttgttaca gattggtaga    129120
     tcataaacct atattcaatt tcagtcaagt aattcgctca ctccagcccg aatcttgaca    129180
     tgacacgttt ctccatttca acaatatctg ctaggattgg aagaggtatg tccatggagt    129240
     tgtgctcttc gggttccatg agaaggagaa ttcctttcat gtgtcctttt ttccttatag    129300
     cctgtcttgt gttctgaaac catttttgaa tggactttgg atggacattg ataagcaatg    129360
     ccaagtcaat aattgttttt gacgaaggaa acttcgatat ctcgaatatt ctattcagaa    129420
     cacatgtttg cagtcttgtc tttctcattt gctttccagc gcagtatcta ttcatctgga    129480
     atccactcag cttcagcagc ccaagtgctg cttctagctc tcttacgttt ttggtttttt    129540
     cactagccat ttttaggaag tgagctgagt ttctttaaaa caagttgacg tctgttcact    129600
     cactgatata ttaaattatt cttgaatgtc atgtattgta atgcatctta aattgcttgt    129660
     ttttacaaaa tttgaactct aattaataac tctattggtc ttaatttaaa acgaacagaa    129720
     gttaatcatc tccaggtctt aaaaggccat attggcaata ggataggctc tttaggcctg    129780
     gctcccactg aaacattcct ctctaaagac attctatgcc tctgttttat taaaatatcc    129840
     tcttctatgc ccctcaagtc ttccgtattc ataagctgtg caataaatgt tggaagaaat    129900
     ctaaagtgtt cgaaaaacat agaacaattt taattggctg ttcttttttg cttagtaaag    129960
     ggcaatagat taaataccaa aaatccatcg cagtaataaa aaccatttcg ctcaaattga    130020
     atcacatctc cttccttaat gtccacaacg gcagattcag cataccaata ctccttttgg    130080
     atggaatccg tgttgaatct cgctgccaga tcctcgtcgt ccccgtcagt catcagactt    130140
     ccatattcaa taagctccac aactacagat cccctcttgg aaacccacga tattttgttc    130200
     tttgtctgct tgaaatcacc ttctggatta agaatgattt ccatcttagt cacaattccg    130260
     tcctggacac ttttacttcg aacaatcgca tttccccagt tcatcaatgt aaattcttca    130320
     ttttcttgga gtatttgccc atcttcttga gaaagaagta ttaaacttga gtagaagacc    130380
     tcctttgtcc cgatgtctcc attcttcttg tgccttggaa cactcatcat atattccgat    130440
     gtatttttaa cagacacttc tacaacattt ctttgctgaa cgcagaaata tcttggtgcc    130500
     acaggatcaa ctcttttttt gttcattgcc cagaccttgt cccaagatat ggtacaggtc    130560
     ttttgagaaa ctccctgcat cagtatatat tctctgagaa cttccatgtt catcccaagc    130620
     ctccttattc ccgcaactgt tgctagcctt ggatcatccc atcccgacac aaatccgtta    130680
     tcgacgtagt acttaagctt tcttttacta agaacggtat tctcgaagtt gagtctcgag    130740
     aagtcatgaa ttttaggcct attacttaat tgaagattct ctatgaacca gtagtattga    130800
     ggatttctat ctctatattc attagcacga agtgacaatg taaccccctc cagactgtcg    130860
     acaatgggac atgaaaagtc ataagtggga taaactttgt acttgtcgcc cgttctatga    130920
     tgaggagatt tgttcattct gaaaataaca ggatctctca tggccttgtt gcagttggac    130980
     atgtctatct ttgctctcag acaatatccg gaggcttccc cgctgatcat ttcctcaaat    131040
     atccttttgc tttcctctgt actcatattc ctgcatttgg actcaatacc ctttcctctt    131100
     tcatccctca tttcttcctg tggcgtgtta tctgcatatg ccttaccctc atctatcaag    131160
     aaaaaggcca aatctattat cttttcaaag tagtcactgg tgtgggaaag agtgtattct    131220
     ctgattccca gaagatcgag atcctttaga attcccttct caaacctttc ttcctccttc    131280
     tcggggtttg tatcatcaaa cctaaccagc agacgtccat tccctttgct ggaaaaatac    131340
     caattcaaaa gtgctgctct tgcatgtcca atatggaggc ggccgttagg ctctggggga    131400
     aatctggtta taacattttc cgacggccca tctatttcaa ggttcccttg ctctttctta    131460
     aaacttgtgt taaactcctt aagcaggttc ttgttagcct tgaattgctc cgaatacatc    131520
     tcacagacat tcggaaactt ctccatttcc ttcttgtctt ttatgagctt ggtaagtgtc    131580
     gaatttatat tgatcattcc aaaaagaatg tccctcagct cgtcagagtc aatgcagctt    131640
     ataaaggagt tgagcgaaag tagaaaattc actccttctt ctcgattcgg atttatggtg    131700
     taggaatcaa gaacatccat aagaccggcc gggaaaattt ccttagatat ttttcccagt    131760
     gcattggaat acactggagg atcctctggc tttgtgccat atttctttag caggatgtaa    131820
     ttgataagct cctctttgaa ctcgcctttt ctattcattt tgtttaatgg gccaaaatat    131880
     tatctgccta ttcgttgagt ggctggccgc aatactacta gaggtattcc aagtcttata    131940
     caaagccccc gggatgagca aaattttgtt tgtagatttc tgtacggtat tggagagaat    132000
     aaaccagacc actaagcgct tggagatcca atcaatactt acggattacc tgaaggatgt    132060
     gcataaaatc gatcctcctt ctttggctcc agttctgtac ctgtttacag caacagtgta    132120
     tccagaatac ttcaataagg aactgggagt gggagagaat actttaataa atgttgttgc    132180
     tgagctcaca ggaaagtctg ccaaaaatgt taaaaaggaa tattcaaagg aaggagatct    132240
     ggggactata gcaatgaagt gtagagtatc gcaattgttt gtgttgaaga cacagctgga    132300
     agtaatggat gtgtttcttg gaatgagaaa ggtggcaaac gaggggggac agaaatcctc    132360
     tgcatccaag aagagaatca tcctcggaat gatggttaaa tgctctccat tagagtcgaa    132420
     atatctgata aggttaattg agggaagact taaagtagga ctggcactta aaactgtact    132480
     gataagtctt gcaaatgctt tttctagtga caaggccgac gaagtcaagg cagctttcaa    132540
     tagacaaccg gacataggga gattggccga atgtattctt gaatacggag tagaagggct    132600
     tccaaccaag ttccaggttt ctccgggagt tcctctgaag cccatgttgg caaatccttc    132660
     aaaagacctg acatcagctt tcaaaaaggt tgaaaacaag aactttactt gcgagtacaa    132720
     atacgatgga gaaaggatcc agatccataa gttcggaaat aggatagaaa cttttagtag    132780
     aaattccgag aagaccacag aaaagtatcc ggatttaatg gatctctaca atatatcgga    132840
     tagagatttc attattgacg gagagattgt tgcatatgat agaaaagaga gaaaaattct    132900
     tccgttccaa atactaacaa caagaaagag aaaaagggtg gagagcagta aaatagatgt    132960
     tcaggtgtgt gtttttggat ttgatctaat atactttgat gggaaaactt atattgacga    133020
     gccatttgaa gaaaggagga agattttgca cagctcattc aaggagatgg acgggaagtt    133080
     tcagtttaca gagtttaaag attgcgagac tccagaagag tccgagatgt tctttaatga    133140
     gtctgtcgaa aagggctttg aggggatgat gataaagata ttagggtcgg atgcaaccta    133200
     tcttccatca cagagaagta acaaatggat aaagataaag aaggattacc ttgagggaat    133260
     gtcggattcg ttggatctgg ttgtgatggg agcatattat ggaaagggaa agagagctgg    133320
     attctatgga ggattcctac ttggagtcta caatgacgaa gaagagaagt ttgaggcatt    133380
     gtgcaagata gggacgggat ttgatgacaa tattctatcg aggctttatg aacagctaag    133440
     tagtaatctg tgcagtgcac caaagaacta ctcatacaag gagtctgtta agccggatgt    133500
     gtgggtagaa gccaaatatg tgtgggaggt caaggcagcc ggactttctc tgtcgcccat    133560
     atacaatgct gggggtaata gaaatgaaaa gggaatatcg ctaaggttcc ccaggttctt    133620
     aagagaaaga gaggataaag atgtgaaaga agtgaccaca tcttcccaga tttatcagat    133680
     gtacttagac tctaaggttg agaattccga agagttctac taatcaattg gtgtaatatg    133740
     ttttcaaaaa tttttaagtt tgtgttttag ttttcacccc aatggagcat atgaaaagtg    133800
     gctttgaaag tcctcaaccg aatgaggaag acctttctcc aaggtctatt attgatgaat    133860
     gcaactacta cagatcgact ctgacagcca ttcccgaaaa gcaggattta gtaagaacgt    133920
     ctggaattcc ttttgttatt aatgtgatac tagaaaacta tgaagaagaa gaggttccat    133980
     tgtgctcgga cgacataatc cgatgtgaac gctgcaagtc ttacctgaat ccttttgttg    134040
     agattatacc tccaggtctg aagtggaagt gcaatctctg cctgacaatc aacgatctgg    134100
     caactgcctt tcaagttacc agcagaggga tatctcggac tagtagtctg tttgacccca    134160
     aggtgaatgc tatgcataat tacagctact acacccgagg ggagctgaga agtactgttt    134220
     atgagctaga agcaccaccg aattactcgc tcaaaacacc atcccctcca ttaatatgct    134280
     ttctcataga agtgactttt gaaagcatga aatatagatc tgttgatgca gttataagaa    134340
     gtattctagg agggctgaac ccaaggttct ttgatccaag gtctcgtatg atgtttgcat    134400
     tcttcgactc gtgcatatac cttctcagga aaaacggaga cttctccgta atctcggatg    134460
     caacacatat tcctttcttc ttagaagagg acttcttgct acctcttgat catcgcttcg    134520
     acgttgatgg gatagaaagg ttcttcatag aaaacaagtc tacaagaaac aattacggag    134580
     atgcactaag gattgtccag aacatcctcg gtaccactgg aggatgcata atctcctttc    134640
     tggcaacata tccaaacgta ggcccagggt gtgtggactc caatcaacat gagctaagat    134700
     gcaagtcggt attttacaaa gaaatatcgg tgtatttgtc gaagcaaggt atatctgtga    134760
     cacagttttt gtttccccga cttggaatag aacttcctac tcttagtgta ttaagtaagt    134820
     atacaggagg aatggtatac tattacccaa acttcgatgg aaccgatcct acatttgcca    134880
     caaagttagc taatgatctt gcttcgcatc tcgatttgaa tatagggttg tatggaatgt    134940
     gcagagtcag aaccagcaag tgtgtgttta taaaggagta cttcggatct ttacaccata    135000
     ggtctgagga tttaatatcg ttttccacct tctttcctcc tcactcattc agttttgaaa    135060
     tagacatatc caaggaagaa gggacaaggg gcgtttgttt ccaagtggct attcttagaa    135120
     cacttcgtac tggagaaaga agaatccgag tagtgaactt ttgtattgaa aaagtgtcta    135180
     gatcattgta cagtgttgtg gatccttatg cagtagcaca tgcatttgct ttgaaagcct    135240
     ttttcttcga gtcgaggaca aagggaggag gtaatgagta tctcaataag tccatgaagg    135300
     atattgtcag attgtacaag cagctttcca atacaacaac ccttttacct gcaacactcg    135360
     aggtgcttcc gatgctcatc ctatctcttt gcaagtctat tcccctcaga cctgcatctt    135420
     atacaccaat ggactacaaa tcctactaca tatacctgat tagcaattcc tacccaaagc    135480
     tggttgatac agtgatatat ccaactttac tcgctttaca tcggctggac tctatacagc    135540
     cacttaacct aactcttaac tgcctcgaga caaacggatt gtatttacta gataccggtg    135600
     tgaccatctt cttttttgtg gctagagact gcgatccatc tctcccgaac ttactgttcg    135660
     actcgtccat aggatcggaa agatttatct tcgatcctga aaggaacgaa tttagtgatt    135720
     ctgtatgtaa gataatcaaa gagttgagaa gtaataggca tttaactccc aactatgtgc    135780
     tggtgaggga cgatggcaca agcagcatat ataaggacat attcttcact tactttgtgg    135840
     aagacgagtc tcacggcctt ccatcctatt ctaaatatct tgaattgctg agggcttaat    135900
     aaaactgttt gaaatctctt atcatattcc atggactgct tgaaaagcca tgcctggcct    135960
     ccccccaatg caaagggaat tggaagacct cataacaaag ctcaaaacaa tggcaatagt    136020
     tgataatcac gaggactaca actatttagt gtcgtgtaca gacaagtacg acaacaaagg    136080
     aaagatattt gagcttctga gaaataggaa caatgcacct ggggagatgg cacctctact    136140
     gtttacattc acatcgaagc tcgggacgga gtctgacgaa ggtctgcttg ttcgaatcat    136200
     tgacttcatc agaggatgca gaagagactc gagagagacc tcagaatgga tggtcaagat    136260
     cctatttttg attctggaaa aagtcaaaga gaaaaggaag gattctgcga taaggctaag    136320
     gcttcttgaa tgcattagga tttacagcca ggacatagga ttggtcaacc acatgatcga    136380
     tcttatgtgt acgaagagta gctccgagat tatcgggtcg atacttgaat ccattccctc    136440
     agtatctcat gagtttattg aatgtgccat gaagcaagat aatccagctc tgctgaaaaa    136500
     cctgtctctt gttcttcctt ccttatctga aaaggatata agtctgtttg taaactacga    136560
     gtcctttgaa gaatttcttg agtctgagca cttttttatg aggaactgct tcctggaaat    136620
     atgtgcaaac cttgtagagc actttaagaa gaaaggaatg gttgagaaga tgaacgatct    136680
     tataggaatg gttgtagaga ggttatctga cacatatttc ttaactcggt ataaggctct    136740
     tcaggttcta gaatgtctct tccaaaggaa ctcaataggc gtaggaagaa gacatgaaat    136800
     cattcgggag attggaggtc gggttctgga caaaacggtt gtcgttcgaa agaaggccat    136860
     agggatttgt tctggcttac ttatgagcca tccctttgca tctgaaaaaa gtcttgaaaa    136920
     gaagaatttc aagccaagcg aggatgaaaa caacagtaac tatcctgaca ataagaaaaa    136980
     agaggttgaa agaaggtatc atgaagactt gaatgagttc cacgacatca tgagggaaat    137040
     acaggacaat gtcataattc tcctgaatgg agagactaaa acagaaattg ccgaatgtgt    137100
     tgaatttgta aagctttcct tctactataa aatagatggg tccaaagagg catttgaatc    137160
     actctttgat cttgtatgga cccaagacca ggaactcttg gttctgtctt tcaaagacct    137220
     tattatgcag atgaagatga gcaagatcag cttatttggc ttcttcaagg agtttataag    137280
     gaaggaagga aatcattcgt ttgaaagaat gattagagaa ctcagtacaa ggaggtatat    137340
     agataagtca tttgtggggg agctatacaa tacgtttctt caaggagctt atctctttga    137400
     aacctcttat cttttaaggc atataggaag gcctgttccg gtagatatgt tccactcgtt    137460
     ggccctgtct atcacaaatc ttttattctc tatccaggag gaaaaggatt tggttgagat    137520
     gctgtccgtg tacaaaaaca taatacagat caagatacgg gagagggtgg aattcgatgg    137580
     tgagataata gaaatgctca ttaagaacct tgtgaagatg actttctttg aacatcaggt    137640
     aaccgagata actgtttctg tgatatattc aattagcaga tttcccgaga agagcattat    137700
     catgctactt gaaaagcttt gtatgatgga aaaaagcatg ctcaaggtta tttctgcagt    137760
     aggatatatt gggctgaaac acatgaagta tctagaggag ttggaaagac tggtgaagtc    137820
     caacaggata aaagtcaagg tggataaaac agtaattact cctgagatag tggagaggag    137880
     aagaagtata aatgcatcta gacagagtat tagcaccatt attgaagaag aaagggatgg    137940
     gaatagtaca attctaagcg accctgggtt tagcaataat atttcctcta ggattggaga    138000
     caaaagtgaa gaggaaatca ttgacttttt cttctacatt aaggagaaag agatgctata    138060
     tggaaaaagt attctctcta tcttcaaacg aattgttgaa gatggatgcc actccaatga    138120
     tgaggagata caggtttgct cgtatgtttc cctttacagg ctcatgtgca ttagctttga    138180
     attttttacc gagcattacg atgtctttgt caggtctatg aatcatccgg tctctagagt    138240
     tagagcaaat gctgttgttg caatggggga ttttctgttg aactacaata ccgttgcaga    138300
     acaacatact tatcttttgc ttgaatctct ttctgacgca gatgtagatg ttcgaagaaa    138360
     tgctcttctt gtaattcaca atctgcttat gaagaacatc cttaaaatca agggatatgg    138420
     ttccaaactt gcagttcttc taatcgatga ggaaaccgaa attcgagaaa tggcagaaca    138480
     ccttctggtg cagatatcca agaaggagaa tatgatgtct gtccttctct acgagacaat    138540
     aactgcaggc aatgaccaac tatcttctgt tataggattt tttagagatt tggtaagcga    138600
     aaaagtcaag gagagtttat tcttgaaggc cttgaagtca aaggttgaac cagaaacctt    138660
     gaggcttctt cacagtgcct ttgatttgga tgaaaaaatg atggaggtgg ttagactcct    138720
     cgacggatct aaataaatgt tcaaagccta agtccagtct atatccaaag aactgatcta    138780
     gctatgtatt ccagggtgcc tttttgaaca cctttatgtt gggaattttt ctgtgaagcc    138840
     tcctatatgc ttcatgtatg tgggaaggaa gaagagggcc ggtctcttct ctttctccct    138900
     gaacaatctt tgccatttct atcatctccc ccacaaatac ctttgcaagc ccacaaactg    138960
     cgatgacgaa atttggattt acagcctggc ctattacgct gcttatatac tttttaattg    139020
     cagcctttgg aaacccgctc cctcgaaact tttcatacct gtgcaattct tcctcagtca    139080
     ttgtccctgt aatagaatgt agacgcccag gatcctctct cttgtatgta gaatcgtctg    139140
     tcatgagatt gaggtcgtca gattctgtgt ctgactgaac gtctttagtg ttttggtcct    139200
     tttctccttc ttcattactc tcgttcattt cgagggttaa ttttcgagta gagataggcc    139260
     catgataata agaatcgatc ggaagcacat aagtagttct attgaggagt ggttccaact    139320
     cctgaagtcc aacaacgatt ctttggagga tggaaagacc tctggatgcg atccatcaat    139380
     ggagtacgaa atagaagtaa aagaaagtat cgggaaaaaa atagccttgg ttactgtaaa    139440
     cagggttggt ataaagcatg aagtgtcttt ggataagatc gaagaaactc ttctggaagt    139500
     tgttgggacc cttcttggac atgaactggt ggttattcat ggatttacag ttaaggatca    139560
     aagcggagaa aagacgaaac cgattattcc gatcttcttc agatcgactc tcgggattca    139620
     aattcccaag agaatggggt atttaaagaa cgatggagcc ggaattccag agatcgacga    139680
     gagtatgatg gttccatttg tgcataccag tccaatttta aagtcattac taaactcaag    139740
     acctttgagg ttctcaggcg agggtgtaaa agctttgtta gttctctaca acggatctac    139800
     attcatcatc ccagatacag ctagaattat tcctatgatc cgtggaatgc tttccaggga    139860
     aaaaatggga gagtttctca agcttctcaa aaagttccca tttaagtttg ttgaaacctt    139920
     tataaaagca tatatgcaac cttcttcact tgaagttaac aaggagttga gtggttgctt    139980
     ttcagaattt caaaacaacc ttaccaagct tcacatcaaa tgcatacaca agatagtatc    140040
     taatgctcct gtgtttttgg atgctcggga caagattact gaaagaatcg agaagtttta    140100
     tatttacaat gcaaaaggat ttaagagaaa aaggggggaa tatcttaagt gtagagagga    140160
     gctttacata gacaagaatc ccattggatc tttgaagagg tatttccgag atctctaaaa    140220
     agcagttata gcaagcctgt gtattgtacc catggtaagt gtattaacct cagtagatga    140280
     tgtgaacaaa gtagtcggag acacatcttg cagacttgta gttataaggt ttggagacaa    140340
     agaagatccg ctgtgcaccc atacagatgc acttctagag aagatatgtc ctctcctttc    140400
     taattacgtt gatatatatg tttgtgaaag aaactcagta aaggaacttg aagaagtgat    140460
     gaggttagac tcgcctttga atatcatgtg tttctttaac aggagacata taaaaataga    140520
     ttgttcaagt ggagacaacg acaaaataaa tttcctagtg gagaatgaag aaatgcttgt    140580
     agaaatattt acactggcat acaaggcagg tgtaagagga aaaggaatta taaaatctcc    140640
     gtttaaggtc caagagctgc aaggagaatt ataacatgct agatatttat caaagaaaat    140700
     cctcctagag gagcacaatc gaataaataa atcccttatc gaattttttt gaaacaagag    140760
     gagggtctgc tctgagcatt gtgttaagaa tgtcgacaca tctgtatctt gagattcctg    140820
     tgtttttgat aatttcttcc agcacggctc cttctctatt atcataaaga aaccttgcta    140880
     tttttgcagc attgttcctg aatagcttat taccagttgt ggtggatccc attctttcta    140940
     taaactcctg caagctttcc tctcctctta tgtttgagaa agatgatgtt gtctcttctt    141000
     tagttttttc cttaggaata actttcttag gaaaaactat ggtttgggaa gtcttgtcca    141060
     agtctagatt gtgctcaaca ccacggattg tgtatgcgtc aaaggctgcc agtagtgcct    141120
     ccaccttgta gttaaactct ttgatgtggg agctactttg gattattact tcgagtttcc    141180
     ttttgacttc actcactaac cttgagattt ccttaagctt ctcatccatg ggataagacc    141240
     attgatggat aatatcttta agccccagat ccagcttcca aaatcaaaaa acagcttctt    141300
     tatgccccca tgtctaacga tgacttagga acctggctaa aggcagctgc tgaaaacaaa    141360
     atcacaacaa agaatacatg gaagtcaacc ctaattgacc actttacaaa tatagatgag    141420
     tttcgagaaa aacaagggat taactttcag aaggccagct ttacgttgga tgggtgtgcc    141480
     aaggtttatt cgacgcgtgt agacgacgtt tctgaaaatg caatgagact tctggaagga    141540
     tttgggagag aagaagggaa aaagaggcaa gctaaaaaga acaaaacaac aatagaaaag    141600
     aacattctta atcttaatat caaagtaagt gcgtcgagaa ggctggttga tccgaagttt    141660
     ctgtacttgt cgtcgttggc tgagaatgct ttaatgatcg atgcattggg aatttcgtca    141720
     gacggaatgt ttaggatgac gtcttctagg gattgggaga ctgtagttgt agacgatctc    141780
     aaactatctg taaaccttcc tcagggactg cagatttctc ctagtataaa cgaggataaa    141840
     gagataaagg atattattat cgaccctata gtaggcaatg atgacgagtc ctctggggga    141900
     tcggggggtt ttgggattga caatcatcct gacttctccg agtttcctcc tactgcggat    141960
     aaccagaatc ttgcttacaa agagacttcg ttttcttatt tcaagggatg ggcagggcca    142020
     aatcactgga aagtacaggc aaaaaaagga aagggaggat cacagaaacc caaggaaact    142080
     tcttttttgg actttacaga aataatagac cacgagggca tacttgaggc aggaaacacc    142140
     ctctttgagc cttctttgat agtagagcgt agagaaaacc atcatgtact acctcaggac    142200
     tttagattgg aggtggaaga tctgtacaga tatctagtaa gagatgggct ttttcatagg    142260
     aaagaccaaa gtcatatgga tgaaatctct tttgattact ctccagatcc gtgcattgtg    142320
     gaggaacctg aggacgagtt tataactgat gctccttctc agggaaacca aagaagcaca    142380
     gtcccgctta gaaagacatc caagaaaatc aacatcaaaa agctgaagga taatgtattt    142440
     gatttcgtta gagagggaag caccagtttg ctttccatat ttaaaagtgt acccaagata    142500
     tatgatagcg aagagtctaa agatatttct atgcatcttt gttttatttc tcttcttcat    142560
     cttgccaatg agaagaatat tcaacttaaa gacgtaggag atgatgtaaa ggtatggata    142620
     tcaccagatt caagaactta gggataaatt agcttcttca ctgtcctttc tctatgaagt    142680
     cccaagtggg gattatgctg attcttctaa ggaattctgt ctcctcgcca aatccgtaag    142740
     ttagtcttga gtagaggaag aaaaatacaa tcacaaaaaa cgtaaacaca gcaacaaatc    142800
     ccaatctggc aaatttcatg atatagcata atgaaaacaa tgcaaaaaac aaggcgggat    142860
     aatagtgatg gaagtacagc actctcttaa caaagaaaaa gggaatgtag tgcaggagcc    142920
     atccacaaca agacagaaaa accatgtatc cttcgttcct taggaatgcc agtggtttcc    142980
     cctttcgctt tcggctgatt actctgcaaa gaagaacaat cggtgaaaga atcacacaaa    143040
     ttcctgaaga gtaccataca agtggatttc caaacatata gaacttctcg ttctgtccgt    143100
     cccacgcggt cattcttaat cctcttttga ggatgaacca ctcatatggc tttgaaacaa    143160
     ttctttccgg ctccagatct tcatcctgaa tgaaagaagc atttgtaata aacatagcct    143220
     tattatgctc cacaaacttc tttgaaaatg gatatcttgt gatctcttta tacacaggat    143280
     ttttctcttc gctcagcttt gcagatgtgt tttcctcgac attccaaaga gttgcctcgc    143340
     ccttcttggc tccacagatg acctctccct gctcaaatcc ccacgaagga tattttcttg    143400
     atgaaggctt gagatagcag ttatgtttgg tgctgaacag cctgaatttg gttgtaagag    143460
     tttttactcg gccctccttt tttatggcgt cttctactat ttctattttg aacaggttcg    143520
     tatcggaaag gtggcttcct gaggactctg ctctcaaacc acttgacata agagaatggt    143580
     tgcctggaat gtccaaatac ttcctagtct ccatgtgcag aagaacaact gtgtcacctg    143640
     acgaaatgaa ctctgcatct tctaggtcat cagtcacctt ttgaagtacc caggcgttgt    143700
     tttcgtcctt atgatgatag atggttactt gattattctc tccgttcgga tacttgtggt    143760
     cgtgggaatg gagatatcct cctcctgtct tggaggactt aattgtcacc ttagttccaa    143820
     acaatggata ttttctgttg ttacctatgt cacttccctt gagggttgct tgaaagagtg    143880
     agctcatatg tccatcgtcg ctactactcc tgtttaccat ctcaaagtgg atgtaaaaca    143940
     atagaacgta caaagacgcc ggaatacaaa tcagaaaaaa cgccttcata agaaacagct    144000
     tggcaaatcc caaaatgctt tctttagagg taatattaca ccatagacaa tagatggtaa    144060
     acaatccaac caggctcatt gtcaaaaatc caatccactt aatgctcagg acgcagccca    144120
     aagttattcc cagaagagaa atagaggcca aatctatctt ttccttagat ctaaagtaca    144180
     ttctagtcat gaagtatgca actgcagccg taaatgtcag gagatgggag tccaaaagta    144240
     ttagtcttcc aatggatgta aacccattct caaatataaa tattaaagaa agaagaattc    144300
     tacgcttgta tgaatacttc atttctttaa gcattaggta tccaagaact ggcataaaag    144360
     acgctatggc agaatgaaat ctccgcattc ccgaataatc aaatccttta ggaaatttct    144420
     ctcctgattt aaattcgaag tccagaggtt ggttaaaaag atatcctcca agagaagtta    144480
     gtatcttacc gaggggagga tggacatcaa agtaaaactt tctggataga tatttctccg    144540
     aaaacttccc aaaatgggct tcatcccata caacaaagtc tccgttctct atccggtagg    144600
     ttttcataac tatactcaat gtgaatatca agaggacggt agatatctca aggtatttgg    144660
     actttgccat tatatttttg ccttttctcc tttttaagcc acacctgaaa catgtttcaa    144720
     ttgtcgatca aattacttta atcacctcga tcttccctgg ctgctgaaag cctttctacc    144780
     tttcctccaa tgaaatctct tattcctctt tcgttaatcg tatgaaatac attcttcttt    144840
     aaagcttccc tatccaactc tagaacattg tctttacact ttacaaataa attgaatagg    144900
     gccacctcgt tatagaacgg atggtctata ttacacagat ccatttcttc ttcaggcctg    144960
     tcataaagaa taaagttaag catcttccca tattccctat ccagactact caatgaggag    145020
     gttgtcttat ttctggtgca gaagtcataa tgaactcgga gagcaaaaga aatgtctcct    145080
     gtgattccct tttcgctttt aagaattcca ttgatgattc ttctttcgtc tgatgtattt    145140
     tcccgattgg cagatgattt gagcataccc attatttttc tctttagaga tatctccgga    145200
     ccaaaatcca taccgggatc aagaatactt accagcttat cgtatccgta aatatctctt    145260
     ttcgccagat tcttccatgc tgtcttcttt ctctcgatgg cttccttaat catttgctgt    145320
     ctcctatttc cacaaatgac ggggttgtat ttcccccgag taaccaagga tacatacagc    145380
     ttcaggttct ctgatctcct ctggccctta aaattactcg aggatcggag gcaacccttt    145440
     ccacatatga tctttttctc ttggcattcg gatgcagata tagatgtgat ttatctgaga    145500
     ttcttattct tacagctgta aacttcgttc tgtttcctac tagcatgtat ccctcacaca    145560
     aacagataga aacctttctt gaaaagaaga tcccataatc caaaatcatt cgctagggtt    145620
     ggttgaaaaa ttaaaaacac cacatccaga gtcatcgaaa caagtgtgaa aatatataat    145680
     ccgtgctgta cttcttttcg gcagacactt ctcccttata gttcttagat acaaagcagt    145740
     gtgtatattc attcccttct gtaattgttc ctcctccgtt tacgatgact cttgcatagc    145800
     tttccctctt ctgttcatca cagtacagtc taacaatcca tctgtggaat gctggcttcc    145860
     ctttggatgc cactctttct ctccattttt tgattgaggc cacaatcttt ctctcctttt    145920
     ctggagtatt ctcgtctgca gtccattcat acttaccgaa atcaaagttt gccgagttat    145980
     caaaattatc tatgaaatca ggcctgagaa tccatcctcc attgcacaag cacgataaaa    146040
     acttttcgga cgtacataca ctacccatga tgagatgggt acatttctca tatcggtctc    146100
     catcactata ccttaccctt agtttttcaa atctctcgat tgctttgctc ttcaggattg    146160
     gagataaccc tgtaaattgg aacagcataa atctagaagc aaagatcccg gtctttctgg    146220
     acatttcatc ttttttgttt tctataaaca aatttgaagg ttctattcct atcctatact    146280
     tgtcttcatt cacatatctc atccgatgca gacactggtc aacccatgac agtaatacga    146340
     ctttatatgg agtatgtcta tttcctgtat attctttcct gtctcttatt attagatgtg    146400
     tacagctcgc atcaacttct tctttcacaa tcgctcctaa agctcttagt ttattaaaca    146460
     cttctacctt cagttccctc agactcgcgt caatgcagca taccgcttca ctcagaatag    146520
     cattacttct tccaaaataa actttatagg gcccaggaag taaaatagag tctgtctcaa    146580
     cgcaatcgaa aacatactga tagtgaaaga cctttccatc atgtctctta aattccccat    146640
     gtgattccgc cactatgaaa tcaacatctc tatcaacaac cgacacacgt gttcctccgt    146700
     tcgatataat taatcttctg agacgattga aaaggatctt tggaagcttc gaatcaagga    146760
     aaaatacctt cccgttaaac aaaggttcgc cggctgagtc tatggcttta aaatgaggtt    146820
     cctttttgta tgctccatag tcatttccaa acacagaatg ggatgtgaca accggaattc    146880
     catacttctt acagaactct gtcttctcat tgcattggga attagtaatc agaaaatctg    146940
     tccaagcagt aagattttcg gtgaaggatg cgccaagaag acaatggtaa ttgataagag    147000
     agtcgtcggt cactccggag attgtaaaac tagaccctga aagtggtgtc atctcatact    147060
     tctttgtgtt ttcatctgta tcgtacaacc atctgacatg gagaatcttt atattccatt    147120
     tcaaagcctg gatatacttc tctgtcatca ttgccttgta ggaaactagg taatctgtag    147180
     tggtggacag cgtatcctcg agaatcacat gttttgggag ctggctcctt attaagtcct    147240
     gttcatctct tgaaattccc gttgtgcaca caaacacatt tggcttgaac gtgctctgga    147300
     tttcaaaatc cataccctcc tagctctaat tcatggctaa atataaaagg tgatcactac    147360
     tccaaagaat accaaacaaa gaatttattt ttcgcttcca ccggagacat gctctaccaa    147420
     cgcagaaaca acgtctcctt tgtttctcac atctctaagc ttcttgacct tcatctcaaa    147480
     ttcggatttt agcctttcat caactacttt tatgtattcc tcaacttcct tttctagaag    147540
     aagtaaccta ctttcgtttt cctttctaag gtcctcaacc atcaatcctg catctcttct    147600
     cgcttgagcc ctcatctcct caagctccct acgtgccatc tctagcttct ctttggcatc    147660
     gttctcgcac tggacaagtc ttttaatact ttcgacagac atacccctgt gttgggcgcg    147720
     ttgcttgtct tttataagcc cgagtgttca aacccaacat aaagcaaatg tgtttatttg    147780
     tacaaaaaat agacagatat tttcttgtaa tatttatttt cgtcgtcttc cgtatacaac    147840
     tctgtgtatt ctcccaaaat acaatgtctc tcctctcctc agaaaatata agaagaccct    147900
     tatttttctt tttcttcttc ccatgcatac aacctctgcg atgttgttgt tttcaaactc    147960
     gatgtccttg tctaggtatt ctgccatatc cggtgtaaag aacaatcttt tatcggaata    148020
     tgcaattagc ttcaagttgc gcgtctcaaa gcattccatc aatcttttaa aagtcaaggt    148080
     cccatcgtaa agaactccat accaatgata ggagcaggta cgacatcccg gatttctttc    148140
     gcatgtctct agctttcgga tgatatttcc attgtcgaca cagtaataat tgcacttatt    148200
     cttaacagat aggatcatca gggatgcgat tattgagttt attgtgctca aagacggaat    148260
     tatattccct gctatcgtaa ctgcatcgtc aaaggataag ggtttgattc ctgcacacat    148320
     tcctcttatg tatgccacat tgtaaatgta ttccaaaaca tctctcttgt ctttgtcaaa    148380
     cgagatgaga tccgaacttc ctaaaatctc gactattttc ttggtttttt ctttgtagtc    148440
     ttcactgctt ctgaacttct ctaactcgcc tggagtcgac atatcttcgc aattttctat    148500
     aatgtctttc agatgtcttg gataaaagtc ttgttcaccg tctaccttca acttcatttc    148560
     gagaaacacg tactttgccc aggaaatgca atgttcaaaa ctggtcggcc ttgatcggat    148620
     cgtgcacacc agatgctctc ttgaaatcct ctttggaatg caatcaaaac attccgagtt    148680
     gtagtcgaaa taatacgcct ggcccttgaa cccaccgctt cctccatcaa ccaagggtgt    148740
     ttttgagata aagcatcttt gattcacata acttcgtact tcgatactgt ccaaacagct    148800
     atagactgtc tcatactctg caaaaaacct tgcatcaaat tctgtgatgt ctgcacatat    148860
     tggaaagact ttacatttct tgttcatttt cctaaaaact ttggctgcta caattgcttt    148920
     actttttcca atgtcttttc taccgaagaa aaactgccgg ttaaggtttg aaaggtcaac    148980
     gttatcgcag tctatcaatg ttatactctc taaattcttt gttgctagca acttcagcaa    149040
     ttcacatcct attcctccac accccactac caagactctt ccacggatca tgcaaggctt    149100
     ctggtaatgg ggcttatata gactatgcaa tgaacattaa agataaagca tggaatggaa    149160
     atccatatga aatagcttta atccttcttt tcatcggaaa cgtagaagat atttatggtt    149220
     ccttgttcgg agctcagctt aagcttatag aaaccttttt catatcgagg atattccatt    149280
     atggtttccg aaggtgcctt aactgcaaaa acgaggtttc catctagaga aggaaggttc    149340
     tggaggtctg agtatgtaac atatgcattt gcaagattct tttccgactg ggaaagcatt    149400
     gaaatctctt cattgagcct gaaaagggtt tcgtccagat catcgccttt tagaacattt    149460
     tctggattta gataggaatt ctcctggttt tccttttctt catcatcaag taaataccga    149520
     tctatgtttc cgccaatcca ctttgcgttg cttacagacc atttactcaa aagtcctaat    149580
     ccttccaata cattcgttat gtcgtatatt cttctctttc ctacattcag ctctatcgat    149640
     gcctggtgaa tgcttatgtt atggtctggt gccatactca caagctttag aaatctcttg    149700
     gtaaggttgt aaagcgagtt ttccgatcta atagacgaca atctgtccga agtcgatttt    149760
     cttgccatga gggagtttcg gcagaaatgg ttttagtcga aataaggaag caagtttttg    149820
     atttggggca attcccacac acccgaaaat gaaaacctaa agcatcaggc agttgcatac    149880
     atggcagagg cgaaagcatg ccacacttga gaaagactta aggttcttat aaatgttatt    149940
     aatttctcca ccctttatga ctaaacagaa gtttgggcta acagccaaaa aagaagaaga    150000
     tttttccgaa tggtatgtac aggttataac aaaaggagag atgatagatt actacgagat    150060
     taaaggatgc tatgtgatgc gcccccaggg acagtttgtc tggaagtgta tccagaaatg    150120
     gtttaccgaa aagattgaag aacttggtgt ccaagaatgc tattttccca tgctagttcc    150180
     caagtcgacg cttgaaaaag agaagaacca tgtggaaaat ttttcccccg aagtagcatg    150240
     gattactaag tgtggaaatg aggtcttggg agatccagtt gccgtgcgtc ctacatccga    150300
     aacaataata tatccttctt tttctaagtg gataagaagc cacagagatc ttcctctaaa    150360
     aataaaccaa tggtgtagtg tgctgagatg ggagctacat gggaccctcc cttttataag    150420
     agggaaggag tttctatggc aggaagggca cacagctttt ctgacgaaag aggaatcgga    150480
     tgtggaggtt tttgcaattc tggatcttta ctccagaata tactcggagc tccttgcagt    150540
     tcccgtgata aaaggaagaa agtcagaaag cgagaagttt gggggagcag attacaccac    150600
     gtccattgaa gcctttatcc ctggatcagg ccggggaatt caagcgggaa cctcccattc    150660
     cttgggacag aacttctcaa aaatgtttga tattaaggtc gacacagaag aaggatccga    150720
     aaatagcagc tttgtctacc agaactcctg ggggctaacc acccgatcca ttggaattgc    150780
     aattatgata cattcggaca accttgggtt ggtgcttccc ccaagagtag ctatgattca    150840
     ggttgttgtt attccctgtg ggataacagc atcctcttcg gaagaggacg ttgaaagttt    150900
     acgcacatac ataagcaaaa tacatgccca gctcaaaaac ttcgttcgtg tgcatgtgga    150960
     cgatcggaat aatgtaactg ttggattcaa attcaatcat tgggaaataa gaggggttcc    151020
     gttaaggtta gaggttgggt tcaaagatat ggctaactcg gaagcttgct tagttagaag    151080
     ggacacccgt gccaaaaagc aggtatctgt ggaggatatc gggcagacag taatggagga    151140
     aatagatacc atgcacaacg atatgcttag tagggctacc acagaaagag ataggagaat    151200
     ttcatatgta agaagcttcg aggagtttat gtcttctctt gaaaacaaaa aaatgataat    151260
     ggcaccgtgg tgtggagttg ataaatgtga agccaacatt aaatctaaaa ccacaaagtt    151320
     tgggcccaac ggaaatgtag tttcgactgg ggcaaagacc ttatgtattc cttatgaggc    151380
     aaagtcctgc aatggaatgg aatgtatcaa ctgcaaccag aaggctatcc attatgcttt    151440
     atttggaaga tcctactaac ttacaagtct ctgtcgctac cataattatt aaaaagacaa    151500
     ggaaatatta accgatttac attccatgga ataattcttt atattaagaa aagatatttc    151560
     tcctcaatgg aagaagggcc gtacctggcc caatcgcccc tctggaagtc atgctaaaac    151620
     ctgaaatctc tcttccaaga gaagacaacc ttctggagta tggtttttgg gctcggcctt    151680
     atcaagtatc cttttttcca gcagagcttt gatttcttta tacgactcct cgtgggattt    151740
     gggagaaaca atttccgaag aaaagcggtc gagaaaatga atggcaattc cattagtcca    151800
     tccaaatccg acttgcgccg tatattcccc cttatatcca ggtgacccaa ccatctcaca    151860
     actatatttt tcaaagatcc ccctctttgt ctcgtcaaca acggatgtag aaacagatat    151920
     gttttctaag taggatctaa ccatatgtaa tgccatttca cgctcaccca ctctttctaa    151980
     gaaaaacgcc actatatgca caaggggagg ccacatgttg ggaaaatccc attgtaaggt    152040
     actgtcctta ttcttagatc cacttgcagg catccctccc ggatgtccaa atatatcttc    152100
     tgcaaacata ttcaaaatgt ggtaaacgct gacacctttg tcttttggag gagggatccc    152160
     atagcacatc ggcattaagt ttgaggcata gaacccagga gatgtatgct ctcttgtttc    152220
     aatatcaaag tcattccata caccttgttg atcgttccat agcacattat taatggcatc    152280
     ttttctttct tcgctctttt ctttgaagta cttagagttc ttggagtttt ttccttcgat    152340
     tatctcatat agcttcgaaa tgatacattc attggcatac attactgaat tcagatccgc    152400
     aggaatcctt ttggagactc ttatggaatc aagttgcccg cttaagccta gccatctgga    152460
     tgaaaagtcc catcccgatt cggctccggc ttttaagtcg gcataaatgt cttctgctct    152520
     tcttctgtac ttctcatctc tgctcttatt ttgctctgca gtttccctgt cttcactata    152580
     agactctgct cttggcgtag tatcgttaac cttgtaaaca ttaagtacat acgactttcc    152640
     gttcttttca accctttcaa ctttttgggt catgaagaaa gtatgctctg ttactgccgc    152700
     atccaatccc ctcttgatag tgttttctat cttctcccat ggtaagtgtt tataaagagt    152760
     gagaagcatc tgaggaaagt atggaggctg agacctgttt aaatagtatg tcctaagtcc    152820
     attaggaatg aatccaaact gctctatcag acctataaag ttctccacca ttcccacggc    152880
     aattttttcc ataccgcttc tgacaagtcc ttctaagatc cagctactat cccaataata    152940
     agcctctttg aatcggtctc caggaataat aaatggattc ttgaccttta tcatcgttga    153000
     atactgtcct ctcttcaacc tattctgcct tacgtagatc ttaccccatg cattttcgag    153060
     ttctttcccg attctaatca agtttgctat agattgtttg tattggctgg tctggaaaag    153120
     aggattggag ccatctgaaa gcttttcctc aagcttgatt atatagctcg aggtgttctt    153180
     gggcatatct gcctgaagct ctttatcatc tttaccaaat ataagttcgg tctctggctc    153240
     aaaactattt tcatctacaa acctccaaaa atcctcctct ttttcaaaag atctattttc    153300
     tcgaagcatg tttctaagaa tctcatcaat ttcttctgga ggcttagtaa acaccttatc    153360
     aaccaaaatc ttgctatcct ttgtaatctt acttacaaaa gaaacctcga gaagttctga    153420
     actcattcgg gagccaggat ccataattcc ggaagccctt acggggatta ttgtacaagc    153480
     ggcaaggaaa atatagcgca attttacccc ggaagccatc tccatttcta acctgttttt    153540
     tgcttttaaa catttgtaat agtttattta agttaaattg tgcaagctaa attattctat    153600
     aatcattcct ggttattggt gagatgtcat cttaagagtc atccctaaaa ggaagtttaa    153660
     tatcattata ttgaatttac ttagaggagg tgtgcagctt aagttattta tatgtttatt    153720
     tcaaaaaaag cctaccctta atggcaggaa actttttgct aagtatttcc ataatgaact    153780
     atgtttttat ggtttatttg aaaatacgtg agctcaggca gttgttcaag cctccatcca    153840
     agacatacct taggctggct acaatggatc agataaaaaa gaccaaggaa tacaatagag    153900
     acaagctatt tatgtccgtt ttcgagctca caattcttct tgggagggat atatatctga    153960
     tcaagaaagg agtgttggag gaggtgtaca gcatcaaata ctttatgaat agttactatg    154020
     gggatacatt gttcttgcta ggattcgccc acttccaaag actctttgac cttcctttgg    154080
     atctaatttc cacattttac attgaggcaa aacatggatt caacaaaacc acatttccaa    154140
     catttctatt ggacttcgtg aagatgacgg ctataatcac tgttatattt gctccttttt    154200
     cacatattgt aatgagcatt attcggaaat accagaaaac attcttctgc atctatctat    154260
     ggattttcat agccattttc cagatagtcc ttgttattat atatccgatt gccattcagc    154320
     ctatatttaa taagtttgag gagatggaag aatcggatct taagacgaag atccaagaat    154380
     tggcagaaaa ggttgggttt cgtgccaata agatactgat tatggacgcc tcgaagagat    154440
     ctggccattc gaatgcctac ttcataggaa ttactaagga aaaaaggatt gttctgtacg    154500
     acactttgct aaaacaggca aatgaagagg aggttcttgc cattctgtgc cacgaatttg    154560
     ggcattggaa gcatagccat gtcattaaga tggcatctat ggttcttttg attcagctat    154620
     tttacttgtt catattgaat gttttgatga actcccgttc ctttgggaac ttcatacttg    154680
     ggaaggattt gccactgctt ataaggtgtg tttatttcct catgataatc ggagctctca    154740
     gcgttcctat agacatgata aaaaactctg tttcgagata ctttgaaaga caagcagata    154800
     ggttttctgt gtcccttggt tatggaaagg agctttcatc agggcttatc aagctttttg    154860
     aaaagaatag tagtaatatg gatcctgatc cgctttattc agctgtaatg cacacacatc    154920
     ccactttgat tgaaagaatc aacctgattg aaggcgagat gaataaaatc aagtaatttc    154980
     ttaagtattt atttggtgcc cgatcccttg aatgaagatg gcagaggctt gcatagattt    155040
     agctccactg gtaaaatcag cagtgaactt cttgtatcgt ctatctttat ccaaaaatat    155100
     gaagtcgagg cattgctaca agaaaatggc ccaagagtta gagaaaatag aaggacctct    155160
     ttattcgctg gactacctga agaacatcaa gtgggctgga gctaaaacaa ttgaaaagat    155220
     ccaggagttg atagacagaa gaattctaga agacataaaa acggaggagg attttgagaa    155280
     gtatctgaat gttctctcac cgagggcata tgaagaaagc aaaagaaagt tatggaaaga    155340
     aggcacagag aagagcgatt ccaaggataa acaatacaag aaggagaaag acaacatatc    155400
     caagaagaga aaatacattc ctggatatag aacaggaagt tatggaataa tgaaagcact    155460
     atggataaga gaagggattg gtaggcatga gatagcacgg ataggaagaa attactgtga    155520
     ctcagagttt gactttggat caagacattc tgcttggtca tccatgaaaa cactagttag    155580
     aaagggattt gtgtataaag agggaagatc gaaattctac cttacagacg aaggaaggga    155640
     gctagcagca acaatgtttg caaatacatc tgttgttgag gaggaagacg agattacact    155700
     tctggtagat actagggaag taaagagtag gagatccagg ctgtttttcc aagagtattt    155760
     tgaatctcaa caaatcaggc acgagacaag agctcttgag gtaggggatt ttctttgggt    155820
     cagaggcgag agggtttgta gctcgataat cgaaaggaaa agaggaagcg accttgtaag    155880
     tagcatagta gatggaagat ttaaagagca aaagaacagg ctgaaaaaca caggaataag    155940
     aaagattttt tatattgtag aaggactaaa gaacagccat atgcaaaatg taggtaaaga    156000
     gactatagta tcgtgcatgg cggcaactag gctggaggga ttcattgtca tggagacaga    156060
     agacataggc cagacaggct cagtgatccg tatgatagat tacgaagtga aaaaggaaca    156120
     agagaaaaaa aagaagactt cgaacaaatt agaccattgc gaagaatcca gtgaatgtct    156180
     agaagatcct gacgaagaga tggagatgag ctatgaaagc tttattgata aaagcactaa    156240
     gtcgaaagga aaaactcaga cctatctgct gtacatgtct cttctctcta ttaaaggaat    156300
     aggccataaa aaggcgctta tactggccga acggtataag acaatcgggg gactaataag    156360
     tagagtaaaa gctgatggag taaacaagct ttatgacttt gaaataaacg gaaaaaaaat    156420
     atctagaaag aatggaaatg acataataga cttttttctg aagtgacacg gattgataag    156480
     tggaaatatt ttgctcccag gatgggaggg atcagcgaga agttgaaagg actaaagttt    156540
     atgcaaagag cggagagaaa aaacaatggg gatggagagg tgtcgttttc gacgtacttt    156600
     tgcaagaaag gaattttcag ttactgcagc aagcaaaaga tccacgataa ggaagacgaa    156660
     gctcaaaaaa aggccaggaa ctagagcatt cccatatctc ttattaaata tatgtatcct    156720
     atacgtaggc tttctttctg gacccttttg tgttagtatt agatgaatga agatggagtg    156780
     aacataaaag aactgataaa cgccagattt cagaatccaa agtttgtcta cgatggaaag    156840
     aggatgagag tcctacagga aaggaaggta gttgactata catcgggtat ttgtgttcaa    156900
     agagtgaaaa ggagaattga tccactacaa gtcaacacga gctttgaact ttcctcacag    156960
     attcttaacc taaaatcccc agagctatgc tacaatgatt tatccagcct atttacgaca    157020
     aagatcgagc atgtcagtgt caacaaagtc aagtgccctg ttaacattgt cagatggact    157080
     cctgatggaa gaagactaat gagcggaaca gctacagggg aattcacatt gtggaatggc    157140
     tatggatgca actttgaaac tatccttcag gcacatgaat cacctgttag agggatggct    157200
     tggtctcctt cgggctcgtt tttgatatcc tcggacaact ttgggataat taagtactgg    157260
     catccatcga tgaacaatat acaaataata caaggacatg cagaggcagt aagagatctt    157320
     tcattttctc acaacgatag taagttttgc tcggcttcgg acgattcaac aataaagatt    157380
     tgggactcga ttgaagcaaa agaggaatca gtccttagag gtcataactg ggatgtaaga    157440
     gcagcacaat ggcacagata taaatcgttg atagcaagtg cagggaagga taatttggtt    157500
     aagatgtggg atccacgtac tgcagaggag ctatgcactc tacatcatca taagaataca    157560
     atactagcct tgaagtggat gggcgatgaa aactatctcc ttacaggagg aaaggaccag    157620
     gtgataaaaa tggtggacat tagaacaatg gctgatgtgt ttacctacaa gaatcacaaa    157680
     aaggaagtta catcaatagg aatacatcct tgtattccag atatgtttgt aagcggaggt    157740
     acggaaggag ggatctactt ttggcaagca tatactcagg tgcctttgga ggttatcgaa    157800
     gagggccatg agggtactgt gtggtcacta gattaccatc ctgtgggaca catcctagca    157860
     tctggatctg tagatcaaag cgtaagattt tgggttagac caaggccaga cgagaatgct    157920
     gaatctactg ttggaggatt tgttgatgaa gaaaacaatt ctgatggagg agccattcca    157980
     ggactgtagt gtgggtctcc ctccatgaaa tatatattta aatgtttgtg tgcttctatt    158040
     attaaatatg ttgttgggct ttttctgttt atcctagaaa gttggataac tacaattgag    158100
     aaaaaataaa aacaaatcct ggatgattac cgagtacgaa tacgattttg ttattcttgg    158160
     aacggggcta gtagagtgtg cggttggatg tatcttggct ggaaagaata aaaaagttat    158220
     tctaatagat aggaatccga tgtacggatc ggattttgca acgctgagat acacagaatt    158280
     agagacgtac tttcggagct caaacatggt ccccgaactg aaaacctatg attccgaatt    158340
     ttcggttgat cttactccga agctgttcct tgcggatagt aagatgctga agatgctagt    158400
     caggtatggg attgatgaat atttagagtt ctgtagaatt cccggatctt ttctatggaa    158460
     aagaaagcta tattctgtcc cgacgaacga ggctcagtcc atgaccactg ggcttatagg    158520
     aatatggcaa aagccaaaag tcatgaggtt tttttggaat gtccgggact atgcaagagc    158580
     cgcaatgaag ggcaagtctt atcaattcaa gagtactatg agagaagaat tcaaggagta    158640
     tggacttacg gaagaatcga tggaacttat agggcatgga atagccttga atcttgacga    158700
     ttcctatctg gacagacatc ccaaagagac gtttgataag atcttaacgt acgtaaggtc    158760
     tattatatgc tatgaaaact cgatggagtc accttattta tatccaagat atgggctttc    158820
     tgaaattgct cagggatttg cgcgaagttg ctgtacaaag ggaggggaga taatgataaa    158880
     tgcggagatg ctggaaatcg atgaagcaaa gatggagttg ttagttcgag aacctgtcaa    158940
     caaagaaatc ttgaaaataa aggcaggaaa gataatttca gatcagtcct atttccagaa    159000
     aagtgttgtt ttatatgaag ttataagagg aatatgtata gtacgagggg attcggttga    159060
     tataacaaag ggagcttctt cagcccaggt gatcttccta aaaggagagc ttggaaggaa    159120
     gaatgacatc tttgttgttg tattgggatc tgaggagaag tctacgcctg aaggctataa    159180
     ggcggttatt ataagtactg tgagagaaac agataatcct gagaaagaga tagaggttgt    159240
     tttggagagg ttgggggatg ttgtaaggta cttcattgat gtaaagccgg tatacgaagc    159300
     ggaagacatg gagaatatag tttttacaaa gggtgtggac gaatcccccc actttgagga    159360
     catttatgaa gagatagaaa ggatttgcaa aaagctagac gtttgttgac tagccaatca    159420
     cctctgaatt tccggtgata agaggcttgt taatctttag aagcgaggtt acaactattg    159480
     gatttcataa agcccttatg gaaataaaga cagggatgat aagtggggct ctttcgtctt    159540
     gctatttgaa gactaataaa acatcagtta tatgctgcat ctatctagag caaaaaggag    159600
     agacggagcc acaaaccgag gtacatttct ccgagggact acctctgcag attcgttcag    159660
     gagttagctc aatcgtaaag tcgttatttt caacaaaaac tagatctaca aggatcaaag    159720
     tgacattcca tgctgtgaga tgtggagagg acttgttttc ttgtcttgta aactcttttt    159780
     ccgtatgtgc catactatct gggattggga tcatagatac catttgttct agtactgtat    159840
     atgctgacaa gaataacatt tcgcttacaa gtcagttgaa ttctttccct ctacacatgg    159900
     tgtatatgat tcacaagaaa agaatcatgc aggtgcattt tgatgggtgc cttgactctt    159960
     ctctttttgt taaagccact gagaggcttg tccagacatg tgttgagcag gccgacatgt    160020
     tgagattaac aatagaggaa attacaagaa caggatgagt agatggaatt cttggatctc    160080
     agcatgatga aatggagaat tcccaggaac cctgctatga gcttgataga atcggaaaag    160140
     aaggaagagg atggaacaag aagaaaaatt tttgtggtgg ttggaatggc aggaagcgga    160200
     aaaacaactt tttgccaaag attatattca tggatttctc aagacaattg cacgatagat    160260
     ccagccacag gattaaattc gcatatatac tctataaata ctgatccagc agtggtgaat    160320
     acaaagatgc ctttaaacct cgacataagg gacgttgtgg attatcacga gacgatggag    160380
     aagtacgagt tagggccaaa cggaggaatt aatacatgtt taaacctatt tcttttgaat    160440
     ataggggaat acattgacag aataaaagaa gagtacatca tcatagatac acctgggcag    160500
     atcgaggcct ttacatggtc atcgccagga tatgtactga ttgaggcgtt gaaaaccgtt    160560
     ggagaagtta ttcttgtata tgtggttgac tctgtgtctt cgcacaagca tgctgtgttc    160620
     atgtcgaata tgatgtatgc agcttcttta atgtgcagat atgaggttga gacactatgc    160680
     cttttcaata agaaggactt gtcaggaagt gagcttcttg aggaatggat tagcgactat    160740
     gaaagcttta gggattcgtt gaacgatgaa gatatgtttt ctcctattct aggatccatg    160800
     gccctccatt tcgaggagtt ttataactcg ataaagactg tgtctgtttc ttcgtctaca    160860
     ggaagtggga agtccgactt tttcgatgct gttaaccaaa ttatgaatga gaagtatcca    160920
     gaaaataaat ttgaataatg acaaagtcta tgcttgcgga agcagttctc ttctcgacca    160980
     aatttttatg atttgcgatc ccctggcggt ctatgaaagc taaggataga aggaatcgaa    161040
     ccaagatgaa aagcatagat agtatttcca gaatcaagga atctaagatt gcatactctc    161100
     tacctcatgg gccctacaga gtagtttcaa ttgtttctct aggaggaggc tgtggaaact    161160
     atttcgacaa gtacttgcat gagaatcgag ggctattctt ctcaccggag tacaagatca    161220
     actatctatt caaagagact tgtggagtta gtgagttcca tattggatac ctctgcagag    161280
     caagcgacat agtggtattt tttattaact cagatgagat tgatgacagt aagcttaaaa    161340
     taatcaagaa gtttgttcca agctgtctat tctgcatatc caaccagaga tttaaagatg    161400
     tggctagaaa agttgtgaag aaacacttcc caaaggagcg aatagttgag atagatggac    161460
     ttatgggggt attgagcaac gtgagagtta agaacacgtc ggtttgcaag aggccgtata    161520
     ttgttccaag taatgcttat tctgatggag aatacttcta tgtcgagggc tttctaaagc    161580
     gtggattcct gagtgacaag gtagttgtta acggacggta tgaaatgact attgaggaga    161640
     tttttacgga tcggctatat aaaggagagg atttatgtgt aagtgttgac attgagaaga    161700
     cttctctagc agaaggtgaa gagttggagt ctgattgcaa ctcggagtcc ttggagtctg    161760
     gctgcgatga atacgaagaa aaggaaaatg atgaaagtga agagtttacc actgatgaat    161820
     catctactga ggatcggcca tctcttatag acaaatactc tgagtataga ggaataagaa    161880
     atctttcaac atgtagcttc aagtcataca acttcccaag ccattacaaa agtcttgtgt    161940
     tttttgatga ctttaggaga gctgaaaagc tgataactga acaagatagc ataattccta    162000
     atgaccaaat ggttaagata aagcttaggt atgaaggact tattgaagag cagatatacg    162060
     tggtgtttgg atgttacgaa tatgaaaaaa gaaagaccat acacaacttc cattttgaag    162120
     gaatagaacc tctaaaggag gaaagtatgg tggttgatct aggccatagg attattgaca    162180
     tacgtcctat gatcacaaga aacttaaacc atagagtttt caaaaagcaa gaagaacttg    162240
     agtctggggt tgttagcttt attgggccaa tggcgtttgg cctatccaga gtgctcctat    162300
     acaagaagtc tgctctgggg gaattatcta aggaaacgct tgttgccgtc gggatgaatg    162360
     gatttacagg agacaggatt atttttgagg aggtagtgct tcaaggaatc ccgttcagaa    162420
     acaagaaaag atacagtctt gtcaagcgca tgtttaatag caaggaagaa gtcatgtact    162480
     tccgaaacat tcagctgtat atgcgaagcg gaaagattac tgggtttata aagaagccga    162540
     taggtacaaa ggggatgttc aagggatact tcacacatcc aataaaatcc ggagataagg    162600
     tgatgatgtc cttatacaaa agagcctttt tagaagatca ataaatgcca tactccaacc    162660
     gtatttagat ttagtttttg tttccctgga tgaaaacgta tatcaaggag aaaagactag    162720
     gggagggaac atacgccgtg atatatcttg gatatcgatg tcttcctcag gacaagcccc    162780
     ttgtagactc tggtacaaag atagaggata cgcctgtagc gataaagaag ataaagctaa    162840
     acaagtacac tcaaggacac gagataagtg ccataagaga aattaaggct ttgaagagaa    162900
     taagttgcaa gtatgttgtc aagctcctcg acacttttat atatgacaag tgcatccata    162960
     tagttttgga atatgtcgag accaatcttg aaaatgtaat aagaaatcct gataaaatca    163020
     tcatgccggg agacattaaa gcatggatgc taatggtgct gaggggagtc tacgaatgcc    163080
     acaaactatt tataatccat cgggacataa aaccgaacaa tatacttatc acagccgagg    163140
     ggatggttaa gcttgcagac tttggactta cccgaggaat aggaaacaag atgacccctc    163200
     aggcagtaac tagatggtat agggcacccg agcttctctt aggatcaagg gattatggaa    163260
     gccctatcga catgtggtcg gtgggatgtg tgtttgcaga acttttttta agagttcctc    163320
     tatttgctgg agacacagat atccagcagc ttgacatgat cttcagggct cttggaacac    163380
     ctaaagaaaa agaatggccg gggttgtcta ctttaccctc gtttcttgag tttcatcagt    163440
     acgagaaaac gtctttgcgt cctttgtttt cggctgcgtc ctcagatgca atagacttac    163500
     tagaaagact ccttactctg aatcccggca atagaataag ctgtgacgat gccataaaac    163560
     atccatactt caagtcattt ccatccccaa cacccatggg aaagcttcct gtctaagaaa    163620
     tacggtcttt cgtacaaaac ttgttatgat gatatagcta tactgactta tataaaagag    163680
     ctaaaaagat ggattctagg tttatttcca cttaattgca tttggccgga aaacaaaaaa    163740
     cccttcaaat aatgcactcg agagattttg catcccaggc catgcaccaa acgagtaaac    163800
     agtttccaaa agcatttgag ggacagagaa ggccaaagat gaaaattcca gactttccgt    163860
     cagaactcga gaaggaccaa gcatcctttt tttcctttga tacatcagtc caacctccac    163920
     ctcttagcac aacaaattgc tttattaccg agacaacaaa cacagatcct aatcttctga    163980
     gatccacaat gtatactctt cctacggata ctgatacctt tgagtcaatg gaaattccct    164040
     ttggattagt tctcaatcct ttcaatcaga aagctatggc aaccgagttg gacaaaagca    164100
     tttctatgaa gtgctggcaa tgccaaagtt acgtcaacat atttacaaag atcgaaggaa    164160
     acactttcta ctgcaacatt tgtaactcaa aaaaccaggc aaaagagaaa ataagtagcg    164220
     aggttaccag atattccaca atagaatatg ttgatagggt gaaagaggaa agaatcacaa    164280
     ggccagaggc tggaaacata gtttcagaaa gtcttttcag gactacaatg attgatgggc    164340
     cagcatttat ttttggaatc gatactactg catctccatt aatggagcat gcattcaaag    164400
     ctatgaagct tttgattaac gatgaaaact ttcgatttct gtttaagaaa gttggagtga    164460
     tcctgttttc cagcactgtt tctttgataa agccatcggg ggggatgatt acagaggttc    164520
     tactgtcgga caggcttcaa cttccgttta tctctccgga attcttaatg gattccgaag    164580
     acgatgggct gatgaaatca ttaatggagt acgttatggg aaaatccgaa gacaaaggaa    164640
     agttcaaaaa tggatttgaa gattgcttaa gggttgcaat ttctatagca gggtattgca    164700
     agggctcaaa gatggcggtt ttttcgaata ttcaagacaa ggtggaatat gaggaagtgg    164760
     caaagcaact catcgaggtg ggatgttcgc taaatgtttt ttcaacacaa aagacatctg    164820
     ccaccaagct gtgtgcttcc actacaggta aatgttttat atatagcctt gaatccctca    164880
     gcaagctggg cccagacctc ctaaacctag gagtcacaaa gagctcatac aaagtgcaag    164940
     tcgaggcaaa gacttcggat gccataagga aattgagttt ttatggaaat acagtctttg    165000
     aacatctagg gtttcaggac tttgcacata tggatgataa aactgcattt ggaatgacct    165060
     tttccttgga agagccgctc caaaataagt ctaaagtgta tgtccaggtg atactaagat    165120
     tttactcttt tgacgggtca agtagggttc ttgtgatgaa ttccagcttt gaaggatcgt    165180
     cgagaatttc agaggtctat gcaagcctca gctttgacac tctggcatgt atatatgcaa    165240
     aatacatagc aatggacgaa agcactgcca aggaacattg taagaaggta gaaaactcga    165300
     ttagccgatc tcttaagtat tatagggata actgttgcaa agaggcgtct agttcccagt    165360
     ttgttcttcc tgaatctatc aaattgatcc ctttgatata ccaggcaatg gtgaaaaata    165420
     gctgtttttc caacaacata agcacagata ccatgtctcg agtgactggc tttactgtcg    165480
     aggaaaatct caggtttttt tatccgcgcc tatttgcatt taccgatttc tacatagaca    165540
     aatctctgga aaaggtcaaa gctctcagac tcaatgttga gtcgcttaac tctgaagaaa    165600
     tatatatctt agacaactct cagaagatat atatctacat tggaaaagac gtagatattt    165660
     ctctgaagga ggctatattc agagataaaa cagaggaaaa cgaagttctg gataagatga    165720
     ttgatgaatt ctacacttac tatgatagtg aacttccagt tatatttgtg gaagaaggaa    165780
     aaggtgggtc ggaggttgaa tttgtcggat atatggttga ggacagactc aacgacatac    165840
     cctcttactc tgattatata tgtgagcttc attttaaggt caaaaatgct taggaacagt    165900
     ttccttttta ccctccagga gggaaggcaa acttaaataa aatcgtgaaa tagttttaat    165960
     tagttgtctc tttacacttc gtcatctctc tgtaagtctt cttcaagcag catggaatgc    166020
     gctagggtca tcatgccaca aactgcggat atcgcaagaa gccccactat tgcttccctg    166080
     gaaaatataa agaaaatcag tattccaaca gccccagcta tacatacgga tctaggctcg    166140
     agctcaacat taaagagagt tggcttcgtc tggtacgcat atgcagtgac agcaataatc    166200
     ccaatgagta taaccaattc tagacgataa agaacatata tcaatgcaaa tgcacttgac    166260
     attgcaagat aatgaaattt aaatctatca agattcacaa ggattctcct ttttgcaacg    166320
     ctgaaatctc gtgggataga ggccttacgt atgctaaaaa agtctcttgc tgcatttttg    166380
     tccccaagcg cctccttaat gtttttctga aaagtctttt cttcgtgcat tcctccttgc    166440
     atgttttcaa ggggcttctt tgtttaacta ctaaagatat tcagcttcat ttgtttcaaa    166500
     ggtgattgat ttcaagcaaa cactgttcgt taccaataag atttcctcct taagagacgt    166560
     ttgttacaaa ttatccaatt agattttttc ccagatggaa ttggttattt caaataggga    166620
     aacatccgaa ccaatatcaa tagtaaagac atctcccatt ttcttgctct taatcctgca    166680
     atacttcctt ccgtcacctt caatgaactc ggttccaaag cccttgacaa tctcaagata    166740
     tatttcgttg aaggaaggtc tcgaaagtgc tcggagtttc tcctcttttt cttgaatcct    166800
     tttatctgtt gtgatgattc cggcctttat cttttcgttt tcgtcttcga gttcaactat    166860
     cttcttagca agcctcaact tttcattgtt tatctccaca aatgcgtcat ttttcttact    166920
     atgggtatat gaatactttc ttacctctcc ctcaagctgc atgtttttct ttttaaagag    166980
     ctgaacattt tcctgaagag tcctggtcac tgtttccatc ttcagtcttt cttctttcct    167040
     ttggctatcc agcgccatga gtatattctt ttcggccgga ttcttgaatt tttcgcacag    167100
     atcttgtagc aacgtctttg cctcttccat ttgggtatgc tttttttagt ttcaggtatt    167160
     catgggtttg tagaggttgg gactctgtaa ggccccgtgt ctgcaagtgc ataggttgga    167220
     tggccgagtg gtccaaggcg ctggcttaag gtgccagtct ctcaggaggc gtgggttcga    167280
     accccactcc agccattttt cttggtggaa ttccgggctt acttttgaat tcttatcaaa    167340
     aatacattag agatttctct gcacaacaat aaataggtag aaaaccgata ttttatttct    167400
     tcaacgaagc agacctttgg catcttcgta attcattttg gtatgaatac ttccttgaac    167460
     aattccttta ctagccctta catgggaatt tggatatctt gaagtaatct tctcaattaa    167520
     gcctttgttg tcagacacat ttccagctag gatagtttcc tcattaacaa atacataaac    167580
     aagacattga acactactct taagggcttc accacaaagt aagcctataa atctaaccaa    167640
     atcttttcta gtacaggagt ctgttggctg ataataataa accaccgttt tgtcatctaa    167700
     atttgaggta ttcttggcct ttgctatcag ttcgagaatt tcctttttgt ttttggcata    167760
     ttgagctctg ctaagctctt ctcccttctt cttattcttt tggttcaaca cttcaacttt    167820
     ctgtctgtag aataatggaa ttgtcttatc aacattaaca acttccccta tgctaagctt    167880
     gctcaagtag atctctgcct ccatatcaag ctcctgtgcc tttttcccag ttactgcaac    167940
     tattcttcga gtgttggcag atacacctgt ttcactaatg atcctgaatt ttcctatgtc    168000
     ggaaacatta gttacatgcg ttcccccaca catttcttca atagttagtc cattggcctt    168060
     catggttata accctcacct tttctggata ctcttcattt ctcatccgaa caatattagg    168120
     actttccatt gcctgctccc tgtctaaagt aatagcttca acgtctgtgt tgctttggat    168180
     aaactcattg accttttttt caacctcttc taattcttga tttgttaatt ttctcccctc    168240
     aaaatcaaat ctaagctttt ctggatcaac aaggcttccc cgctgctccg tttggattat    168300
     agtacgtaga aagaagttta gcaaatgtgt tccagtgtgg ttcttcatta ttttttttct    168360
     caattcttga tcatacatct gcaatgcctg gtatgatgca cttccctcca atattccttt    168420
     atgcactaca aaccctttga ttgcttgtgt gtccataacg ttgaaaacac ctacgtcctt    168480
     ctctccatca taaaatatta tttttccagt atcaccaacc tggcccccac attctgcata    168540
     gaaacaggtt ttgtcaaata caagcccaag ttctcttcct tcaggtattt cattgggctt    168600
     agtgatgatt tccttccctt ctatgccaaa aaaaaacgtg gcattaatgc tattctttgt    168660
     atacttgaag gagtcatctg tacgggggaa tttggactga aggcctgcat caatgtttag    168720
     tttcattcct ttggacatct tactaatttc aactgctttt tgcttgaagc tctcaaaatt    168780
     ggtgtagtcg atcttaatat ttctttcctt agccataatc tccgttagat caactggaaa    168840
     tccatatgta tcatacagca aaaacaaatc ctctccactt attttcccgt tgttctctgc    168900
     aagcttgtgg aatctttcaa ttcctttctt taaggtcttc ataaactgga gttcttcctt    168960
     attcacacag tccacagact tgagttctat tcctattgca tgtgcagcaa tcccaacaag    169020
     ttctccaaga accccctcct tcaatcctag aacttcatga gcatatctaa cagcccttcg    169080
     aaggattctt ctcagcacat atcccactcc gtcattactg aagtcaactt tgtcgtaagt    169140
     gcaaacagct atggtcctgc aatggtcggc cacaactctg aaggcgacgt caatactctc    169200
     ttctgtgtcg ttgtatttga agttgcatcg atcctctatg gctttgatta tcactgcaaa    169260
     actatctatc agataattag atcgaacatc tataagtata ctcaaaagcc tttcaaggcc    169320
     tatccctgta tctatacatt ttctttcaag aggaacaagg ccagagatgg ttcgattgta    169380
     ttctataaat acaatgttcc agatttcaat aacattagga tcgtccttgt tcactagctc    169440
     agaagcatct ctgtttccaa ttcggtcgta atggatctcc gtacagggtc cacaaggccc    169500
     cgtatccccc atctcccaga aattgtcttt gtaagaagcc gatagaactc tctctgaggg    169560
     aagatatttg agccatatat ttccactttc tttatccaac tcttcataat acgtcacata    169620
     tagtttgtcc ttgttcagtt taagtacatc gaccaaaaat tcccaggcaa atcctattgc    169680
     ttcttccttg aagtaatccc caaacgacca attccccatc atttcaaagt atgtgtgatg    169740
     atatgtatcc ttccccacgt cgtctagatc attatgtttt cctcctgctc taatacatct    169800
     ttggacgcta caggctcgac gcaagtcatc cctttctcca agcaagttct ttttgaactg    169860
     caccatccca ctgtttgtaa aaagtaggct gtcatcttca aaaggaatca cagaactcga    169920
     gcttacaatc ttgtgcgatt tggaggcaaa atagtctaga aaagatcggc gtagcttttc    169980
     cgttgtccac atcattaggg ttcaaaagtt ttcacaatga atagatattt attttgtttt    170040
     tataatctag gatccactac agccttaaat aaaatattca tactttctaa caccattacc    170100
     taatccttcc agataattcg tttcttattt ctttaagaag ttgaatgagg ttcttcgggc    170160
     tcattccaga atccaaaagc ttgtacattt gatcaattgt atcctctcca aagtgcagct    170220
     ttagctcttt agcaaactcc aatatgtcct tgtatccatc ttccatgcca gaccagagaa    170280
     caacaccagg gggagacaaa ttttttgttc atttttgccg atggtacggc agaattactt    170340
     atttattctg gcgactaatc tctgccatcc tctctagatg ttcactagtc gggaggcttt    170400
     tagagccttg aatctctctt cctccaaaac tgtagtcaaa gtccttttca ataataaatc    170460
     gtatatctcc attgtccaca atattctttc ccttgtgctt gcacagaagc gcagatcgat    170520
     gaattatatc cgataaaaac ttctctgtta ggagctgaag gttccttatt acgtccttat    170580
     caatcttttt gttacaaagc ttcaagagct tttttgggca aagaaagtga tgttcgatgt    170640
     tcattttggg gatcaaaaac tcaacaagac tattttcccc tttttctcaa atggtagaga    170700
     taatagataa aatacgggag ataaaatatg cagatgaaat ggattatatt gttgaaggat    170760
     tggttaacaa tgaaatagag gaatccttga ggttaatact tgacttgaca aatgatgaga    170820
     agttcaaaag ctacatgaaa gaatccaggt atttggatga aataatccag gtaatatctg    170880
     agaagggggt attagaaact acatccggta tggtgcttga gatattatca aggactttca    170940
     atccatattc tcttgttgat ttcaagggtt tatttaaggt cctggcgatg gcatttaata    171000
     ggtgtgaagt ggaaaatata tcggcagagt cttctatctg tgtccaaagg gaggcaaact    171060
     tcattacaga aatactagag aaaattccga ttaagtggta ttctaaattt tctaatcaca    171120
     cagagctcag aaaagtggtt ttttccttac agatgtgtac aagcagaaaa gtgatagaat    171180
     ggaacaagtt tctgatttct cttctaatga agcatcctga attaggaatt atcgatgatt    171240
     ttgcttccat tctattgaag aaaggtagaa actacgaagt aatagcaaat tatacaatgt    171300
     ttagggaaaa tgctgaaaag ttatttctta gtgagaactt cagacagtgt ttaagaagag    171360
     tagttataaa ggagttcata aaagacaaag attataaaag gcccagatac atgctgaaag    171420
     gacttacccc gaagtctctt gtcctgccag ttcccgaaac aaaaaaaaaa gagagcttgg    171480
     gaggaataga aaaagactca aaaagcttga gtaggaaaag atttttgata ataatactta    171540
     tcaatttgct ttttagagat ttccatttag acattcctct aagcttgatt gaaagagcct    171600
     attatagtgt ggatgaaata accagatgtt acatagccat acttcttctt tcaattgaat    171660
     attcggaaaa gaacactgtt caaagtatac atgttgaaga tcttaagaaa gatgcgagac    171720
     atctactttc catctccaat acatgcttat gcgaagaaat cctaaataga ttaatcaaaa    171780
     tatcaagtta gccccaagaa aacattgtga ttcatctcga ttatcgattg agtttcttag    171840
     gcagaattta ttttgttgta ttttaaaccc cagccatggc agacaaatct ctaattcagg    171900
     atgataaaga agttgcaaga gagttatttg caatgattaa acaagacact actgcaatag    171960
     aaacaggcct tgatggaaat gtcagcggtg tggtaaccga tagaggaaag cttttggttg    172020
     cagaacattt ctccgatatg ggcttgtcag acgaacttct aaaggccatt tacaacaggg    172080
     gttttgaaaa gccgagctta attcaaaagt ctgcagttcc ccacatcctt aaaggacaca    172140
     acattgtagt ccaaagcaaa agtggaactg ggaaaacaat agcttttacc tgtgggatcc    172200
     ttggaaatgt aaatgctggg gaagggaccc aggcattagt ggttacaccc actagagaac    172260
     taagtactca ggtcaccgag gttatttcag gctttgcaga atctcttgga atgaaggttt    172320
     tttcggcatt aaaaaataag actacagaca ttgttaggga ggaagttgtg gtcggaagcc    172380
     cgggaacgat tctaaagctc attgaccttg ggaagcttaa tcacaaggaa attaagatgg    172440
     tggttcttga cgaggcagat atcctccttg ataaagacat gatgggaaca cagacattta    172500
     gaatactcaa gcttgtttct ggtgcacaaa ttattttctt ctctgcaaca tactctgacc    172560
     aagtgaaaca gacaatcgag ttctacacac cagatgccgt caagatgtat gaagagagaa    172620
     atggaaaacc cgaagagatt aagttatttt acatagaggc agaaggagat aacaaaagaa    172680
     aagcattgaa atcactttat gagtatcttt caatcagcca gatgattata tttgtaagta    172740
     caaaggcaac ggtcaattac ttaagaaaaa gactggaaga tgatttacat tcagtatcat    172800
     gtcttcatgg agatctggag attgaggaga gagaaaaagc agtggaggag tttagaactt    172860
     caaaaaccaa aattctcctt acaacagatg tcttttcaag ggggatggac attcctcaag    172920
     tcaatctaat tgtgaactat gatcttccaa tatacaaagg tgttgcatct acacaaacgt    172980
     acattcacag gataggaaga tctggaagat ttggaaggac tgggtttgtg gtggattttg    173040
     ttcgggatga agagctggag gcatatctga aattccaaaa ggaattgaaa tttgcatcaa    173100
     agaaatttac aatcaaggcg cttgaggagg ttgcagaaga gatcgactag taaataaata    173160
     tcttgagact tggaagtatg aaagagtcgg ctttctgctt ggcacaatat atgtatttat    173220
     ttcaaataaa acttttgata tgtaggcatg tttaaaaatt aattttcaaa gtccttagaa    173280
     tggaaggtct agaagatgat ttcataccgg attttacaca tttgtctgtt gcaggggaag    173340
     tggccgatag aaatagcttg gttagacagg agggggatgt cgtgtacatt tcagtgggta    173400
     atcgactcaa cggatggaat ttaagatttt cggaaattga gaagagtata cccactctta    173460
     agaaaagaat aacccatttc gacttttccg atggggtatt ggtgataggc tatgaaaacg    173520
     gagctatcca agtgcattca agcgaaataa tatcgttccg cccacactct agaagagtca    173580
     caaaagtctc aaagatagga gactatattt tgtcttcttc ggcagacggc agcatcattt    173640
     tatacgactt aattggagag gaaattcgaa tatcgtatga aggaaatgac atatgtgtcg    173700
     aaaagttttt ttctgattct tcggtagtta ttggaatttg ttctgataat gcattgagaa    173760
     tctggaatct cgaagagaag catgtaaaaa gcgtccacat ctttggaaag gccataaaag    173820
     acgtgtttgc cgtcaatgaa gaggccttaa tatttttcaa ggatggagaa tgtattttct    173880
     ataatttagt agagaagaca tctcgtccct tcaacaaatt taagaaacta aggaatatca    173940
     aagtgagagg gaataagatg ttccttcaga acaaaaataa gttacacata tatgaaatag    174000
     atagcaaaga taagattgta ctgagagatc ttgaagctga aaaaataagc gatagatata    174060
     ctgattttga tgtgatgcca gatggagggc ttttgtttgc tactattgac aacagttggg    174120
     agtgcttaaa ggatggaaag atatacccat ttggatttca cagaagtgag attctgggcc    174180
     ttgagacctg cgaggacaag attgtcacaa tgtcgaagga aagcataatc ttctgggtga    174240
     tagacaaaaa agaaatgaaa agagttggaa acatacagat aaaaaacgga aaatgcatgt    174300
     gcatatggaa tggccatgtg gtaattggcg ggagtgaagg actttcttgc tactcaggct    174360
     taaattatct cctagttaaa gaagaaaata tagggcctat atcatctgtt tttgccacca    174420
     gacaagaact acttgtaggg aaagataaca gccttctgtt ctatgacaat agatgggttg    174480
     tttcaagaac attagaagta gaagacccca tatcgtcgat agaagcttct caagacggat    174540
     ctctactttg cataggtctc ttaaatagca aggtacacat atatggtatg aacgaattga    174600
     atctaagaat taccctttat ggacatgctc ttccagtaag gtctatgaag ctatctcccg    174660
     acaattcgga aatcctcaca tgcggttcag acaagaccgt taagatgtgg ggaacacagt    174720
     ttggagaatg taggaaaagc ttcattggcg attcaagaag tatagaatat tggaacaaag    174780
     atctgtttat gtttacatca ggtgttattc agtactttaa gagatatgaa aaacttaagg    174840
     agttcaagaa ccgcgaatca aacttggtca aaataagaaa ggacatgatg atttcctgtg    174900
     gaaagtttaa tgttgatctt tataccatga acaaatatga atttcaaaaa gaagatgagg    174960
     aggaaagcaa tgaggaagaa gttatgaggg tagccaagat aatgaattat aagatgtatg    175020
     accgttttct aaccgaattg gaagagttat caaaggattt ctccagtgac aacattaaga    175080
     cgttttttaa tgttttaatg gatatagact tttgtgaact ggacaagttt ttatgtctaa    175140
     tgaactcttc cgacattatc caggtcatga atgtattgca tgaatgttgt aattggaatg    175200
     cgatactggt tgcaagggta ttcatttctt tggttagact ccacaaagat atatgtattt    175260
     cccatccaaa gttcaaggtt tttcttcaga cgattaccga taaaacaaaa gaggttagaa    175320
     ctcaagttag cagaaaccag ggacttcttc tcacgaggaa aagtataaac aaagaacaaa    175380
     gctttagcgt ggaataaatt gctttcaaac ctatctagat acaataacta ttcagaaaaa    175440
     aggtcctaac agaaagaatt tagatctgag ggacaagtat ttcaaagtat cttcatcagg    175500
     cttggctcag tttgatagca tcctacgttt tcattaaaag ttttaaaaat tggctcctta    175560
     aatgattatt tgaattcaca tgatttgttg aactagtaga aagatagaag tatatcttga    175620
     gaaggatcgg atttacatta tagaaagaaa caaacgctca ggaatttcta atagaaatac    175680
     tggaagaagt tctggcatag tggaacttta gattataaga tagtagaatt tggagaagag    175740
     actatagata ataaataatg tattccaaat gtaagt                              175776
//

If you have problems or comments...

PBIL Back to PBIL home page