(data stored in ACNUC8465 zone)

HOGENOMDNA: ENINT1_3

ID   ENINT1_3; SV 1; linear; genomic DNA; STD; FUN; 176815 BP.
XX
AC   CP001944;
XX
PR   Project:42703;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Encephalitozoon intestinalis ATCC 50506 chromosome III, complete sequence.
XX
KW   .
XX
OS   Encephalitozoon intestinalis ATCC 50506
OC   Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-176815
RA   Corradi N., Pombert J.F., Farinelli L., Didier E.S., Keeling P.J.;
RT   "The complete sequence of the smallest known nuclear genome from the
RT   microsporidian Encephalitozoon intestinalis";
RL   Nat Commun 1(6):10-10(2010).
XX
RN   [2]
RP   1-176815
RA   Corradi N., Pombert J.-F., Farinelli L., Didier E., Keeling P.J.;
RT   ;
RL   Submitted (22-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Botany, University of British Columbia, 3529-6270 University Boulevard,
RL   Vancouver, British Columbia V6T 1Z4, Canada
XX
DR   StrainInfo; 819376; 0.
XX
CC   Linear chromosome is missing portions of the telomeric regions.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..176815
FT                   /organism="Encephalitozoon intestinalis ATCC 50506"
FT                   /chromosome="III"
FT                   /host="Homo sapiens"
FT                   /strain="ATCC 50506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="nasal tissue"
FT                   /db_xref="taxon:876142"
FT                   /culture_collection="ATCC:50506"
FT   gene            complement(<34..>279)
FT                   /locus_tag="Eint_030010"
FT   mRNA            complement(<34..>279)
FT                   /locus_tag="Eint_030010"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(34..279)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030010"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU06_0080"
FT                   /db_xref="InterPro:IPR011667"
FT                   /db_xref="UniProtKB/TrEMBL:E0S612"
FT                   /protein_id="ADM11147.1"
FT                   /translation="MATATLERGGRREVGIVEVGIFKNGKGEHVIYHLMFRVTKVEEVR
FT                   SAMSSLAAEKEYLSEEQMSEGGVCVSSRSSVFYLME"
FT   gene            complement(<527..>1693)
FT                   /locus_tag="Eint_030020"
FT   mRNA            complement(<527..>1693)
FT                   /locus_tag="Eint_030020"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(527..1693)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030020"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_0080"
FT                   /db_xref="InterPro:IPR022115"
FT                   /db_xref="UniProtKB/TrEMBL:E0S613"
FT                   /protein_id="ADM11148.1"
FT                   /translation="MVWKKILVFKFFDIIACSMVESSVAGSMITSVVKLKGTESESMPF
FT                   PLLFRGTGMLIVQPTTKFSDLRRDLQAMIDVREFIESGNLAMGVWMFAAKDLLYTDDDR
FT                   FKRMFSEKIVPYLQKISLDLWKIYEKRNKTFSELLMMAYKRVFQCEEVENREMTKFGEA
FT                   IISEVEKMVEEAEEEEDEEKKRKKIVVCYGIKKYGERLCNRSWWKKIINAERIVCEACS
FT                   KLYETPEEVELMGCMVEGWVKKVLKENSISEEEACEYLYLEYRIISVGLLLTTCKERSK
FT                   DVVEEIIKQIMIGKDGEEIDLEYVEKVSDAVRRRQKAEEERRLKIERELLGESEDSGGR
FT                   KKKKSRGGGQEEETGSRGEEGRRGREGRGGRAGGGGRRSFYSLGLWKE"
FT   gene            complement(<2418..>3566)
FT                   /locus_tag="Eint_030030"
FT   mRNA            complement(<2418..>3566)
FT                   /locus_tag="Eint_030030"
FT                   /product="choline kinase-like protein"
FT   CDS_pept        complement(2418..3566)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030030"
FT                   /product="choline kinase-like protein"
FT                   /note="similar to NCER_102276"
FT                   /db_xref="GOA:E0S614"
FT                   /db_xref="InterPro:IPR002573"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E0S614"
FT                   /protein_id="ADM11149.1"
FT                   /translation="MNIILLLFSGIYILFGFCSQSKIVMKAIGGMNGVTSSNPNPSFSA
FT                   SIEHSSSEIPKHVVENIRKHIGSLPNGPMPRLSMAYSNVVYMFSVGKNRYIYKELKDFD
FT                   AQDEMINNMVASERVIVSTNKFRIERYLDSEHSIIKRDLKEIATELRRFHNIKASGIRS
FT                   YKELVNNMMYKCIKEILPGEENNANPRDVIEKIKSLNQKSYKKDKDHIVRLLIEVQNRV
FT                   FRVSTGDFESVTCHNDLQPGNILMVKTGVVFIDFEFVAMGSPVIDIANLFCEAAYDYEN
FT                   YVFQEENFPNTQERLEFIGEYMDSNEHLEKMLELVEGAMAYSHFLWYLWALGNSRTGCS
FT                   KNFDYSRYGNSRLHQLRVCGIINHEEYEILQINKSELVNNTS"
FT   gene            <4524..>5402
FT                   /locus_tag="Eint_030040"
FT   mRNA            <4524..>5402
FT                   /locus_tag="Eint_030040"
FT                   /product="nucleotide-sugar transporter"
FT   CDS_pept        4524..5402
FT                   /codon_start=1
FT                   /gene_family="HOG000149521" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030040"
FT                   /product="nucleotide-sugar transporter"
FT                   /note="similar to ECU03_0150"
FT                   /db_xref="GOA:E0S615"
FT                   /db_xref="UniProtKB/TrEMBL:E0S615"
FT                   /protein_id="ADM11150.1"
FT                   /translation="MKRVIEELTASLIYLFSSIITTLSNKYILSNLGFKMQYLLVAIQS
FT                   FTIVAGLLVLRITGLVKFPLTNFRKWMVPSLLLSVMIFSGSKSLYYLPISLYTLFKNSS
FT                   IVVVALLEQRLFKKKISALSYMSFVLMIISSYTGNSSDVVLNIGYYWILINILSTTAYV
FT                   LSLKVAVDMNSKGKAESVYYSNLISLPILVLLSALFDERSMGIFGFQELVWILISSFCA
FT                   FLTSFSTAWTLNVLSSTALSMIGALNKSLGSFAGILALGESINHQKIFSLLLGSLASAI
FT                   YSYDISFRKRD"
FT   gene            <5478..>6335
FT                   /locus_tag="Eint_030050"
FT   mRNA            <5478..>6335
FT                   /locus_tag="Eint_030050"
FT                   /product="hypothetical protein"
FT   CDS_pept        5478..6335
FT                   /codon_start=1
FT                   /gene_family="HOG000150374" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030050"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0160"
FT                   /db_xref="UniProtKB/TrEMBL:E0S616"
FT                   /protein_id="ADM11151.1"
FT                   /translation="MNRYETADHDYMHAKDYFNNYKFGYIERTTKTLLLQSLRPEDRQD
FT                   EDLLSIMNQSKSQLKDVKSIGKEASKSISELSELIYETKNKLLKYEEMLGHEMERERDL
FT                   AEEYSRLESLDENLKTYDELKALFDKGCEEVEENSKKISALKEEIAISSTSEAEEELKK
FT                   MKDRRDKLCGKQKRLSLITMESYLEDSYNWYKKSLELIKNVFGISLVTIEQEGNEMYMR
FT                   LKVFACEIGIFVRDGRMIDFKLYNNNDETLASFFEEAGRLAVSVNDPRILLLLVANRCK
FT                   VTEV"
FT   gene            <6394..>7797
FT                   /locus_tag="Eint_030060"
FT   mRNA            <6394..>7797
FT                   /locus_tag="Eint_030060"
FT                   /product="hypothetical protein"
FT   CDS_pept        6394..7797
FT                   /codon_start=1
FT                   /gene_family="HOG000150373" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030060"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0170"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniProtKB/TrEMBL:E0S617"
FT                   /protein_id="ADM11152.1"
FT                   /translation="MIIGCMAGLVAAAQACLKDSDCLTRSRPDVHSMFCVDNICQKVLP
FT                   PGKHCTRPTECSSYSFFGPLACTGKCKVENECEYGKDDNFDSMYCCRSIPQGKECNPNR
FT                   PGSLSGCDITQSCLMGKKGFYECVPDKSNSWLLGVFLSISGNIGINIGINLQKKSYKQS
FT                   HIRLFNMNLQTFYAGCFTYGLGKILGYCSYLFGNQSLMAVLSATGLVSNSILAPMINEE
FT                   IFTWKDFSAIFFVFAGTTLIVMNTATSHKVYTLCELLKMYTRVETLVWLGFIILVIIVL
FT                   FIFVKYVEVNSNWELPDENMIFLRREGVWFDEEGTVIKYTMVLAYVCLSSFIASFTTLS
FT                   IKSLGEMIDKTVAGDNQFIFLTTYCFIIILATCTFFQIYWLNRALRHYDALLVIPMFHV
FT                   TWTLLSIFTAGIYFREFEQYTRYQLSVFVCGVILIFFGSFFLGSRITNKTYIKTKDIGM
FT                   ESEKILKNQ"
FT   gene            <7891..>8358
FT                   /locus_tag="Eint_030070"
FT   mRNA            <7891..>8358
FT                   /locus_tag="Eint_030070"
FT                   /product="chromobox protein"
FT   CDS_pept        7891..8358
FT                   /codon_start=1
FT                   /gene_family="HOG000149520" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030070"
FT                   /product="chromobox protein"
FT                   /note="similar to ECU03_0180"
FT                   /db_xref="GOA:E0S618"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008251"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR017984"
FT                   /db_xref="UniProtKB/TrEMBL:E0S618"
FT                   /protein_id="ADM11153.1"
FT                   /translation="MRDENIYVVDKIVGCRKKGGKKQYLVKWEGYSDSENTWEDEKNIF
FT                   CKDLIKKYEESQEKLKRPSRKVANRKTSPKKLNKSTSEKTKVIINDWDELVNKVISVEK
FT                   KGASLMVWLQFKDGKKGSFPASQIHIKCPLHLLEYYENNLVFCEDGGDNTK"
FT   gene            complement(<8490..>9488)
FT                   /locus_tag="Eint_030080"
FT   mRNA            complement(<8490..>9488)
FT                   /locus_tag="Eint_030080"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(8490..9488)
FT                   /codon_start=1
FT                   /gene_family="HOG000150372" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0190"
FT                   /db_xref="UniProtKB/TrEMBL:E0S619"
FT                   /protein_id="ADM11154.1"
FT                   /translation="MRKTYESTSRLSKKMKSYKKRILDPGTKLDVVKDDDNLENIDDYW
FT                   RTAESVLKDDTTIEVDETSVYKSDTGGEDENEEPNAQSDTLFDIKTIRESLSAKNRDVF
FT                   LSSSRESLETNSILENKRLSSSFERIEDKPEGQPKSPEDGKEFSGEFYTEISSRGEELN
FT                   EYDDDRCSPNEMGKDQGISPAKEMKDRYRKRLQSLGKGVEKSTARKSIIEPKEIYEYKG
FT                   ETIYNSEGKKVAVTNISALYRGRSAFEPLVASTMLETAILFLNNLAFIKPEKAVCNFSI
FT                   FMIKGTVCIEMGHDKVILKRGSICIIEKGDVYSISNSFGTRCTILLTYSIV"
FT   gene            <9584..>10414
FT                   /locus_tag="Eint_030090"
FT   mRNA            <9584..>10414
FT                   /locus_tag="Eint_030090"
FT                   /product="TatD deoxyribonuclease-like protein"
FT   CDS_pept        9584..10414
FT                   /codon_start=1
FT                   /gene_family="HOG000201523" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030090"
FT                   /product="TatD deoxyribonuclease-like protein"
FT                   /note="similar to ECU03_0200"
FT                   /db_xref="GOA:E0S620"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012278"
FT                   /db_xref="InterPro:IPR015992"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:E0S620"
FT                   /protein_id="ADM11155.1"
FT                   /translation="MFIDIAVNITDKLLARDESSVEEVIRRCKDSKVLPIFIGLDHQTS
FT                   QTSINLARKYKTISTVGIHPTSSSKYKNIDEIIPLIEEDAVVAIGECGLDYDRLEFADK
FT                   ISQKRIFRSQLDLEGDCYFLHSRSCHRDFMEIVSDYRLRGVVHSFTGSIEEAEELIKKG
FT                   FFIGINGCSAKTSEGIDVIKNLPLDSLLIETDSPYCKIRKSYAGFEYVTTDFSSLKVLK
FT                   KKNEPCCVVQVAEIISNATEKDFNLVVETVFSNTIKLYGDVVRKSAEEWGFLTH"
FT   gene            <10479..>11213
FT                   /locus_tag="Eint_030100"
FT   mRNA            <10479..>11213
FT                   /locus_tag="Eint_030100"
FT                   /product="hypothetical PSP1-like protein"
FT   CDS_pept        10479..11213
FT                   /codon_start=1
FT                   /gene_family="HOG000149377" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030100"
FT                   /product="hypothetical PSP1-like protein"
FT                   /note="similar to ECU03_0210"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:E0S621"
FT                   /protein_id="ADM11156.1"
FT                   /translation="MSFCKNWASPFLNSLWSETSETWQENQEDWRIVGTNPFKRRSENA
FT                   CKIERIITDLPSKQVAEGIENSFKFMSITPETHYYIIQFESKRLDVAFVDANINVKKNS
FT                   YVILEADRGEDCGVVVGVTTKDKLEKLFKRYDDISNEVQPKRIYRLATLLDLEALERKR
FT                   SMQARALEFCKERAILGGLDMEVVGCEYQWDLNKITFYFASDERVDFRELVKELYRVYK
FT                   TRIWMCAIEKSKNKYLKELIEF"
FT   gene            complement(<11337..>12959)
FT                   /locus_tag="Eint_030110"
FT   mRNA            complement(<11337..>12959)
FT                   /locus_tag="Eint_030110"
FT                   /product="T complex protein 1 subunit alpha"
FT   CDS_pept        complement(11337..12959)
FT                   /codon_start=1
FT                   /gene_family="HOG000226729" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030110"
FT                   /product="T complex protein 1 subunit alpha"
FT                   /note="similar to ECU03_0220"
FT                   /db_xref="GOA:E0S622"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012715"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniProtKB/TrEMBL:E0S622"
FT                   /protein_id="ADM11157.1"
FT                   /translation="MNKEISTADILSGGESYSGASAVEKNANAMMKVYNAIKTSFGPLG
FT                   LDKMCVDSAGEVSITNDGATILQSMVVDDPAAKILVDLATHQDHEVGDGTTSVVLIAAS
FT                   LIEKGAKLIASGVHPSVVVSGYKMAFNECVQFIKKSISKSTLNLGSKALRNVVKTSISS
FT                   KVISSESELFCEIVIDALKCIESSTEDKKNMYPIEDINILKHPGGSMKESFLHQGYALN
FT                   CSLASNFMKREIKKPKILCIDFGLQKYKNPLTVNIVVDNPNKLEEIRKKELEITRKQVK
FT                   AIIDSGANVILTTRGIDDMCTKILLEAGVVGIRRCKKEDLIVIAKAIGTSLVSSTSDLS
FT                   GGDNITSPGSADKFEVVSIGEEECVFINGLKKKMASIILRGANSQLLDEMQRSIHDAIC
FT                   VLRRTLESGSVVPGGGSVECALSLMLEKFAFTVNSKEHVAIHRYAESLLSIPKILATNA
FT                   GLDSNEIVAGLLSSQAKEIESSSETRFLGIDVTSGKIQNNFEFGIIEPSMNKMKSLKAA
FT                   TEAAISILRINEVIILPPDQSKN"
FT   gene            <13104..>13436
FT                   /locus_tag="Eint_030120"
FT   mRNA            <13104..>13436
FT                   /locus_tag="Eint_030120"
FT                   /product="60S ribosomal protein L31"
FT   CDS_pept        13104..13436
FT                   /codon_start=1
FT                   /gene_family="HOG000216660" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030120"
FT                   /product="60S ribosomal protein L31"
FT                   /note="similar to ECU03_0230"
FT                   /db_xref="GOA:E0S623"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="UniProtKB/TrEMBL:E0S623"
FT                   /protein_id="ADM11158.1"
FT                   /translation="MWSKIEENQTVEMTVNLRKICTAIPWSKKAPKAVKALKREIQKHF
FT                   REKIGVVITSDLNNFIHSRGSKKIPNKVRVRVTKETSLKNAEENVLKTDLVVVGSFKNL
FT                   KEVIVD"
FT   gene            <13564..>15372
FT                   /locus_tag="Eint_030130"
FT   mRNA            <13564..>15372
FT                   /locus_tag="Eint_030130"
FT                   /product="MdlB ABC transporter ATPase/permease component"
FT   CDS_pept        13564..15372
FT                   /codon_start=1
FT                   /gene_family="HOG000149519" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030130"
FT                   /product="MdlB ABC transporter ATPase/permease component"
FT                   /note="similar to ECU03_0240"
FT                   /db_xref="GOA:E0S624"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniProtKB/TrEMBL:E0S624"
FT                   /protein_id="ADM11159.1"
FT                   /translation="MNQKSLILNSNPLKQSAMIRLKPHNSLVHGVVEIFRKYVLNRTYL
FT                   CLMVLPIVLLATTANILYDYIPSVIIPRIAEHIKANDLGLHMDLAYKFFFYGLLATVFE
FT                   YFPIFLMALVIQDIYRDCYRDIFMEYISLEYNAFHDISPGDMEGRIYRKCKAVGEAVDV
FT                   VIPTLMNSTIFVLVAMIDIYRSFGVVVSLIFLLIPIAYISITVFLTSRRNRIRGKYNAA
FT                   KDKSTRKLSDILNNYEVVKSFGLEERESKKFCISLRDRVSIGTVYSCSENVITLLQKLS
FT                   SLIPHIGILYLSLNTNILTFEKAIKLNSLHFILKERLTEFAKEFTELYEYYYDYSTSTY
FT                   EKEEDSLDQVDVRGFDKDIVIRDVGIQRGEKVILKGINFTLHKGEKLAIAGPNGAGKST
FT                   FINALLRFLDYSGDIFIDGVEMRRYTRRSTRHIMAYVPQDNCILDDTILKNLQYGNKDI
FT                   SFEKIKEICKKYGTHGVFSSLEGGYLKEAGQQGGELSVGQKQYLSLMRAIIKDSPIFIL
FT                   DEATSDVDHQTETELIDYVMSVLADRTIIMIVHNHSLLKKFDNILFLKNKTMKGYGNIR
FT                   ELLKSSEDFVDFYLGEKSVLDTGIQP"
FT   gene            complement(<15467..>16279)
FT                   /locus_tag="Eint_030140"
FT   mRNA            complement(<15467..>16279)
FT                   /locus_tag="Eint_030140"
FT                   /product="glucose/Na cotransporter-like protein"
FT   CDS_pept        complement(15467..16279)
FT                   /codon_start=1
FT                   /gene_family="HOG000150371" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030140"
FT                   /product="glucose/Na cotransporter-like protein"
FT                   /note="similar to ECU03_0250"
FT                   /db_xref="InterPro:IPR022057"
FT                   /db_xref="UniProtKB/TrEMBL:E0S625"
FT                   /protein_id="ADM11160.1"
FT                   /translation="MHPIDRVCSEASFPMCEHLSSEICKSTSRGFLFFKTKVSSPTTVI
FT                   LLIIALLSATRMIRHVKALCSSVGRKEMLVFFYLYLGSAALEAVLVGSKEFISKHTHLF
FT                   LTSIQLSLYTSAFFSLFVGSITVDMFTRIFGLGATTLLKISTGIYSVGIGTVIFTGLST
FT                   SSKELTSVPFFVLNPLFFFLYMIFQVKRLRKTDGEVWAYGTLIISTACFLIANTFSFLG
FT                   SRVIGLMTDRYFDNLFFYHFFILCTFIMVHKYWLSVYNYEVESLRLEV"
FT   gene            complement(<16578..>16973)
FT                   /locus_tag="Eint_030150"
FT   mRNA            complement(<16578..>16973)
FT                   /locus_tag="Eint_030150"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(16578..16973)
FT                   /codon_start=1
FT                   /gene_family="HOG000150370" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030150"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0260"
FT                   /db_xref="GOA:E0S626"
FT                   /db_xref="InterPro:IPR004015"
FT                   /db_xref="UniProtKB/TrEMBL:E0S626"
FT                   /protein_id="ADM11161.1"
FT                   /translation="MGVKEIGDGKYGRVIAVSPDPLKITCKRGIKKDQKEAPKDIKEKP
FT                   FRNKSKVKLFKCVSMWKNPTSQIISLESRIAHDRFRSIQPKINIKDFAELKSSLDNAEH
FT                   LYSQDFAKRSIKEPEEIKELSKPQEPL"
FT   gene            <17134..>19422
FT                   /locus_tag="Eint_030160"
FT   mRNA            <17134..>19422
FT                   /locus_tag="Eint_030160"
FT                   /product="vesicle coat complex protein Sec21 gamma subunit"
FT   CDS_pept        17134..19422
FT                   /codon_start=1
FT                   /gene_family="HOG000149518" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030160"
FT                   /product="vesicle coat complex protein Sec21 gamma subunit"
FT                   /note="similar to ECU03_0270"
FT                   /db_xref="GOA:E0S627"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR014863"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="UniProtKB/TrEMBL:E0S627"
FT                   /protein_id="ADM11162.1"
FT                   /translation="MKTKLFAAPTERQLLEEMNESLTKSPVLTRSAVKALNSLFYMLST
FT                   KKLSEETIRNVYITLLKGFQSKDLYLKLCIYSAIEEMSKLTNEGLVGINILMNDLNGKI
FT                   PDDVKAMALRTLFSIVPDEMVYDFGKYVNQAFISTSQARKDMSIVVAYKLLCSNFTQVK
FT                   KWLEGVELSGNPLMDYHITGFLAQSRRLHLSSVEHSRGPAGIIGVRMVVDSMKENSEAL
FT                   PILRRFLNSKYCDEMIFMEAARAVSGLSEEYGSQFVDQAVQSLRIFLKSTNIVLQFSAI
FT                   RIVSQLAQKYPQKVSVANKEIEDLVSSENKSISMFAITSLLKTGTEETIDRLVSLIPSM
FT                   VHDMGDGFKKIAIDTLESLSNLFESRKFLYVDFLGNSLLQRGELEFKKYIIEVISRAVK
FT                   NDGMRERILEILCTYIEDSQYYQITLDVLGILGQEIPKSRAPSKYVVHVLNRLILENNH
FT                   VRAGALQCLYNISSVVSPSTVENAMKRCLGDQDESIRETAAFLLRNMKLERSCKPFSLD
FT                   ELGDLKGRVLQHIGKSDEDAKAERDTLIKNCRELILTEPNADVQIKVIKKVYEDKIILE
FT                   FSLENSLEGIQICDGVLNLASSDGEERNISIKIEQIEPLGSLLIAREWNVKEGCVINGA
FT                   FDFTICMEGDMSDTETDSISLEPFQITTLDFVKPARVKKSPNRRNEISFNLQGDIYTAG
FT                   KKILDLLNMKIISQESESSTMSMVLNGEYYETPVIIHVKLVFNVACKCAIEVYCDNEQV
FT                   AQKIVRLFD"
FT   gene            complement(<19539..>21017)
FT                   /locus_tag="Eint_030170"
FT   mRNA            complement(<19539..>21017)
FT                   /locus_tag="Eint_030170"
FT                   /product="UTP glucose 1 phosphate uridyltransferase 1"
FT   CDS_pept        complement(19539..21017)
FT                   /codon_start=1
FT                   /gene_family="HOG000113618" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030170"
FT                   /product="UTP glucose 1 phosphate uridyltransferase 1"
FT                   /note="similar to ECU03_0280"
FT                   /db_xref="GOA:E0S628"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR016267"
FT                   /db_xref="UniProtKB/TrEMBL:E0S628"
FT                   /protein_id="ADM11163.1"
FT                   /translation="MQEENGKETTLSGDEAKDFHKSLDEFDDKCTCKLLKEMKEILEKM
FT                   KKRHSNPIDLNEFYRLFERYLRTRSEKIVWEDIKSPKDKIIQYSDIPDPSEKSKELVKK
FT                   LAVLKLNGGLGTTMGCNGPKSAITIKDGKNFIDLVVKQMRYLNTKYDIEVPLILMNSFN
FT                   TECMTEKIVFRYDGIRKFSQSKFPRISSETLLPVSSSYGDKGMYPPGHGDLFYSLKNSG
FT                   MLEELLNEGYEYLFVSNIDNLASTVDLKLLEYFATNNLGFLMEVTDKTRADVKGGTLIE
FT                   YKGALRLLEIAQVPSNKKSEFTNFRKFTIFNTNNIWINLKDMKKKLEEGFFDLDIIENK
FT                   KTLGKETVIQLETAIGSAIKYFPNSCGIVVPRSRFLPVKTCSDLFLVESNLFVEKNGTL
FT                   QLHPSRVPRACPVVKLEGENFSKIESYEKCFKGIPDILELDHLTVSGNITFGKNVVLKG
FT                   TIIVLVDEKKEIYVPDGSVLEDEILHGHLPRREL"
FT   gene            complement(<21259..>25890)
FT                   /locus_tag="Eint_030180"
FT   mRNA            complement(<21259..>25890)
FT                   /locus_tag="Eint_030180"
FT                   /product="DNA-directed RNA polymerase II largest subunit"
FT   CDS_pept        complement(21259..25890)
FT                   /codon_start=1
FT                   /gene_family="HOG000222975" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030180"
FT                   /product="DNA-directed RNA polymerase II largest subunit"
FT                   /note="similar to ECU03_0290"
FT                   /db_xref="GOA:E0S629"
FT                   /db_xref="InterPro:IPR000684"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007073"
FT                   /db_xref="InterPro:IPR007075"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="UniProtKB/TrEMBL:E0S629"
FT                   /protein_id="ADM11164.1"
FT                   /translation="MFEEKVKKQIKSIQFGLFSPEEIRNGSVALIVHPEVMEGGVPKTG
FT                   GLIDLRMGTTDRMYLCQSCGGDNFSCPGHFGHIELTKPMFHVGYISKIKKVLECVCFYC
FT                   SKIKVSKRGVRSTLNNVWSMSKSKLVCEGEILDNGKSGCGNRQPVIKKEGLTLVAFMKG
FT                   EESNEGKVMLNGERVYSIFKKISDEDCVYMGFDLKYSRPEWMILTVLLVPPPAVRPSIV
FT                   MEGSLRGEDDLTHKLADIIKSNGYLKKYEQEGAPGHIVRDYEQLLQFHVATLIDNELGG
FT                   QPQALQKSGRPLKSLSARLKGKEGRIRGNLMGKRVDFSARTVITPDPNISLEEVGVPLE
FT                   VAKIHTFPERVTSFNIDKLEKLVRAGPNEHPGANYVLRSDGQKIDLNFNRSDIRLEEGY
FT                   IVERHMQSGDVVLFNRQPSLHKMSMMAHYARVMGDKTFRLNLSVTSPYNADFDGDEMNL
FT                   HMPQSYTSKAELEELALVSKQIISPQSNKPVMGIVQDTLTGLRLFTLRDTFLNEREVML
FT                   LLYAVNIEFSDTAPGETTYMGVNRTKDYDIMKVLKNPAIAKPMKLWTGKQILSFVLPNL
FT                   NYTGFSSEHNEDDNENINDTKVIIQNGYIHSGVIDKKAAGATQGGLIHIIFNDFGPKRA
FT                   AQFFNGVQKMINIFMTGIHTFSIGIGDTIADAKTVKMVDEAIRKAKEEVSIIIENARQN
FT                   RLERLPGMTMKESFESHLNLVLNRARDVSGTSAQRSLSGNNNMKTMVLAGSKGSFINIS
FT                   QVTACVGQQNVEGKRIPFGFSQRTLPHFVKDDYTGKSRGFVENSYLTGLDPEEFFFHAM
FT                   GGREGLIDTAIKTAETGYIQRRLVKALEDAIVRQDESVRSGNGLVYQVKYGEDGFDATF
FT                   LESQKVDVKNFTKRYYIDMFGNGELGIKQGQVSEEVYGILCSDVDLQKLLDQEYEWLVE
FT                   EIFEGPPISSIGEIDIEHDYRVKDIYQNAVMSPCNLTRLLASAKREFHLSAGDVSPYYI
FT                   LEAHKNLMTSNKILNVLIRTNLSVKRILLEHKLNTEAFNWVVEMIRAKILKAKITPNEM
FT                   VGTLAAQSVGEPATQMTLNTFHLAGVSSTVTMGVPRLKEIFNVTKNLKTPSMKIYLDKE
FT                   HCKTIELAKTIQNEIECLTVKDLCLSSEIYYDPEITSTEIADDKDFVEAYFEFPDDDVD
FT                   FSSLTPFLIRLVVDRAKLVGRGINLEYVATFISKELGNGAHVICSDENAVDMVIRIRIA
FT                   KSEDESLNFYMVVLNSLLKFQLGGYKNIKKVYISEDKNRKEWYLQTDGICLPQILGNPS
FT                   VNSQLTTSNDLIEIAETLGIEAARESILRELAIVIDGNGSYVNYRHMSLLADVMTMRGY
FT                   LCGITRHGVNKVGAGALKRSSFEETVEILLDAALVSEKNLCRGITENIMMGQLAPMGTG
FT                   NVEIMLDVKKLDKAIPLSNPVFKPNEPVTPVISTPSSDSFSISSGNWSPTHLEMAYPRD
FT                   LSGRLSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSVLTP
FT                   NFSNKNKSKDQDGNKKRRNEEPF"
FT   gene            complement(<26139..>26597)
FT                   /locus_tag="Eint_030190"
FT   mRNA            complement(<26139..>26597)
FT                   /locus_tag="Eint_030190"
FT                   /product="ubiquitin ligase Skp1-like protein"
FT   CDS_pept        complement(26139..26597)
FT                   /codon_start=1
FT                   /gene_family="HOG000150368" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030190"
FT                   /product="ubiquitin ligase Skp1-like protein"
FT                   /note="similar to ECU03_0300"
FT                   /db_xref="GOA:E0S630"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S630"
FT                   /protein_id="ADM11165.1"
FT                   /translation="MIEVETSDGRIFRVDTKQAYKSVLIKNVCTSTVCKYPISLKVSSS
FT                   TFEIIQKYMEIDTSQLSEDYNPLEIRFKPSDLNFFMEYDNKKLLDVCNGANYLEYPYLL
FT                   ELCCKIISDKMKYKNTKELAEFIGVEYNITDEELMRIEKEFEWISSDE"
FT   gene            <26728..>27015
FT                   /locus_tag="Eint_030200"
FT   mRNA            <26728..>27015
FT                   /locus_tag="Eint_030200"
FT                   /product="vacuolar ATP synthase subunit F"
FT   CDS_pept        26728..27015
FT                   /codon_start=1
FT                   /gene_family="HOG000056545" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030200"
FT                   /product="vacuolar ATP synthase subunit F"
FT                   /note="similar to ECU03_0305"
FT                   /db_xref="GOA:E0S631"
FT                   /db_xref="InterPro:IPR005772"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniProtKB/TrEMBL:E0S631"
FT                   /protein_id="ADM11166.1"
FT                   /translation="MDKRTRIGIIGDEETLTGFLIAGVENVHDNPNLIQVTPSTTEDDL
FT                   KRTFYTLTSREDLAIILVCDFAAEKIKEEINGYKEVIPAVLVIASKNKYA"
FT   gene            complement(<27101..>27538)
FT                   /locus_tag="Eint_030210"
FT   mRNA            complement(<27101..>27538)
FT                   /locus_tag="Eint_030210"
FT                   /product="40S ribosomal protein S16"
FT   CDS_pept        complement(27101..27538)
FT                   /codon_start=1
FT                   /gene_family="HOG000019803" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030210"
FT                   /product="40S ribosomal protein S16"
FT                   /note="similar to ECU03_0310"
FT                   /db_xref="GOA:E0S632"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0S632"
FT                   /protein_id="ADM11167.1"
FT                   /translation="MSRSVKSVTTQGKKKRAVATCVCTYSGEFSIRINKVPFKLITNTL
FT                   MIAKLKEIICIVEHSNIKDLSFDITCKIGGEVSRVYAVRMAFSKAILAFYGTYFDEWKK
FT                   QEIQKRLLDFDRFSLVADSRKREPKKFGGPGARARYQKSYR"
FT   gene            <27575..>28066
FT                   /locus_tag="Eint_030220"
FT   mRNA            <27575..>28066
FT                   /locus_tag="Eint_030220"
FT                   /product="60S ribosomal protein L13"
FT   CDS_pept        27575..28066
FT                   /codon_start=1
FT                   /gene_family="HOG000170452" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030220"
FT                   /product="60S ribosomal protein L13"
FT                   /note="similar to ECU03_0320"
FT                   /db_xref="GOA:E0S633"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="UniProtKB/TrEMBL:E0S633"
FT                   /protein_id="ADM11168.1"
FT                   /translation="MKGNRILPNNHFRKTSLKIKVHHDPETKLRIMKEKKIRKAKSLFP
FT                   MPLEKLRPIVRCPTIRYNRNERLGRGFTAAECNKAGLDYRHARRLGIAVDLRRRDTNQE
FT                   TLDKNAERIKTYLSKITIYESIQEAREKGAKPYAKEIMPLPKTKPVVESISREEIASYE
FT                   "
FT   gene            28159..28241
FT                   /locus_tag="Eint_030230"
FT   tRNA            28159..28241
FT                   /locus_tag="Eint_030230"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA Type: Ser, Anti Codon: TGA, Cove Score: 62.66"
FT   gene            <28364..>29254
FT                   /locus_tag="Eint_030240"
FT   mRNA            <28364..>29254
FT                   /locus_tag="Eint_030240"
FT                   /product="phosphatidylinositol-4-phosphate-5-kinase"
FT   CDS_pept        28364..29254
FT                   /codon_start=1
FT                   /gene_family="HOG000149517" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030240"
FT                   /product="phosphatidylinositol-4-phosphate-5-kinase"
FT                   /note="similar to ECU03_0330"
FT                   /db_xref="GOA:E0S634"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="UniProtKB/TrEMBL:E0S634"
FT                   /protein_id="ADM11169.1"
FT                   /translation="MEDQKINLVLESLSQIEEMMAEKLGVGDVEEIRRRGGIVMKAYNY
FT                   SEFKEIRALNGVEGLHKLGKQYILNKQIQGKSGSSLFFTGNLRFIIKTIRRCEFLCIRG
FT                   MMEEYRKYILENPKSLLCKILGCYSLYSEGKEEYFIVMESMLGGLGIQEVYDLKGASVK
FT                   RKGYSMSSLKEVDWIRNKKGIHLGNRKEAIISQIKSDVRFLRKHRIMDYSFLVSFNSRG
FT                   KEDFTSLPRNSYHSHTSEDKDIRFGIVDILTQWTFTKRMERLFHIFCCKPNSSCLNPDA
FT                   YMDRFLMMIESNIFK"
FT   gene            <29403..>31085
FT                   /locus_tag="Eint_030250"
FT   mRNA            <29403..>31085
FT                   /locus_tag="Eint_030250"
FT                   /product="phosphoglucomutase"
FT   CDS_pept        29403..31085
FT                   /codon_start=1
FT                   /gene_family="HOG000150367" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030250"
FT                   /product="phosphoglucomutase"
FT                   /note="similar to ECU03_0340"
FT                   /db_xref="GOA:E0S635"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:E0S635"
FT                   /protein_id="ADM11170.1"
FT                   /translation="MGNSKDSLRRKIEETETLPEKMNKEDGHENEETEIMRNKYLEETW
FT                   DPSGFKKDLETYGEKDIMRFIKFNTGGMRGLMRSGFNGINEVTCNLIGTELCKRFSSIV
FT                   IGCDGRYNSLNYAILLREIFRINGKEASLYPEVVTPFLAFLIPKLGASCGVMVTASHNP
FT                   KEYNGFKVYTSKGSQIGPPLDREIEDSMKMLDLTELDKEGELSNIFSRMKEENNALKEG
FT                   KTLLSGRVADLVDTNTWERSKLIDAYNRWMFENWGDEIVQRIRNTKPLVPIVFTGLCGV
FT                   SGEFVKKALKFYGLDGLVHFIEEECIPNPNFPRLPFPNPEVTETLEQSKASDLADIVFS
FT                   CDPDGDRFGLSERIDGEWVDYNGNEIAAMFMYFFVENFEPSSLAFVNTHLCNDLMEKVC
FT                   LDHGIKYLRTETGFKNVSRAVDSVEEKKVFAYEDSLGFLFGNGKEKDGIKCVVLMAHMV
FT                   QKELPSQILKKMERYGSFSSVNIHVRCADPGRVLKRVLKKLPNVKTEGKRSMVEFSDYK
FT                   VTLRISGTESMLKIYTSSRQLDKKGLSKAAEDFTKKYVRDEVL"
FT   gene            complement(<31144..>31674)
FT                   /locus_tag="Eint_030260"
FT   mRNA            complement(<31144..>31674)
FT                   /locus_tag="Eint_030260"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(31144..31674)
FT                   /codon_start=1
FT                   /gene_family="HOG000150366" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030260"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0350"
FT                   /db_xref="UniProtKB/TrEMBL:E0S636"
FT                   /protein_id="ADM11171.1"
FT                   /translation="MSSSRSVLYLDEFLLLDTPYVSEVLLDPREFYELDDIYSPTELNG
FT                   NDLLREITVDAIGALSPWPREIKRQPEDGDIYKPKKVRGAGKLREGYCGMCNLWLKLKT
FT                   SSYWYHMNYKHGISSKGSRYPEPQVRHVGNRTEGFCTICSKWIVLGHKASGRSTRFGWF
FT                   KHCQKSHGSSKTI"
FT   gene            complement(31775..31847)
FT                   /locus_tag="Eint_030270"
FT   tRNA            complement(31775..31847)
FT                   /locus_tag="Eint_030270"
FT                   /product="tRNA-Asp"
FT                   /note="tRNA Type: Asp, Anti Codon: GTC, Cove Score: 52.32"
FT   gene            <31961..>32227
FT                   /locus_tag="Eint_030280"
FT   mRNA            <31961..>32227
FT                   /locus_tag="Eint_030280"
FT                   /product="U6 snRNA associated Sm-like protein"
FT   CDS_pept        31961..32227
FT                   /codon_start=1
FT                   /gene_family="HOG000149516" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030280"
FT                   /product="U6 snRNA associated Sm-like protein"
FT                   /note="similar to ECU03_0360"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S637"
FT                   /protein_id="ADM11172.1"
FT                   /translation="MYPLTLLRISRNKIVELELKNNDHLRGLLYKCDMAMNLHLKSVTI
FT                   QKEDGSSIFINECYLKGTSIKLVKLESKILLEQREESVSSNKI"
FT   gene            complement(<32228..>33010)
FT                   /locus_tag="Eint_030290"
FT   mRNA            complement(<32228..>33010)
FT                   /locus_tag="Eint_030290"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(32228..33010)
FT                   /codon_start=1
FT                   /gene_family="HOG000150365" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030290"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0370"
FT                   /db_xref="UniProtKB/TrEMBL:E0S638"
FT                   /protein_id="ADM11173.1"
FT                   /translation="MKIIFSFLLIRKVSCYFLFELINDFVGYYEDMFFPSSIGAWAILA
FT                   GSFFVTFYGIRFPRISLAPYIAAIVYYNFCDIKEGINSISPKTVQTYHIPPDILQGSKD
FT                   LLGGSSTDPVSLWVVSLFLASALVWFLEIASGLLFVAGLYVIYRMFFHIGFEKYKETDP
FT                   EIFYTLFLGSFVILYYVTRRMVKYLLILLFAVTGSLILLVSIELITENYALGFYDLILD
FT                   LEDTKYLEVSSLPAPLSVWIITSFIGMFWQWRSSPDKN"
FT   gene            complement(<33127..>33390)
FT                   /locus_tag="Eint_030300"
FT   mRNA            complement(<33127..>33390)
FT                   /locus_tag="Eint_030300"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(33127..33390)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030300"
FT                   /product="hypothetical protein"
FT                   /note="similar to NCER_100634"
FT                   /db_xref="GOA:E0S639"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="UniProtKB/TrEMBL:E0S639"
FT                   /protein_id="ADM11174.1"
FT                   /translation="MYKSFLSKIDPPADYVGQKLASDLMYLIFGVGYTLGLIVGVVLND
FT                   LAYTMYISIATLIISIIVVVPSWRFYRRNPLKFRAPVKDKKE"
FT   gene            complement(<33732..>35507)
FT                   /locus_tag="Eint_030310"
FT   mRNA            complement(<33732..>35507)
FT                   /locus_tag="Eint_030310"
FT                   /product="EPP transporter-like protein"
FT   CDS_pept        complement(33732..35507)
FT                   /codon_start=1
FT                   /gene_family="HOG000149514" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030310"
FT                   /product="EPP transporter-like protein"
FT                   /note="similar to ECU03_0390"
FT                   /db_xref="GOA:E0S640"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniProtKB/TrEMBL:E0S640"
FT                   /protein_id="ADM11175.1"
FT                   /translation="MQVESEKAELLWKNLRLASKGLGGARNTILKGVSGVIEPSTMTAL
FT                   MGTSGAGKSSLMNSLAGRISSDMDLSGEIFLNSCQRSKNSWGNFIGYVEQEFHAYEYQT
FT                   VYETLLFSSKIKIKSEGEEQKVKNRIEEIIALLGLSNSKNKYIANLSGGERKRVSIGVE
FT                   LLGNPPILFCDEPTSGLDSFNALNILSLLRDLSKMGKTILVTIHQPSYEMMNFFDKFIL
FT                   MTMGNIVYDGDIKSCIAFFEECGYRLPELTNPMDFFLKTISLDTRTKDKEEKSLRTISH
FT                   ITNEWRKKKKNLEAKLHEEVRGKSSENKLSLGFLLLLNRNLKNYIRNINYLKVKAFQKI
FT                   FFMVVFGFAFLNIGYSVESIYTRLGGITFILTNTVFGICNPIFSIFPYERKVILRERRS
FT                   GMYSGVTAFMAKYCSEILMNFIIEEPYVVIIYWMMGLNSDLKTFLTFLAITNSLILFSI
FT                   AYSLAIGAMTSSQSNSQVFGPMGLLVFLIYSGSFNNPNTIPEYLRWMVWLSPMYYAVKA
FT                   SFQNQLNGVVFESSYARTTGEEQIKLRGLDGTGIQACILMLIVMTFFFLVSGALALHYG
FT                   TENNMKVVTSDEEEV"
FT   gene            <35506..>36621
FT                   /locus_tag="Eint_030320"
FT   mRNA            <35506..>36621
FT                   /locus_tag="Eint_030320"
FT                   /product="hypothetical protein"
FT   CDS_pept        35506..36621
FT                   /codon_start=1
FT                   /gene_family="HOG000150364" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030320"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0400"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="UniProtKB/TrEMBL:E0S641"
FT                   /protein_id="ADM11176.1"
FT                   /translation="MGSNKLQNYNPWNVPQMPEGIKSLFEGQEVFVVVDDTKVRVRKEE
FT                   ISTEGNCKREGIIRDIPLIEIRSLHVKNDEGFFLKLRLLEETIIFKFDSHHSRDIIKSM
FT                   ILSFMKTDQDVIRKILESDPAVKTMFNNLKQCISSSKFWTINKDRMRQMMPIVRQQPSR
FT                   EIEVDEKTFISSLDPVLLNIFGQMNCSVNQFYNLLRQSYFCNTKNEKNSLDRMINSAVR
FT                   DYEVRQDFASRINTHSVLALKPIEDVEIRPSTKEGRKVEFLPIYPFEEEKPEKPRREFR
FT                   FDRHPLKCELDLEIVPMTEKKMFEKKDLVWIRDLSKVVYKSMKEEDGAFLDEVSEITKR
FT                   FLDNMERKYGKGCDVYLKRILPTYFIEGKNK"
FT   gene            <36675..>37361
FT                   /locus_tag="Eint_030330"
FT   mRNA            <36675..>37361
FT                   /locus_tag="Eint_030330"
FT                   /product="hypothetical protein"
FT   CDS_pept        36675..37361
FT                   /codon_start=1
FT                   /gene_family="HOG000150363" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030330"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0410"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniProtKB/TrEMBL:E0S642"
FT                   /protein_id="ADM11177.1"
FT                   /translation="MDQEDKIVFSSKEVKEFLGIKFITESCVLLRLSYQVRYKALVLFY
FT                   NFCEEIDLVDLCTASILLASKLEEEVCTLKKVIYVFNYLYTKYESKAAPLTNRQSIRLK
FT                   EGCVIAETRILKSLGFDVSFEDVYCDFVEFLQTMDLPIDFIDKAIQVFNTMIQWPEVKL
FT                   LDSKSLAKATIESLFGQNKEFKDFVSRYNMFQKKKFDLQTYKEIPTIRNIDEGLVADFA
FT                   KRQKRR"
FT   gene            complement(<37400..>39970)
FT                   /locus_tag="Eint_030340"
FT   mRNA            complement(<37400..>39970)
FT                   /locus_tag="Eint_030340"
FT                   /product="nucleosome binding factor SPN subunit SPT16"
FT   CDS_pept        complement(37400..39970)
FT                   /codon_start=1
FT                   /gene_family="HOG000150362" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030340"
FT                   /product="nucleosome binding factor SPN subunit SPT16"
FT                   /note="similar to ECU03_0420"
FT                   /db_xref="GOA:E0S643"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR013953"
FT                   /db_xref="UniProtKB/TrEMBL:E0S643"
FT                   /protein_id="ADM11178.1"
FT                   /translation="MSMIKLEEERFKRRSKEIRKHLGGPLVVLLGKGQDVLEFRINSAL
FT                   FIYLLGYEFPETILIVDDTCTAITSQKKSEILKQISCLNIVVRNKDNSNMDEIYGMLRN
FT                   SYYVADSEEIQGDFCRNILEKISVSDATEKLGEIFLTKDDEEIKNSKASGMAVSALMKK
FT                   GMEMLWDGAFEKARLEEMMNSNVDGVDMSLCEFSFPVEYTRDRVRIGVRYNGYCSEASR
FT                   TIVTNMEEAYMAQEYILGLVREGTDSSTVYSEGEKYFAENGLVFDPDFIYTIGLMSKER
FT                   SFKNSFILRKGCVFVIRLNNETMSLSNTFILEEVPEYLTLQDAAPDFLDKRSRFRDKTK
FT                   EYELSMRRKEHQKELLDKLIEERLEFYRNLSDSGKDEEKKEDKIVPYGKESLVPRQGRL
FT                   VVDFSRESIVVPIGSYAVPFHVSSIKSIAVTDEKILRINFKAEPKGRDGAEETEHEQGG
FT                   ESTQSTIKSISLRGNNSRELAEEINNLKKIHSTRKTAGEAESFEELKISQRPLSLTDVY
FT                   MRTDIKTGSRRRKVGSLELHANGFRFKEENVVILFSNIRHIFFSEGNVETNAILHLHLL
FT                   NPIILGGKVTNVQFYREAGSGMIYDTMKRGDEHMEYIIEKEEEDRQEAINQQFRSFVNI
FT                   IESETDFKVQIPKTGFHGVPFRENVMIKQTHECLVSLDEAPYFVLTLEDVEVVNFERVV
FT                   LTVKTVDVLFILKNKYPLDVVMKNKSRLLVSILSVDVQSVNKLKEYLDSNNILFMETSA
FT                   SIRWNNVIGSIMKDPISFYEDGAWSGLMVGDSEESSEDEELETSEESNSSETEDLSTDD
FT                   EDVSDISSEDPSEDESDYDSSDDEDEEDDSEEEYDQEPGKRRKN"
FT   gene            complement(<40028..>41251)
FT                   /locus_tag="Eint_030350"
FT   mRNA            complement(<40028..>41251)
FT                   /locus_tag="Eint_030350"
FT                   /product="WD40 domain-containing protein"
FT   CDS_pept        complement(40028..41251)
FT                   /codon_start=1
FT                   /gene_family="HOG000150361" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030350"
FT                   /product="WD40 domain-containing protein"
FT                   /note="similar to ECU03_0430"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:E0S644"
FT                   /protein_id="ADM11179.1"
FT                   /translation="MYRANKMFNFHSPMSGLVLVEFEDQEGRKVSDRLQIPVKILRSQL
FT                   QLLANTTLSLYINGQPVLETLEETLELLGISSEEEVIKIRMSDEEPATQAAFHCSSSFS
FT                   GHEGPVLCVRYGGVIVTGGGDSTVRFWDARTKTQSKIVKRHTHWVLSLDVSPDGRYVAS
FT                   GGLDGGVNLYSREGEYIRSFLGHRKGVVALKFYKESLVTGSRDNSVVVWNLNGEVLLSY
FT                   AHTMPVTCICSGEDYIASGSKDGRIKVYKNLRFSDELRGHSSGINTIDCNGNYMVSGCD
FT                   GGDVIVWKGFVLHKRMKHNAEVISVSISQNRLYAASGSFDKSVRLWSVDSGQQLLIFRH
FT                   VDLVYKVKMMNDLIVSCSKDKTVKMFRVSKKKVVSDLVCDDEVYCFDMGSEGGLVCGTK
FT                   SNRVYFFN"
FT   gene            <41346..>44489
FT                   /locus_tag="Eint_030360"
FT   mRNA            <41346..>44489
FT                   /locus_tag="Eint_030360"
FT                   /product="DNA-directed RNA polymerase subunit B"
FT   CDS_pept        41346..44489
FT                   /codon_start=1
FT                   /gene_family="HOG000222963" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030360"
FT                   /product="DNA-directed RNA polymerase subunit B"
FT                   /note="similar to ECU03_0440"
FT                   /db_xref="GOA:E0S645"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniProtKB/TrEMBL:E0S645"
FT                   /protein_id="ADM11180.1"
FT                   /translation="MRLKDAAKAHIEAYDAIFEEHILDNLVANIPPLIRGKTKIVVEDI
FT                   HIYPPFLSDKDHISVDRRLFPWECRERGLTYKGKIIIRISLFHDNKHIMTEDKLAGYFP
FT                   IMVRSSLCHLRNAKNMNKVGEDEDEVGGYFIINGFDKFIRFTITQKRNHIFAFKTRKRE
FT                   SFFTGYGVSMRCVGKDEIGHMNNLYYCTDGNVVLKMYYRRSEFFFPLVLILRALVNTTD
FT                   EELYEALGQGERAIHLLKCFAEYNVFSRKECLDYIGSRFSSMANFGSKIEVAEEILSKY
FT                   IASHLSSHLDKFNFLILAAKKLFSFVNNEIAEEDFDSSGNHELHTTTQILSSLLRDKIE
FT                   EFMRSLPIAYKKAYLKSEGEKRRLEEDSDSEVVDGIYEDKLDILKIKEIFKKAVMNIGQ
FT                   KVELFLSSGNIFLSCCSDILQTTGLSITLERTNFYRYFGNLRSINRGTHIPSLVTRIRK
FT                   LRPESWGFICPVHTPDGACCGVLLHMAKGADIVSRANDFDTEILFELGVVPTIRGVRME
FT                   VPVLVDGKVIGSTSSPQFLVRMLREYKVKNRLKIEIVYSEGTKVFSSVCIFSSMGRFIR
FT                   KVMNQRLGSEEWVGIMEQVSLNIDLERGEGDYHEIDKSNILGIIAGLTPYSEHNQSPRN
FT                   MYQCQMAKQAMGFSAYNMKTRIDHTMYNINYLQSPLVRTKGYDMVKDYPLGINCMVAVL
FT                   SYTAYDMEDALVINKSSIERGLFTGLIYKTERIVLNKGYSFLYLPSVGEKIQKDSILYK
FT                   YVDLEDREYQTRYLETEDGVIDSVRVFESDAGERCALLTIRMVRNPTIGDKFSSRHGQK
FT                   GVCSVHWPSIDMPFTESGYVPDIIINPHAFPSRMTIGMLMESIAGKVGCLSGNTQDGTA
FT                   FEKNLSQGEDEETVGRKEYICSELQKYGFNYYGNEPMYSGVSGNEFRVDVFVGVVYYQR
FT                   LKHMVGDKFQVRTKGAIVSTTRQPVGGRKRQGGIRFGEMERDTLISHGASHLLQDRLLK
FT                   CSDGTTFEYCGACKSILFTSSGDCICGSSDIRIVEMPYVFKYLCYELLAMNIRVKLDL"
FT   gene            <44541..>44849
FT                   /locus_tag="Eint_030370"
FT   mRNA            <44541..>44849
FT                   /locus_tag="Eint_030370"
FT                   /product="hypothetical protein"
FT   CDS_pept        44541..44849
FT                   /codon_start=1
FT                   /gene_family="HOG000150360" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030370"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0450"
FT                   /db_xref="InterPro:IPR013885"
FT                   /db_xref="UniProtKB/TrEMBL:E0S646"
FT                   /protein_id="ADM11181.1"
FT                   /translation="MRRTKKNNARDGNSLQDRPKKKEGQAGLEDDIEAIFSSVGSSEAH
FT                   KLKERKEDSESDEEKYFSVGKNGRRYHEGLPIYTPEELHLGNGGDTEDCPIYCDCCM"
FT   gene            <44939..>45514
FT                   /locus_tag="Eint_030380"
FT   mRNA            <44939..>45514
FT                   /locus_tag="Eint_030380"
FT                   /product="ARF GTP-binding ADP ribosylation factor"
FT   CDS_pept        44939..45514
FT                   /codon_start=1
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030380"
FT                   /product="ARF GTP-binding ADP ribosylation factor"
FT                   /note="similar to ECU03_0470"
FT                   /db_xref="GOA:E0S647"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:E0S647"
FT                   /protein_id="ADM11182.1"
FT                   /translation="MYFSRIVRKIKKERSQLRVLVLGLDNAGKTTVLHKLLGKAIEHVQ
FT                   PTFGYQIYDVTYKTLSLIILDVGGQSMFVEYWSSYYEDVDGVVFVFDSSDRRSFIEHVG
FT                   HIKSTLVDTPMLILANKSDLNPTFDPRSFGNDFCEFLEKNDVKLSKCCGLSGDGLEEGF
FT                   DWMIGRAMKGLMVDEEEEKKMEQEKIFG"
FT   gene            <45543..>46100
FT                   /locus_tag="Eint_030390"
FT   mRNA            <45543..>46100
FT                   /locus_tag="Eint_030390"
FT                   /product="splicing factor 3A subunit 2"
FT   CDS_pept        45543..46100
FT                   /codon_start=1
FT                   /gene_family="HOG000149513" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030390"
FT                   /product="splicing factor 3A subunit 2"
FT                   /note="similar to ECU03_0480"
FT                   /db_xref="GOA:E0S648"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S648"
FT                   /protein_id="ADM11183.1"
FT                   /translation="MKRRKGSSLGSMHTVSEIRKHKRERNRKLLLEIYGLEKDPNLTKD
FT                   ARGRYVCALCKTKHLTEMSYVKHREGKKHREVLSRKEETTRIIPSFSIRNLVREGKKGY
FT                   GIAVDYKLAEEMPQHRFVSSLEQGVEEYDECFGYLVFVCQPYENIGFKFENREIDRTSI
FT                   YEDIDEETGAYMFHFFFQKTHD"
FT   gene            <46145..>46459
FT                   /locus_tag="Eint_030400"
FT   mRNA            <46145..>46459
FT                   /locus_tag="Eint_030400"
FT                   /product="DNA-directed RNA polymerase subunit M"
FT   CDS_pept        46145..46459
FT                   /codon_start=1
FT                   /gene_family="HOG000228131" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030400"
FT                   /product="DNA-directed RNA polymerase subunit M"
FT                   /note="similar to ECU03_0490"
FT                   /db_xref="GOA:E0S649"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="UniProtKB/TrEMBL:E0S649"
FT                   /protein_id="ADM11184.1"
FT                   /translation="MLFCPLCSSMLVVKRQPAGNELSCIMCGYLYGISKEMSKTIAMTP
FT                   KKSDGFVDEDENLKFVSKCGKKCECGSEEVSFVELQTRSADEPMTIFYKCIRCKKVWKE
FT                   "
FT   gene            complement(<46564..>47628)
FT                   /locus_tag="Eint_030410"
FT   mRNA            complement(<46564..>47628)
FT                   /locus_tag="Eint_030410"
FT                   /product="vacuolar ATP synthase subunit C"
FT   CDS_pept        complement(46564..47628)
FT                   /codon_start=1
FT                   /gene_family="HOG000149512" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030410"
FT                   /product="vacuolar ATP synthase subunit C"
FT                   /note="similar to ECU03_0500"
FT                   /db_xref="GOA:E0S650"
FT                   /db_xref="InterPro:IPR004907"
FT                   /db_xref="UniProtKB/TrEMBL:E0S650"
FT                   /protein_id="ADM11185.1"
FT                   /translation="MFVLVGLPVEEDVPQPTEDLIQEDYGVNCSRISLPSFTGVSLEGI
FT                   VNQVERLNLLEKSCEGLFKTFMGYSRTCRIAKEVECDSIENAGNFLRWDNQNFPTNSID
FT                   KAILLLDGEYGRVYKAYEEKVEEFGDARKECEKLQKLTRGSLCDINLNIIVGKAEKYEF
FT                   LKVLYVVVQKSKSSEFNRVVEDSPHISGDAVEKINSDEDHNLFKIYILHQGEEEVRNMM
FT                   HSEGFLIKDLDDNMISSEEMITKRRKAEERFSAVERLLTTFLQINLKEVLKILVHVKLL
FT                   KLFVESVYRYGLPTEYMFFVTSGEKSNILSQWITIAKNWPSDRIVYEEDGDNNEEGEIF
FT                   FAFSEIEMHREEEE"
FT   gene            <47777..>51496
FT                   /locus_tag="Eint_030420"
FT   mRNA            <47777..>51496
FT                   /locus_tag="Eint_030420"
FT                   /product="hypothetical protein"
FT   CDS_pept        47777..51496
FT                   /codon_start=1
FT                   /gene_family="HOG000150359" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030420"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0510"
FT                   /db_xref="GOA:E0S651"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S651"
FT                   /protein_id="ADM11186.1"
FT                   /translation="MYLHRSELEAGIEKLMKTMEDHEVLERCRKSLREMDKIEEENIKD
FT                   FIRETRDIVDAFVKGLRIKKQVPIFVIDFIYTFLVNDLLISSDIKEIISVISEGNWCEV
FT                   SKMKILQMSYYIIRYESFKEDLALSLFKSIVRMIDDRSRQVQTTAKPIAMHLVDVVFSR
FT                   ACPVFKEEVQSEEGEPESTAVCPDVLEGNRPGSERLLVRGGFQFSNSINDGITFLKHLL
FT                   ENGNTSKEMNHFMVDAVLLITRKSDLFEYEEFRKIYDSEVMAMLMELIKRRCSSRGNVY
FT                   KVLARLVERHNCLFEKQILAVFDEMEKSYSLLDDLETEMFLDFFGSLDILLFEGYSSTI
FT                   RRMFFNILENASFDDEFGNEYVIDTIRNSLNGQLKAQEKTSGKFHSSTKAFFGKFSEIL
FT                   YAKLSDIDNVHPKVECLLEIVLWFYSVSGNKEFLDRFMVLGCKLGFTDVVCRNAIENRK
FT                   HIQDSWWIVLENGKDHLGKIIESICIFDAEEIFFLIKGIEQPEPSCTWTSKERVDFLLS
FT                   VFNIIKPVVVEPLNIKIFEMILGGILRESGSEEGYPTKVFCSILMDYVGHLEALTPDVE
FT                   SVIFVLLQKMLGKDLERNGLEILETLSFVLRTMTPESCWDTILQCIECSCIPCLYSSLY
FT                   PIIRWIIEGCGHLISNEHFGVLIDCLYSMCLSPSSEISLKAIFIFQDIGESLMSRRAFD
FT                   RSPKGKEEKNRDMNPAWAKYIKVLGEMTNDGRHMVCETAIKYLVMFLEAECEVMNSEEL
FT                   DFAANNGLIPVLEKGREFAKGRDSEAHCTLMLIMDECSRTIGKMNYHEELYGKFLELVA
FT                   DSLCNTDSSEIQNMCIESLKMMTNRISGTRDEGKSICQEGSEHSPEDMGFKAGIGERKS
FT                   LQPLQRLRDLVLNTYKLIFSSIPVNEGYSTSVCLDMIDSVKGFGFKSSERRSLIPLLRK
FT                   FVHSDCQTLQEKILNMVGEWPAEDGGLDMQLEAYNDWIEFKDIRLSRMLIERIGRILSK
FT                   DLEDTRYSEAAMDLVEYSKEKAFWEDVVRAFMKGSENIKTRASFISFINGCRVILKEAP
FT                   KVKALQCSPETEGCSGLGEEASESMAKAIKKRERIILEFLAFYHEVLSKFAPNTKRLDS
FT                   HSMQPFDQTTESDVREGYKVIFEMSELGSGLGKESISFKCYEILFHDIELIYSDVVEKI
FT                   RKVLTEYNEMEMIYNGLYSRVKQREVYTLLEKIWKSGNKKLVDDVKDVLVESLRSKDYR
FT                   VIDHVRKCLEVILV"
FT   gene            <51593..>53638
FT                   /locus_tag="Eint_030430"
FT   mRNA            <51593..>53638
FT                   /locus_tag="Eint_030430"
FT                   /product="Hsp70"
FT   CDS_pept        51593..53638
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030430"
FT                   /product="Hsp70"
FT                   /note="similar to ECU03_0520"
FT                   /db_xref="GOA:E0S652"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:E0S652"
FT                   /protein_id="ADM11187.1"
FT                   /translation="MSEEKQKSNTSRAIGIDLGTTFSCVAGYIGGKVEIITNSDGERTT
FT                   PSVVSFDENDCTVVGTAAKNMAGLDPTSVLFDSKRMIGRDFDDPKIQNMMSGWPFKIVR
FT                   YNGREKKEMPHKDPSSTNSYDNMAYKFTKNGKTKYYTPPEISSKILSNLKKAAEARLGG
FT                   PVDAMVVTVPAYFEDPQKAATKAAATIAGFNEDRVRLLAEPTAAALAYAHIQTQKNANF
FT                   SAKEDVLVFDLGGGTFDVSVLDFEFNATTGTFGIVKAIDGDTFLGGQDFDNLLINYCIS
FT                   EFLKKNPSIQKTDLKESALLRLRAECTRVKAVLSSATSSTIYVPCFHMTDDLNVQITRA
FT                   RFELLCDHLFKKCMERTKGCLLRSTGVPSVEYSSDGNKLLLNPSLEKTLNEARNNISKV
FT                   LLVGGSSRIPKVKALLAEYFGAHKVIEPVNADEAVAYGAAYQAASIYSDAVEAGSSLLL
FT                   IDCVPLNLSIETAGGVATPLINCGDNIPIKKTETFTTYEDNQTAVTINVHEGNRPMCKD
FT                   NKRIGTFNLDGIIPGPRGTAKIEVTFDVDHNGILVVTAEDKQTGKSNKITVTNSQNRLS
FT                   QEEIERMAKEARDNEQRDNEVKEKMGKRMSFDQAIFTFKGLLEKANISQEKKDESLNFI
FT                   KEHEEWLSKAQGPDDFEVEELERRSNELQSFMNDIMKESGMSAPTA"
FT   gene            <53720..>54250
FT                   /locus_tag="Eint_030440"
FT   mRNA            <53720..>54250
FT                   /locus_tag="Eint_030440"
FT                   /product="synaptobrevin/VAMP-like protein"
FT   CDS_pept        53720..54250
FT                   /codon_start=1
FT                   /gene_family="HOG000189970" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030440"
FT                   /product="synaptobrevin/VAMP-like protein"
FT                   /note="similar to ECU03_0530"
FT                   /db_xref="GOA:E0S653"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:E0S653"
FT                   /protein_id="ADM11188.1"
FT                   /translation="MAIISLVVINVHTRKIKAKAFSLKQFSFFTRGKVKETLTFISQEL
FT                   AEKLETYEFQEYTHEFNDEKAYKLFSMVHNDYAYIACADDDYPGVVALRLLQEARHGNI
FT                   EKLIEEYKDPASKHTLLQIQNEVEETKGALSKTLMAVLERNDKLEDLVAKSEHLCYETK
FT                   LLFKSAKKKNKCC"
FT   gene            <54323..>56467
FT                   /locus_tag="Eint_030450"
FT   mRNA            <54323..>56467
FT                   /locus_tag="Eint_030450"
FT                   /product="DNA mismatch repair ATPase MutS"
FT   CDS_pept        54323..56467
FT                   /codon_start=1
FT                   /gene_family="HOG000149511" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030450"
FT                   /product="DNA mismatch repair ATPase MutS"
FT                   /note="similar to ECU03_0540"
FT                   /db_xref="GOA:E0S654"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="UniProtKB/TrEMBL:E0S654"
FT                   /protein_id="ADM11189.1"
FT                   /translation="MDHEFRQFYETLEKGKFKFFGKGEGYSVFNSDIEMIPQYNARDVI
FT                   ERKEMKELRLSKGEIEGIVRALLTEIKIGVQEYNGQVLVREGFPGNWKDFTDLLLDARS
FT                   IPSIAAVKLGEVVEISFLITSESTIYTSVFEDDEIFSSLYWILSEVNVVEVVYDNKKLG
FT                   GFFNRLGVSSSLRRCEENTVKLLCRYLRISEENYKCEEYTRPFICRIDRSVLSALNVCS
FT                   DDEHCVAKTFCCYTNQGWRLLHRMFLQPLRNKDEIERRLETVDSLRTLNLNILKKFPDL
FT                   LRLSKRIETGRISLREILRLIQTIDIIPELLSSFSSSLPLTRDFSKPLKSIFSAFGPFK
FT                   EEIVRVVDLEAAEENVYRIRPDVSARLLELSEALGEIEKEMNGEYERVSEIYPKIKIDK
FT                   NTGVFKTTKGEYQKAQDLLRKEGFVELNFVKGGVTLTTRILSSLNGRQVALKKEIDDEE
FT                   KEVMDRIKRMLKSYISQIESLNYLTALIDVFNAFSIKASLKGYSRPMFNKGIFEIRNGF
FT                   HPVLEDQDYISNSIRMEEKKMCVVTGPNMGGKSTFLKTCGVVALLAHIGCYVPADYASI
FT                   PILDGIYARVGANDCSFTGSSTFMMEMADIARICRLSSSESLIIIDELGRGTSAIDGLS
FT                   IAQAVKEHIVQKKALCLCATHFPELCGDDVLNKKVKNEGTLLMYEVVDGVCDTSFGIMV
FT                   AEKVGFPTKVIETAKEYMEK"
FT   gene            complement(<56512..>58950)
FT                   /locus_tag="Eint_030460"
FT   mRNA            complement(<56512..>58950)
FT                   /locus_tag="Eint_030460"
FT                   /product="Rho/Rac/Cdc42-like GTPases guanine nucleotide
FT                   exchange factor"
FT   CDS_pept        complement(56512..58950)
FT                   /codon_start=1
FT                   /gene_family="HOG000150357" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030460"
FT                   /product="Rho/Rac/Cdc42-like GTPases guanine nucleotide
FT                   exchange factor"
FT                   /note="similar to ECU03_0550"
FT                   /db_xref="GOA:E0S655"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="UniProtKB/TrEMBL:E0S655"
FT                   /protein_id="ADM11190.1"
FT                   /translation="MAKLRKVIEAIGEIFKSEQNYIQDLLMWERDFRIWILNCPLFSTP
FT                   KIKYEICDRIFINLENIQKLHENIYKDMKKMNLSIYSEITGNHELKNTEEYMIDKVDIN
FT                   NPKIQKLEYVSIYEKYIEEFELYKEYVRRLPKADFELEKLIFRLPEFEKGVENFLKEKN
FT                   AEFLGVKHFLYRPSQKLARYPMLLRAVAKNTEGELKSAYENLIEKFMKIAKNADKEFNR
FT                   FGTQFAIYRLGINFSYKKEVRNQHCLALFQKKRRLLKEGKVLVRGETKEDSPTCKLFIF
FT                   DHLILICDYPKNKFAEIFIREEPIFMARLVVLKKDTGFFPQDESFEELSPLLLFEIGGD
FT                   KAQGLYFQDKGERDVYYNIIQKAILQARSKLRSDVTIEELPFNIDEPVKYVCKATDFDW
FT                   YGESLSSSGSLEEESFSTPSEEEKSFSEDSEEKEVEVEDNELIEIVNRFLEIKKKNSEE
FT                   EKRQSEETDQIGSQTKPKKGQSLWKILFPTADFFVSSIQLPPPLNRRDDAEYIFAQKNM
FT                   YIIATSDGVCRFFNNRIDKILERKVKKIIYDSTYEIMLYQSESILYASHFNVESTSLEE
FT                   NVLKDDIEDFFYGITKQGPCIASTDSGDGKSFSIFLFLAIVSNRSIVIELSRRLYVGLQ
FT                   VYNVFFCSDKIVIASKDFEIIDMETLRTEELLQIYDPFIPVLFQGLQGITARSIFPVSP
FT                   HEFLLCFDSIGFIVDEIGKLKRTDVIFLWNCVPIEFKVIRNYVICIGANVINIFCLKTG
FT                   LLVFSKFQDGLRFVTGSLEPLVHDGRKFYKIIFGEDSEEEDIPDSQSKDQDRKEGSKEQ
FT                   "
FT   gene            complement(<59047..>60045)
FT                   /locus_tag="Eint_030470"
FT   mRNA            complement(<59047..>60045)
FT                   /locus_tag="Eint_030470"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(59047..60045)
FT                   /codon_start=1
FT                   /gene_family="HOG000150356" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030470"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0560"
FT                   /db_xref="GOA:E0S656"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniProtKB/TrEMBL:E0S656"
FT                   /protein_id="ADM11191.1"
FT                   /translation="MERTTLYSLIEKQVNPADSTPLDVHKVRKYCYYGFSDGFLRPKYW
FT                   KIFLGYYSKNKFKTEMFLRNMRSSYGFYAEKMKEEFKGKEECYKVIENDVCRTFIRPRT
FT                   DHGSFEEKRKYCEFLDSVSENSQESHRNIVERILKCYAMTNSSVRYVQGMNLVLIAIYY
FT                   VLCRSEDSEDRKYCEEDTFFCFNSLMAEIGDNFIGDFDQCSGGIVHRMSTVMEIVKNAD
FT                   GELYEVMRKKGLTEGGFHMKWILLMFMPCFEIEDVVWLWDRLLSDVCRFEIVLYCCASA
FT                   ILLMKNMILREDFDVCMEIFQKPLDMGVETMFNVADHLRRKDYEILQMDDQ"
FT   gene            <60380..>60949
FT                   /locus_tag="Eint_030480"
FT   mRNA            <60380..>60949
FT                   /locus_tag="Eint_030480"
FT                   /product="Vacuolar import and degradation protein"
FT   CDS_pept        60380..60949
FT                   /codon_start=1
FT                   /gene_family="HOG000150355" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030480"
FT                   /product="Vacuolar import and degradation protein"
FT                   /note="similar to ECU03_0570"
FT                   /db_xref="InterPro:IPR018618"
FT                   /db_xref="UniProtKB/TrEMBL:E0S657"
FT                   /protein_id="ADM11192.1"
FT                   /translation="MEASMYSREALALEDGARYRGEQLTNGGSFKIEMNVDAIDIEQEF
FT                   ICGTFEIHNLTDRYELLTTYFEGEIVGNIYPFTTEEYSMGNPDIIHWKLFPEWKGEYVY
FT                   REGSYDIKKSNFMYIKIKELFLLPDPRLKSIPGASIDGHYYCCYYKNLDCFAGHYYYKN
FT                   TSNLISQQVLLDRVFSRKSRSKSFSK"
FT   gene            <61067..>63874
FT                   /locus_tag="Eint_030490"
FT   mRNA            <61067..>63874
FT                   /locus_tag="Eint_030490"
FT                   /product="ubiquitin carboxy-terminal hydrolase"
FT   CDS_pept        61067..63874
FT                   /codon_start=1
FT                   /gene_family="HOG000149510" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030490"
FT                   /product="ubiquitin carboxy-terminal hydrolase"
FT                   /note="similar to ECU03_0580"
FT                   /db_xref="GOA:E0S658"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniProtKB/TrEMBL:E0S658"
FT                   /protein_id="ADM11193.1"
FT                   /translation="MDEGWKVKRPSSGTKVESRLFSAQGHKWKLVLSYKGGRVYLALEY
FT                   QGGSYHDVLTAFCFSIDGEKYEYQYQFSMFNTDMGMYIEEKDSYVIKVNISVRSGYYDS
FT                   KKETGYVGLKNLGATCYINSLMQTLFNIAKFRNDVFGLEPVGRVLLLQRLFKEMQTGEN
FT                   PVDTTDFVVNNIWVDDVNAHQDIHEFSKVFFDALEKDSKRKDFIEDLIQGELLTYINGR
FT                   CGCVRRIKEKFQDIQVEIRDFFNNKLSSNLEESLKRYVKSETLEGNNKYNCENHGLVDA
FT                   EKGVMFGSLPPVMFVLLKRFNVDFETGNGYKINDYFEFPSSLDMSPFMDKDEGKESESP
FT                   EIYNLYSVIVHRGDHDEGHFYAYVKIKGKWIKFNDTVVTEAGEVEALEHNFGGRHPYKD
FT                   KVRDHSGYYLVYLKKGMEDELLNAKVTIPLQTEEMLKKKQNKVSIKCVKIENIRNYRGA
FT                   GFYNVNSYDYPLCSYTEFVVKEGDSIKLLRNNIERLLSTRKFLYLFECTAMDEGERTGA
FT                   ADRPGKRIKEDGYGLTGPRTEKDSEEDSRIVENSRTSYQRKVVLVKDGIINADADYFIY
FT                   TCYPEVDFEKNRLIFLKVFSNTPWCEDTLPTSLRLCACIHMDGTIGDNIDAIIEKTSLD
FT                   DISVFREFDPSSALDLSSKVSDLPQGDVLIVVRREDVLEFLDFINEFYRRMCVNVLCGP
FT                   HNFTVFVKRGLTGLELESKIRRFVGSKEIFLKPKREAVSDSSGFKTAAEDFGQSDGESD
FT                   MYEHLQSKNSVSCTITPGHQVVYLAFCNKEIDYNSIPHLHIFITKSGSTSLELIKSVLV
FT                   SHFICLNPVRGHSLKTLRIVDSVRDTLYLKAFTASEEFTANGMCVIQPFVRRTVKTAYY
FT                   SGMYKVVGFPFFLQTDVETVAEFRKKYKLFGKMVIFDGKSYGDLELDWPMSKFNDECFL
FT                   LIERT"
FT   gene            <63959..>64555
FT                   /locus_tag="Eint_030500"
FT   mRNA            <63959..>64555
FT                   /locus_tag="Eint_030500"
FT                   /product="Rab GTPase interacting factor Golgi membrane
FT                   protein"
FT   CDS_pept        63959..64555
FT                   /codon_start=1
FT                   /gene_family="HOG000150354" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030500"
FT                   /product="Rab GTPase interacting factor Golgi membrane
FT                   protein"
FT                   /note="similar to ECU03_0590"
FT                   /db_xref="UniProtKB/TrEMBL:E0S659"
FT                   /protein_id="ADM11194.1"
FT                   /translation="MEFEDCGEPYSNRFDLKSAFLGELPGDEPLLKELGIDFNTIRKES
FT                   RLVFGVFQKKQVDFSFVKNADLSGPVVFVGLYTLGLILNYKIHFGYIYFISLLTALSMY
FT                   FLLNVLDTKHIGFLECCSILGYSFPPVVFFSFLNILLGGIGIGFKVFYGLAFALWSSYT
FT                   ASVVFCRYLSLTNKHVVVGYPLLLGYTGFVMVVLF"
FT   gene            <64670..>65047
FT                   /locus_tag="Eint_030510"
FT   mRNA            <64670..>65047
FT                   /locus_tag="Eint_030510"
FT                   /product="homeobox domain-containing protein"
FT   CDS_pept        64670..65047
FT                   /codon_start=1
FT                   /gene_family="HOG000112867" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030510"
FT                   /product="homeobox domain-containing protein"
FT                   /note="similar to ECU03_0600"
FT                   /db_xref="GOA:E0S660"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniProtKB/TrEMBL:E0S660"
FT                   /protein_id="ADM11195.1"
FT                   /translation="MRKNDFDVREMNAALGLLRLAREGKGEADEPDTRTRKTTFQMMVL
FT                   KEVFKIAPHPSTLTKTDLALMIKLPLKAVQIWFQNERSRKERGGRTGKRSRGGRSENID
FT                   PVKLFKVIMKVLEKNREGFGF"
FT   gene            complement(<65416..>65739)
FT                   /locus_tag="Eint_030520"
FT   mRNA            complement(<65416..>65739)
FT                   /locus_tag="Eint_030520"
FT                   /product="homeobox domain-containing protein"
FT   CDS_pept        complement(65416..65739)
FT                   /codon_start=1
FT                   /gene_family="HOG000112866" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030520"
FT                   /product="homeobox domain-containing protein"
FT                   /note="similar to ECU03_0610"
FT                   /db_xref="GOA:E0S661"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniProtKB/TrEMBL:E0S661"
FT                   /protein_id="ADM11196.1"
FT                   /translation="MEVQAALGMILLFHPERCLKKPGEKVRKSKFQKEVLKKIYQATPY
FT                   PTWENKIDIGILISLSPRAVDIWFQNKRHISKGKNQSIDENADSKAIDLWEIMSIVKNT
FT                   PRY"
FT   gene            <66423..>66707
FT                   /locus_tag="Eint_030530"
FT   mRNA            <66423..>66707
FT                   /locus_tag="Eint_030530"
FT                   /product="putative Ser/Thr protein kinase"
FT   CDS_pept        66423..66707
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030530"
FT                   /product="putative Ser/Thr protein kinase"
FT                   /note="similar to ECU03_0620"
FT                   /db_xref="GOA:E0S662"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniProtKB/TrEMBL:E0S662"
FT                   /protein_id="ADM11197.1"
FT                   /translation="MERKYVIEMSNQRTCLLTQVETSRYRISSFQPYLYRRRKKKTSVV
FT                   CKRFRVYGPKFLRELADMWSCGISLIVFLTGSYPWGKASGRTRNSLDLY"
FT   gene            <67345..>68517
FT                   /locus_tag="Eint_030540"
FT   mRNA            <67345..>68517
FT                   /locus_tag="Eint_030540"
FT                   /product="calmodulin-dependent protein kinase"
FT   CDS_pept        67345..68517
FT                   /codon_start=1
FT                   /gene_family="HOG000149509" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030540"
FT                   /product="calmodulin-dependent protein kinase"
FT                   /note="similar to ECU03_0630"
FT                   /db_xref="GOA:E0S663"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S663"
FT                   /protein_id="ADM11198.1"
FT                   /translation="MKNTKKNEWKGLSFGAWPIMQGYQRRLSRKIQNILFMSLVLLSFI
FT                   FLYKKYFFVCRAKEDQRMEKMCLDFINKKVDKCLQHKSRYDQNKEFAAIKTHLPLIPLK
FT                   MTRSNAVFLYTHKKPYVVIKRCIAPDAPGLAEDEMLKSLDHKNVVKFFKSFREKYVNLK
FT                   EEEETIIWIFMEHMDIKVSQDVVKGNENKIREITKGILHGLQYLHSMGIAHLDLKISNV
FT                   MGKETKDGIVYKIIDFGFARRLANVGDNAEIQIPSKSFGTYPYKPPETSQLNMHGIKGD
FT                   IWCLGAIVWFLSWRQTPFYFDDGRKNLEEWRMFIRGRIPISFKPNTSPALRNFVRKCMD
FT                   FDRFARPSASELLEHPFITGVPMKVTEEEINEMSEEFSSSSEYSDTRSED"
FT   gene            <68574..>68903
FT                   /locus_tag="Eint_030550"
FT   mRNA            <68574..>68903
FT                   /locus_tag="Eint_030550"
FT                   /product="hypothetical protein"
FT   CDS_pept        68574..68903
FT                   /codon_start=1
FT                   /gene_family="HOG000150353" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030550"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0640"
FT                   /db_xref="UniProtKB/TrEMBL:E0S664"
FT                   /protein_id="ADM11199.1"
FT                   /translation="MRIPLMEESEGLRYLMKLLPEYMRIGGERYILHRIGRIIGEDSWA
FT                   TAMFCRKCLWLYIPVVNSRMKCDDGILRVECYGCQEKHEFDKEKLGIVKNGLEVKEDRL
FT                   EDYFG"
FT   gene            <68956..>69366
FT                   /locus_tag="Eint_030560"
FT   mRNA            <68956..>69366
FT                   /locus_tag="Eint_030560"
FT                   /product="40S ribosomal protein S14"
FT   CDS_pept        68956..69366
FT                   /codon_start=1
FT                   /gene_family="HOG000111598" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030560"
FT                   /product="40S ribosomal protein S14"
FT                   /note="similar to ECU03_0650"
FT                   /db_xref="GOA:E0S665"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="UniProtKB/TrEMBL:E0S665"
FT                   /protein_id="ADM11200.1"
FT                   /translation="MTEQIEVESMELAAVAHIKATKNDTFVHITDMTGSETIAKITGGM
FT                   RVKAQRDEGSPYAAMLAAQDVAEKILGRGVKVLHFKLRGAGGVKPMALGPGAQTAIRTL
FT                   IRAGLKVGRIEDVTPVARDRVRKRGGHRGRRV"
FT   gene            <69465..>71195
FT                   /locus_tag="Eint_030570"
FT   mRNA            <69465..>71195
FT                   /locus_tag="Eint_030570"
FT                   /product="isopeptidase T"
FT   CDS_pept        69465..71195
FT                   /codon_start=1
FT                   /gene_family="HOG000149508" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030570"
FT                   /product="isopeptidase T"
FT                   /note="similar to ECU03_0660"
FT                   /db_xref="GOA:E0S666"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniProtKB/TrEMBL:E0S666"
FT                   /protein_id="ADM11201.1"
FT                   /translation="MELPDLSKFREKCCYCYEDIKTGISVCSCGLSFCKEHKDLHLGKA
FT                   KCQIVFEIKEIGNDLGIEIKNTMLGEAEIEELRRRMETLVRSEDEDERVIFRDEEVVCM
FT                   HECPEGPCSIDLGDAGNLSCKVCDVKTRLWVCFICGYVGCGRMQYGAEGNGHARAHYEE
FT                   TQHNVFVLVPSLIKESCEVFCYLCDSNIRFHYEIPGNITIDFGDEGKAGRKRVKKRIIC
FT                   NGIVEQEEKKLKAMEKGKNESIPSPYVGIVNSGNTCYISSVLQMIGYVVSKEDIDMEQH
FT                   FEICCDKNPLECFFCQLMRVLNRMKKARKEKNIDSISILDLIILIWRDMPMFSKFMQQD
FT                   SHEFLLFLLEKIREGEGLYLIPSITSFFEFEVGRKISCSGCMDKSTSYESAMMICTCLK
FT                   GDIRRSVEMFFSPDEWNCKCGGKKNVSRFVTIPPRYLIIQVGRYSYNNNKVEKIKSKIG
FT                   IKSVKLKDFMSKDEADESLAKKLSDDGYSLEDAKRALGIFCNDEGKARSFLERQSSVVS
FT                   PEDLKYRVVGCINHSGDNIKAGHYTWWVYEDEKCYKIDDTNVLGSNVEVLEDGYIFLFK
FT                   "
FT   gene            complement(<71249..>71968)
FT                   /locus_tag="Eint_030580"
FT   mRNA            complement(<71249..>71968)
FT                   /locus_tag="Eint_030580"
FT                   /product="ribonuclease HII"
FT   CDS_pept        complement(71249..71968)
FT                   /codon_start=1
FT                   /gene_family="HOG000100289" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030580"
FT                   /product="ribonuclease HII"
FT                   /note="similar to ECU03_0670"
FT                   /db_xref="GOA:E0S667"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="UniProtKB/TrEMBL:E0S667"
FT                   /protein_id="ADM11202.1"
FT                   /translation="MEGKNIFFSSLEEISEEVVVGIDEAGRGPVIGYMVYGALISSRTT
FT                   LENTGFRDSKVLTSGQRHDFFKMIKERGFGYVYHCTHPDYITEMMQVKSTSLNEISLIS
FT                   VLKILEEIKAKCKKVDTVYVDALGDCEKYKARLEEAYPYKFVIEEKADSKFQIVSGASI
FT                   VAKVQRDILISQFGSNLGSGYPSDPDTIKWLKRNANAVFGFPPGVRYSWATVKRILGER
FT                   RSKPLKGDLEGFYLNNT"
FT   gene            complement(<72013..>74739)
FT                   /locus_tag="Eint_030590"
FT   mRNA            complement(<72013..>74739)
FT                   /locus_tag="Eint_030590"
FT                   /product="6-phosphofructokinase"
FT   CDS_pept        complement(72013..74739)
FT                   /codon_start=1
FT                   /gene_family="HOG000149507" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030590"
FT                   /product="6-phosphofructokinase"
FT                   /note="similar to ECU03_0680"
FT                   /db_xref="GOA:E0S668"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:E0S668"
FT                   /protein_id="ADM11203.1"
FT                   /translation="MEAVIEELQLSGDGILQRHGEVYELLGLDVIYDRGTLKIYSTRKA
FT                   KITSTSPGIHIHTSYKALRRLTTRGLVNENGRGMPLEMMDMMGNKIVVTFSGQGKTNRI
FT                   AIVTSGGDAPGMNSAIKSITRTGIKWGASVYGVYNGYDGLINNNIRRLSWDTETHCSSQ
FT                   GGTVLLSARSQKFMGKEGRKEAVLNMVRKKINCVIVLGGDGSMKGAMVLRDEFKDHLRD
FT                   LIREGKISPRDLKRILNSKAESKDEEKEKVTTETSGVGYSDFYGAPECYKETPMVYHDL
FT                   NSSDDMLEDLQMDKCSCEEMDLDEIEKYVYDLKVVGIPATIDNDICGVPISLGEDTAIH
FT                   RVIEGIDHLMSTMKSHTRTFVIEVMGRKCGWIALMSALASSADYVLLPEAPTEWKKEMI
FT                   EALTTARRCGKAGTFVIVSEGAVEKDGTPIHASQAVEEIAKFGMDVRLLKLGHIQRGGP
FT                   TSAQDRIYGTLLGVKAVEISLGPTKDPVMISIFRDEIFEIELKEVIERNNLVRDFQEKK
FT                   LFEDVLKSRCNFFRLAYSYFRKSLMTGIRNIRDKGCDCSSREKIETECSCGPDCRGKYE
FT                   DRKPRIGVLQFGRRASGMNTVLNAVVQYSLVAGAEPYYIPNGFEGLVNNQLIRAKPYEF
FT                   FGDVNNGGSAIGVGGDLEVDIKLIQRKVVESGLDSLIIIGGSKALNTIKELKGVNIVLV
FT                   PASSYNNIPKIDISIGADTALNTIIKVSDVSKLNSFAYKNNVFVVEIGGENCGYLSLMG
FT                   GIAAGAFEAFIPERKYLIGHLSEVAQRLRVKFREKIRRGIVIFRNERTFRSIPTSSLCE
FT                   ILKTDSGDLFETNYSILGDVQQGLNPSPIDRINATILGIEAVDLCLRKCGVGVVGFSKD
FT                   KIEFTEISEVLKDFDHDLDRVKNPYWLKYSNICRSVE"
FT   gene            <74931..>75278
FT                   /locus_tag="Eint_030600"
FT   mRNA            <74931..>75278
FT                   /locus_tag="Eint_030600"
FT                   /product="hypothetical protein"
FT   CDS_pept        74931..75278
FT                   /codon_start=1
FT                   /gene_family="HOG000150352" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030600"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0690"
FT                   /db_xref="GOA:E0S669"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S669"
FT                   /protein_id="ADM11204.1"
FT                   /translation="MLSADGKENEIGKSLIEDASLFLWFVNAVNSGGCCREIKSEEDLS
FT                   LASKKKIHQKIKFKAYSMGAESIMYEKRNEMAFEEDRNGFICAHCDARYVYKRCLANHL
FT                   IKSHHINSNTL"
FT   gene            complement(<75394..>77898)
FT                   /locus_tag="Eint_030610"
FT   mRNA            complement(<75394..>77898)
FT                   /locus_tag="Eint_030610"
FT                   /product="exoribonuclease R"
FT   CDS_pept        complement(75394..77898)
FT                   /codon_start=1
FT                   /gene_family="HOG000191945" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030610"
FT                   /product="exoribonuclease R"
FT                   /note="similar to ECU03_0700"
FT                   /db_xref="GOA:E0S670"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E0S670"
FT                   /protein_id="ADM11205.1"
FT                   /translation="MWYGIVAERKISKRLKLIKRVREHYVRDDVPCGFECCGGMCKENK
FT                   RTSVFVIPDAAVMSKYRALLKSDYVAAIICQSALEELSRNDEKGLRDVAREKGYAVFCN
FT                   NFCKSTSGRGLEGVLEFYKDHLPQYKFIILTMDNIWEYGKYVSDDIQDLLSIVDEKEAT
FT                   EYEDYRENLDVQYGKKGLYRGMLEVSMYNCYSGFVVDGDVKILVIGKKNMNRAINGDEV
FT                   YVEEIDECDEDGILVDDEEGLKETRKRKEDKEMFGKVVGIYRRKCRAIVGTISPRTVHG
FT                   IGTQNVLVIPIDKRIPAVRIRTGQAEELMNKRLCVEIDGWEKTSNYPSGHYYRRLGTIG
FT                   DKDAEVEAILVANGITYYNSSWKDILGDSWESEERFGIERIYREIEEGSREDFRDLATV
FT                   SIDPPGCEDIDDALHCRLLPNGNWEIGVHIADVAYYVRKDSKMDKVARDRSTTVYLPER
FT                   RIDMLPPSLSTDLCSLVAGKDRAAFSVVWEMSNDAKIVRTHFSRSLIRSRRSFSYQEAY
FT                   DVIRGFSAAEEEILSSLATLLRMSKILRNGRLEKGSLDLSTRQLTFRGGKLEVKECLPT
FT                   NFLVEEFMILANISVASFIYHHHPDSSLLRKHPPPSVLDDNLGIDASSESVGNLLNKVE
FT                   GLKKDLMKRMLIRSMNQAVYVVSGETSNFHHYGLATPMYTHFTSPIRRYADIIVHRILG
FT                   HILQTAHPEEIHTSKLGIVTFLPRKNTEKETQSQKFADEDMCRNMNSRYRSAKKASWEC
FT                   GKVIIYTMLKDRESLVEGFITNIKANGVVVYVPEYNLEEVVVSEGHFQMFQKVQVKILR
FT                   DDERFFLRRRFTFEISNLDSQL"
FT   gene            complement(<77957..>78343)
FT                   /locus_tag="Eint_030620"
FT   mRNA            complement(<77957..>78343)
FT                   /locus_tag="Eint_030620"
FT                   /product="60S ribosomal protein L34"
FT   CDS_pept        complement(77957..78343)
FT                   /codon_start=1
FT                   /gene_family="HOG000216922" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030620"
FT                   /product="60S ribosomal protein L34"
FT                   /note="similar to ECU03_0710"
FT                   /db_xref="GOA:E0S671"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="UniProtKB/TrEMBL:E0S671"
FT                   /protein_id="ADM11206.1"
FT                   /translation="MRTVCETEEDKNFPLAKKMKKVLIHKGATYKTRSNRRIKIRTPSG
FT                   KLVNRRMKKHSKKHRCHECNTVLGSIARMRPAEFSRQKVSARRVNRAYGATICGRCVKE
FT                   KITGAFLADEERIVKEKTGLASSG"
FT   gene            <78703..>79590
FT                   /locus_tag="Eint_030630"
FT   mRNA            <78703..>79590
FT                   /locus_tag="Eint_030630"
FT                   /product="splicing factor CC1-like protein"
FT   CDS_pept        78703..79590
FT                   /codon_start=1
FT                   /gene_family="HOG000149506" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030630"
FT                   /product="splicing factor CC1-like protein"
FT                   /note="similar to ECU03_0730"
FT                   /db_xref="GOA:E0S672"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S672"
FT                   /protein_id="ADM11207.1"
FT                   /translation="MAKDRVSGVQIYLDSNDPKNFMKKTMEKVSKSDSESGSESSSEAS
FT                   VESSGSSRESMGSGEECTETESEIEEETSSGSAEESKRENPSLTVFIKGISYDLTEYDL
FT                   KSEMEKIGKVARVGIPMTNDYKRNKGFGYVEFCKEEDVKKALKLDGTVFLGREVIVNMA
FT                   HPRTNKEKHTIYISNLPFECDKKKLKKYFEEMGEVVGMSFPYDKENDRLKGYGFVDFGN
FT                   KEDYEKVLKKKLVFEDSSIYQRPAYKNGREDRKDFDRRGPKRNDSRWNGKRHGMDGQNR
FT                   NNNKKVKFNSDSEE"
FT   gene            <79654..>80175
FT                   /locus_tag="Eint_030640"
FT   mRNA            <79654..>80175
FT                   /locus_tag="Eint_030640"
FT                   /product="U1 small nuclear ribonucleoprotein A"
FT   CDS_pept        79654..80175
FT                   /codon_start=1
FT                   /gene_family="HOG000149505" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030640"
FT                   /product="U1 small nuclear ribonucleoprotein A"
FT                   /note="similar to ECU03_0750"
FT                   /db_xref="GOA:E0S673"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S673"
FT                   /protein_id="ADM11208.1"
FT                   /translation="MAEACSRRTLYIRNLNRRLPIREVKRRLGLFVSRLSRVSKIKMSN
FT                   KPGLLGQAFVHLDGEITNEILDSLNGRFFLGDVILACPAREDMCIGKRRTIVSTRSLLV
FT                   TGIPSGMTREELVDIFKGFEGLEAVRLIKVKSLAFVDFSSPQEASTAYSYFEDGQVKHI
FT                   LGDMKIMPSA"
FT   gene            complement(<80213..>80686)
FT                   /locus_tag="Eint_030650"
FT   mRNA            complement(<80213..>80686)
FT                   /locus_tag="Eint_030650"
FT                   /product="putative RNA-binding protein"
FT   CDS_pept        complement(80213..80686)
FT                   /codon_start=1
FT                   /gene_family="HOG000150351" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030650"
FT                   /product="putative RNA-binding protein"
FT                   /note="similar to ECU03_0760"
FT                   /db_xref="GOA:E0S674"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S674"
FT                   /protein_id="ADM11209.1"
FT                   /translation="METLEKYFGGEPGGYFYREKTFVGTDEEYLEAKKNSSTIFVSNVP
FT                   TNVREERIWELFLLCGAVKRVIMGLNRNTLRFCGFCFVEFYEVCSADMAVRYINGFRID
FT                   QVPLTIDKDYGFVEGRQYGRGVFGGRVKADKMYLEDKHQRDGVKRRRQGRFLR"
FT   gene            complement(<80793..>81479)
FT                   /locus_tag="Eint_030660"
FT   mRNA            complement(<80793..>81479)
FT                   /locus_tag="Eint_030660"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(80793..81479)
FT                   /codon_start=1
FT                   /gene_family="HOG000150350" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030660"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0770"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniProtKB/TrEMBL:E0S675"
FT                   /protein_id="ADM11210.1"
FT                   /translation="MTIVTLRSKDGEYTYTKEFESDNTILHVKQYLKSQMEGYCIESIE
FT                   NGIKIILNGKIVSDAVQLRTLGKERLQLVYDVSILKMGKMHSPDAERLFFEEVETNDIS
FT                   VKVAVSVKETGAKMMVDPEDLVVFNGNVYLVKDRKKILTLKSIVDLFGDIRISKEDFAK
FT                   FMVFFLLLYTGNGGIVFVLGCVFVLEILSRKLSLTHRNHFKSMDHLCRSFYMFFVSLFL
FT                   IDHAKF"
FT   gene            <81684..>85034
FT                   /locus_tag="Eint_030670"
FT   mRNA            <81684..>85034
FT                   /locus_tag="Eint_030670"
FT                   /product="hypothetical protein"
FT   CDS_pept        81684..85034
FT                   /codon_start=1
FT                   /gene_family="HOG000150349" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030670"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0780"
FT                   /db_xref="UniProtKB/TrEMBL:E0S676"
FT                   /protein_id="ADM11211.1"
FT                   /translation="MGVDLKRLSELFTVRFEKEYRTYGEYFGDIIHLSKDSGLEEMFCK
FT                   YEKNILNEEDILGYITSSSPSNLKHFSRIYEYEKGFCKRTAVLLLKKRYEEEEYDKNAI
FT                   FQCIRKLSHYLEFKFVKDICDDECLAFIIGEYARKHEFDESFLDEIANFLPSVFLGYTQ
FT                   LNGLLLDSFERSFEKVIRKSLEILWVVDCSNKRVARAISRSMEKKRIFEYLASNNLVGE
FT                   DRLGEMMSVVGSVNAQMFLSDGVFGRLEEERAVKYLDGVSVEDVIEIGILGCECRRLYK
FT                   ILPRVFEKRKESFMKDGRIVNVLLLMVYYNSKIRFGDTLGLLGPSLEREFLEYREKEIR
FT                   KIVVDVDKDSGEINEKEECSSDSLGFFSEGNEFRFVREGKAGKRDILEYLKEIWKEEGD
FT                   FIKNVRRKLGFGCFLGNPSKPTFDQLLELPNYYFVESLKRYRNEFLDLLLEFHEIVVPT
FT                   SRRRSLIGKKIISSGYKGLFIRYLIRRNKYFKVEVELSMWLKEMSPEYKIKYFCDYPMA
FT                   LIGRESQVLEGLGSNIYMLYPVVLELERRSVAQEVIDQIKKHMIGAGSFGKKKCEEASR
FT                   LEEVKKIKEEESTKGRESRKESVLEKKANEWEEQTKRTRMEGKEKEENIYDDKYPIEKI
FT                   DHVLFKKRIGFICNEINKRILNGNGLQRAGRVTSILVRDREMLERIQSILNGVNRFGKD
FT                   LTNFVRFLAFFLSYCRMEVDMLDTTLKTLKRYISEEEDDSVLYFVFMKIRLEQVEKLVV
FT                   EFKENSFGVIHKAMCDRIQGVKEGEARNMVEGCVTVSTNVVPGATKKKRGGGIGPDTVE
FT                   IWDYKGQTERIQKIVMAFLSSGDESMQYLGLEGLKALGQRVDVEKFLDSKSDRVVETAL
FT                   SMAIERGITCDVNEKLMKILYRRGRLDSLGKMCLRAVNIDALEKEDVDRIYEMFFIDPK
FT                   SYLEILPRILERGYELSEDIAVELTRLLGSSQCDEVLGNSMKALKNVEYTAEMAFEGIL
FT                   ALENAKFTPKMFLVEKIWRSPSNLSTRGFLRLCVCVCNEENYAVLKGLLQILKKGGVHA
FT                   DIVEKWKKNKSLDRLMARIYPLCLKDKIYYRDILDSMKKDAEEWKFINEFYRDELEAAR
FT                   LVDKHLSES"
FT   gene            complement(<85031..>85546)
FT                   /locus_tag="Eint_030680"
FT   mRNA            complement(<85031..>85546)
FT                   /locus_tag="Eint_030680"
FT                   /product="zinc finger domain-containing protein"
FT   CDS_pept        complement(85031..85546)
FT                   /codon_start=1
FT                   /gene_family="HOG000155749" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030680"
FT                   /product="zinc finger domain-containing protein"
FT                   /note="similar to ECU03_0790"
FT                   /db_xref="GOA:E0S677"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S677"
FT                   /protein_id="ADM11212.1"
FT                   /translation="MIFHCCFEGCGKSFSRKSKLNDHFNSHTKNRPYKCDMCEKSYMKN
FT                   GHLSVHKKKHFPPELKCERCGYMCHTKDRLQRHQKTCLKYRCTICGKEYKKKSWFDVHT
FT                   ESHHVKVFNGRRKKHICEYCKFEFSKKGNLLAHIRSSHLLIKPFKCSCGKEYAYNASLD
FT                   KHRKRCTF"
FT   gene            complement(<85587..>85877)
FT                   /locus_tag="Eint_030690"
FT   mRNA            complement(<85587..>85877)
FT                   /locus_tag="Eint_030690"
FT                   /product="ubiquitin-like protein"
FT   CDS_pept        complement(85587..85877)
FT                   /codon_start=1
FT                   /gene_family="HOG000184686" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030690"
FT                   /product="ubiquitin-like protein"
FT                   /note="similar to ECU03_0800"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015221"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E0S678"
FT                   /protein_id="ADM11213.1"
FT                   /translation="MRIGFNGASVVELNNKEIELSKEEIENSSISTVGDALKYLFSRYG
FT                   ETRDSYFDNCGELVNGTICIINKMDWEITGREKSPVKYGDHIVLISTIHGG"
FT   gene            complement(<85920..>86303)
FT                   /locus_tag="Eint_030700"
FT   mRNA            complement(<85920..>86303)
FT                   /locus_tag="Eint_030700"
FT                   /product="ER-Golgi tethering complex TRAPP subunit protein"
FT   CDS_pept        complement(85920..86303)
FT                   /codon_start=1
FT                   /gene_family="HOG000150348" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030700"
FT                   /product="ER-Golgi tethering complex TRAPP subunit protein"
FT                   /note="similar to ECU03_0810"
FT                   /db_xref="GOA:E0S679"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:E0S679"
FT                   /protein_id="ADM11214.1"
FT                   /translation="MGELLVIISEKNDIVYQRMYGRTSNEEYYRLIILIYGSIDTLGWK
FT                   TLSTNSNYFDCLERHGNLRISVYMMPSGYKSLFIHSKRNPRPFLERIHCVFAAALISSS
FT                   LEEGVFKSQSLDDKFDEIHKACF"
FT   gene            <86466..>87785
FT                   /locus_tag="Eint_030710"
FT   mRNA            <86466..>87785
FT                   /locus_tag="Eint_030710"
FT                   /product="beta tubulin"
FT   CDS_pept        86466..87785
FT                   /codon_start=1
FT                   /gene_family="HOG000165710" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030710"
FT                   /product="beta tubulin"
FT                   /note="similar to ECU03_0820i"
FT                   /db_xref="GOA:E0S680"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002453"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniProtKB/TrEMBL:E0S680"
FT                   /protein_id="ADM11215.1"
FT                   /translation="MREIIHLQTGQCGNQVGCKFWETISGEHGIDQSGRYVGTSDNQLE
FT                   RVNVYYNEASSKKYVPRAVLIDLEPGTMDAVRQGPFGELFRPDNFVFGQSGAGNNWAKG
FT                   HYTEGAELIDSVMDVVRKEAESSDCLQGFQITHSLGGGTGAGMGTLLLSKIREDFPDRM
FT                   ICTFSVVPSPKVSDTVVEPYNATLSIHQLVENADETFCIDNEALYDICFRTLKLNNPGY
FT                   GDLNHLVSLVMSGVTTCLRFPGQLNADLRKLAVNMIPFPRLHFFVVGFAPLTAVGTQKF
FT                   KTYSVSELTQQMFDSKNMMTACDPKKGRYLTVAAMFRGKISMKDVDEQMSMVQSKNSSL
FT                   FVEWIPSNVKTAVCDIAPTGLEMSATFVGNTTSIQELFKRISDQFTVMFRRKAFLHWYT
FT                   GEGMDEMEFSEAESNMNDLLSEYQQYQDATVEDAEEFLVN"
FT   gene            <87932..>88558
FT                   /locus_tag="Eint_030720"
FT   mRNA            <87932..>88558
FT                   /locus_tag="Eint_030720"
FT                   /product="hypothetical protein"
FT   CDS_pept        87932..88558
FT                   /codon_start=1
FT                   /gene_family="HOG000150346" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030720"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0830"
FT                   /db_xref="UniProtKB/TrEMBL:E0S681"
FT                   /protein_id="ADM11216.1"
FT                   /translation="MAYLLEKANGSRCVLEAIKVEPFTQKQFADMIKEAHVRSQDYYLA
FT                   RVQCKNISEDGKNVYYCYDAKQLCKYIFEMVISTEGRKIRIKNFKDPINQEQIHEISFF
FT                   KLRYDSDTPLKAEYVGNQANFLENNCFRSKIFYQENALDALSVNFQFGPQKKKIPIINK
FT                   KKIFTVLMMVVVILAIGTLVSMVAEKGSQKASRPLKLSINKGKSI"
FT   gene            complement(<88577..>88837)
FT                   /locus_tag="Eint_030730"
FT   mRNA            complement(<88577..>88837)
FT                   /locus_tag="Eint_030730"
FT                   /product="small nuclear D3-like ribonucleoprotein"
FT   CDS_pept        complement(88577..88837)
FT                   /codon_start=1
FT                   /gene_family="HOG000182712" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030730"
FT                   /product="small nuclear D3-like ribonucleoprotein"
FT                   /note="similar to ECU03_0840"
FT                   /db_xref="GOA:E0S682"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S682"
FT                   /protein_id="ADM11217.1"
FT                   /translation="MGVTIPLKLLHEAQGFVVTVETNSGDMYRGQMKEVDDYMNIILTD
FT                   AVVTSNSSCIPRKEVVIRGSSIRFFVLPPALKFAPFFGRKT"
FT   gene            complement(<88879..>90474)
FT                   /locus_tag="Eint_030740"
FT   mRNA            complement(<88879..>90474)
FT                   /locus_tag="Eint_030740"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(88879..90474)
FT                   /codon_start=1
FT                   /gene_family="HOG000150345" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030740"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0850"
FT                   /db_xref="UniProtKB/TrEMBL:E0S683"
FT                   /protein_id="ADM11218.1"
FT                   /translation="MDSEDGVVSDDVMRVSQKIKESGSTDSLEKLLIEHKYNPGYVEKF
FT                   YNAFSSRGNDWESDVYEVFGNHFLRNRLYGGMAGVLMPWVESVKKRYSVEECKGVFEYF
FT                   NKMYDEMPASTKEGMYGTFLEVLLGLGWTLSKGGALYESYAVCEKVCEIVTSMGKFSSS
FT                   NTAILYMELLGSFFLESGMLFSYVNVINILTSLEPRCIQKQCSIEDFRTLCSYALLKNE
FT                   GDKQKKLFCKSRLLNLPEILSNVEKRCSGIDVSGNTLIRRKFDFEMWGKYSECVGKRVL
FT                   VEENMDLIAFMKKNDFRFSIDGTYILIEQYEYKTVERKVFEIIEEYKERTRTASKPVIE
FT                   RKRISEEKKIVKKEEPSRPKKTVKFRDRFSSAYKKVKMYSRYYMKNAKGIEDAWYEKRN
FT                   KEAKEAFEKKENKLKTKREELRAYLDLVEEARKGLSQRIEELGRKIEVPMPKPTRSAHW
FT                   RSEGEEAKVYRPPNPHSSGTQKAYVPPLDAFRHIPSENPGGKSDSNPFRRNRNLRNSSW
FT                   YVDNKEKEQEKKNN"
FT   gene            complement(<90533..>90889)
FT                   /locus_tag="Eint_030750"
FT   mRNA            complement(<90533..>90889)
FT                   /locus_tag="Eint_030750"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(90533..90889)
FT                   /codon_start=1
FT                   /gene_family="HOG000150344" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030750"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0860"
FT                   /db_xref="UniProtKB/TrEMBL:E0S684"
FT                   /protein_id="ADM11219.1"
FT                   /translation="MSIGDYALVIFETTGNSFAIGCSMAFASSMFKQREEQPHSRLSLR
FT                   RGGELAKHAMIYSSLYYGLRAIRATGWIRHLAPPFIASFTCGIRNGRGFGVRSGLNGVA
FT                   SSLMQEVVNKMKWS"
FT   gene            <90932..>91624
FT                   /locus_tag="Eint_030760"
FT   mRNA            <90932..>91624
FT                   /locus_tag="Eint_030760"
FT                   /product="hypothetical protein"
FT   CDS_pept        90932..91624
FT                   /codon_start=1
FT                   /gene_family="HOG000150343" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030760"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0870"
FT                   /db_xref="UniProtKB/TrEMBL:E0S685"
FT                   /protein_id="ADM11220.1"
FT                   /translation="MNRTTEYLKHIDKKTQAPPTSKSESFYDTINIKIKRIEKKLEKSL
FT                   SYREILKVEEEFNTLSLEVQQTLDTISVEGSSDLILHFEGVKKIILMRLQRVEKKLRNL
FT                   KDSKIGMSIDLEPERPHTFKNVEEVQMMEEENKRLVEGYNIEGYRLTRKRLLEVEALQD
FT                   TIFQHLTLQDERIDSIVDLTSRAGKFVSSSNEALGKTKNSGKFARRFLFILLLCLSFVL
FT                   LFLHYYYK"
FT   gene            complement(<91655..>92443)
FT                   /locus_tag="Eint_030770"
FT   mRNA            complement(<91655..>92443)
FT                   /locus_tag="Eint_030770"
FT                   /product="putative bis (5'-nucleosyl) tetraphosphatase"
FT   CDS_pept        complement(91655..92443)
FT                   /codon_start=1
FT                   /gene_family="HOG000149503" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030770"
FT                   /product="putative bis (5'-nucleosyl) tetraphosphatase"
FT                   /note="similar to ECU03_0880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S686"
FT                   /protein_id="ADM11221.1"
FT                   /translation="MKESEVIGKIEGVFGIEDPAILPERVKSVIKEILEGGVFPVEHPF
FT                   YVDFINLSFDVLYPGAQEPSELLRRSGFTQDQLEKTGLKRLFSVACAESLKDDKNQSEL
FT                   GEDLKPKRRKKVSWGANLVQIKEIEKTVMETDGSYPTSSSRNGGSGLERNTFKWIIPEK
FT                   LDHGYSEIKSPGRLEQERREANSIRMSNTEEHRRFSPTQCTDVGEDNETITVPVINFAK
FT                   NKMPNFDFRKIVEDRFSNMARIHEILEDPSVVDILLGKEE"
FT   gene            <92442..>93842
FT                   /locus_tag="Eint_030780"
FT   mRNA            <92442..>93842
FT                   /locus_tag="Eint_030780"
FT                   /product="haspin Ser/Thr kinase"
FT   CDS_pept        92442..93842
FT                   /codon_start=1
FT                   /gene_family="HOG000150342" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030780"
FT                   /product="haspin Ser/Thr kinase"
FT                   /note="similar to ECU03_0890"
FT                   /db_xref="GOA:E0S687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S687"
FT                   /protein_id="ADM11222.1"
FT                   /translation="MEGPFRTRFRDCLENKQPCSHMKKFGRKRRSICNTTYEDVRKTFD
FT                   DLKRKIADSGRLSSSGFSPATSPRSVSWRKDYPCDLISSSGDDLEDWSSFISSHNSELG
FT                   DRSGPRTPSPGSEAQESIAVNHGILSSSETYDESLGFSSFLEEESKKASRIQNITFRRK
FT                   KGENGNLLELEKCNIDALQEENLEVAALKKISFDRMPKNVRKIGEATFSEVFSDGLKVY
FT                   KIVPLGDTDDETSLESFLKESAIFKTISSEDGVCRLKDVFLVEGKYPEEYLKAWDDYGE
FT                   EENERPSKYSDSQKYGVIVMEDGGESLESTKFQGAEEMDRFIRRVIEILANLEEKYEFE
FT                   HRDLHWGNILIKEDRISLIDFSLSRLKDGDSVIFSNLNDKQWLFEGDEAFDIQFKVYKD
FT                   MLKLCSGCWSRFTPQSNALWIRYLVEKTFGKGRFKGKKDLVSQYLSIIDSSTSARDIDA
FT                   KLKRKEVQ"
FT   gene            complement(<93853..>95421)
FT                   /locus_tag="Eint_030790"
FT   mRNA            complement(<93853..>95421)
FT                   /locus_tag="Eint_030790"
FT                   /product="synaptic transmission and general secretion
FT                   Sec1-like protein"
FT   CDS_pept        complement(93853..95421)
FT                   /codon_start=1
FT                   /gene_family="HOG000149502" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030790"
FT                   /product="synaptic transmission and general secretion
FT                   Sec1-like protein"
FT                   /note="similar to ECU03_0900"
FT                   /db_xref="GOA:E0S688"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniProtKB/TrEMBL:E0S688"
FT                   /protein_id="ADM11223.1"
FT                   /translation="MLRELQKQKIKAFLGMPNSPWKVLVLDARAQHIIGPLMKVNELRE
FT                   CGVTTHFLVSQGRHPISNTPAVYFVEKADGIAEDILKELYSEYYLNFTTSVGRGELEDL
FT                   GLRLSERGLGLRVRSVFDQFLDFTALQDDLFTLEMKDSFAGIENTDMWRGMVMSLMSVF
FT                   VTLGEVPFMATLDDETCIQIAKMLEAKIKNTGVIKKTGKRPLLILMNRNYDVSTPVQHV
FT                   WSYSALMNDLFKFESNKITLKSGKVFDLDPEDELWRGNSNEYFPVVVERVEKELLEYRK
FT                   EMALRSIDEKTDKKVIQEALDKAPELAKRNESVNAHISICSEMVEIIKKRAIDDFYKVE
FT                   KGRYTDQELMELSEKGDDEDILRLAILLLNTKDFDLIDPLLQKRKVKSKVIEFFRKHKS
FT                   ARPEKTGAFYSQMVTSLMGNVKKLLPVKEQTPISSLVESIYSDIKSQIYSGFKLIDSTG
FT                   SKNIYASEISRIVVFSIGGGTYTELKTLKLLEERIGVPIMYGSTEILNAGEFLRQVKSR
FT                   MSLDQ"
FT   gene            <95583..>96497
FT                   /locus_tag="Eint_030800"
FT   mRNA            <95583..>96497
FT                   /locus_tag="Eint_030800"
FT                   /product="casein kinase 1-like protein"
FT                   /note="involved in DNA repair"
FT   CDS_pept        95583..96497
FT                   /codon_start=1
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030800"
FT                   /product="casein kinase 1-like protein"
FT                   /note="involved in DNA repair; similar to ECU03_0910"
FT                   /db_xref="GOA:E0S689"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S689"
FT                   /protein_id="ADM11224.1"
FT                   /translation="MTTEIRNIKLVQKIASGAFGEIFIGQNTVTNQTVAVKLEKKAHYG
FT                   QLKHEYGVYKALGSIRTPKIYEYGKILYENVYVNGMVMELMGKSLEQLFVACNRHFSLK
FT                   TVLMIGEKMIDDVEYLHHKNYVHRDIKPDNFVFDVRGDKLYLIDYGLAKEFRNPMTFKH
FT                   REMRTDKSLTGTARYASLRTHQGYEQSRRDDLESIGFCLVYFLKGRLPWQGLKAKTKQE
FT                   KYDKIRESKEGISLYELCMGLPKEIHSFCFYVRNLGYEDMPNYAYLRTLLSDALRQRGL
FT                   RNDGVFDWVARTPSDSLADLEIL"
FT   gene            <96566..>96889
FT                   /locus_tag="Eint_030810"
FT   mRNA            <96566..>96889
FT                   /locus_tag="Eint_030810"
FT                   /product="tRNA-intron endonuclease"
FT   CDS_pept        96566..96889
FT                   /codon_start=1
FT                   /gene_family="HOG000149501" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030810"
FT                   /product="tRNA-intron endonuclease"
FT                   /note="similar to ECU03_0920"
FT                   /db_xref="GOA:E0S690"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E0S690"
FT                   /protein_id="ADM11225.1"
FT                   /translation="METHREKRETLKRMFQEEGFVVGDGLKYGVDLLLYTDSPSKVHSK
FT                   YGVLIDRKHSLLDIVGVQRTCTSVNKILIVVFFDGAEVRMVSVERMELGGGGHEFSADE
FT                   LDV"
FT   gene            <96933..>99905
FT                   /locus_tag="Eint_030820"
FT   mRNA            <96933..>99905
FT                   /locus_tag="Eint_030820"
FT                   /product="ubiquitin-activating enzyme E1"
FT   CDS_pept        96933..99905
FT                   /codon_start=1
FT                   /gene_family="HOG000167329" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030820"
FT                   /product="ubiquitin-activating enzyme E1"
FT                   /note="similar to ECU03_0930"
FT                   /db_xref="GOA:E0S691"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniProtKB/TrEMBL:E0S691"
FT                   /protein_id="ADM11226.1"
FT                   /translation="MKNNEEVEIDESLYSRQLYVVGKDAMKKMMNSRVLVMGLDGLGQE
FT                   VAKNICLAGVSKVTLFDDRIVEEEDLCTGFYLRREDIGKARDASVVEKFRSMNEYVDVS
FT                   VASEVNNFEGYDVVVVCNEGYGEQIKLNEMARKDKCMFVGCQVRGLFSQVFCDFGAEFI
FT                   CVDRTGEIPMSGMINDISEDGVMTVVDGQRHNLEDYDIIKITQCEEYEGKYFRVKVISP
FT                   TQVMLQGVDGVRMFEEEAEFKAERFKSVYGGDFEQQKKPSMISFKPLGRTIDEPRILGF
FT                   NYEVEERNLVIHKCFVALGEYMKQSKQTPSGEEFLSFFVRKYKSHFEFEALIRSFGRQC
FT                   GGTLMPMCSVVGGFVAQEILKAVGSRFTPLHQFFYFDAMDVVPGDPKDDGKDYGRYGPM
FT                   VRCLGKECVEKLFNLHVFMVGAGAIGCEHLKNMVMCGIGSRGRVSVTDMDAIEQSNLNR
FT                   QFLFRSGDVSSMKAEIAVGKAIELNEDFLKIPLERGEEKLEGKDVSEMTNGMSGSGLPY
FT                   SNLVYYNLKVGKETESVFSDRFFQSVDVVATALDNVDARIYVDGRCVVNRKFMVDAGTS
FT                   GTKGNVQVVVPFHTESYGSSQDPPEKSIPLCTIKNFPYAIEHTIEWARSEFEFKFHDEI
FT                   LLIKEYLGREKKNGGEGKEEASNETMEDIVEKTPRSAKECIRNGILLFVKLFHTSIKNL
FT                   ITAFPPDSKTKEGQPFWMPPKRSPVTISFDVNNSLHVLFVQSTANIFSFNFGIGEHISR
FT                   EMVVDFVKNEILVEEFSSAVDNICVEESPRPPVDPSAITPCTFEKDDDSNFHVDFLYAA
FT                   ANLRAMNYKIKQADRLTVKGIAGRIIPAIATTTAVVSGLAILEMIKYALGVEHTKHKNS
FT                   FLNLALPFFASTDPVEPMKQLYKIENKKYTFTLWNRLEYKDSKLGTILKAFEIQFKKKI
FT                   SMVTAENALIYWDFDSKYADNLEKTVGELVGRKPDELFVMLDVITDDEEGEFPRIVVVF
FT                   E"
FT   gene            complement(<100011..>100598)
FT                   /locus_tag="Eint_030830"
FT   mRNA            complement(<100011..>100598)
FT                   /locus_tag="Eint_030830"
FT                   /product="putative transcriptional G2/M transition
FT                   repressor"
FT   CDS_pept        complement(100011..100598)
FT                   /codon_start=1
FT                   /gene_family="HOG000155750" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030830"
FT                   /product="putative transcriptional G2/M transition
FT                   repressor"
FT                   /note="similar to ECU03_0940"
FT                   /db_xref="GOA:E0S692"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S692"
FT                   /protein_id="ADM11227.1"
FT                   /translation="MRMNDSSRLKKLYQIEEKRFEERVKRYKDIGYMMDMHQFYLEDVL
FT                   LKREEILYKYALSTQSTEELWEEDTLGFDYEFIHKSVRDREWRKGVSGNGLIDVRGISG
FT                   PKSPCREERAGSSSSRAQKAKTRVYACEIEGCNKKYTSSFGLKYHMKEGHSEEKMNIFK
FT                   PYVCPFGGCDKKYKNNNGLKYHIKHYHDDQAA"
FT   gene            complement(<100817..>101536)
FT                   /locus_tag="Eint_030840"
FT   mRNA            complement(<100817..>101536)
FT                   /locus_tag="Eint_030840"
FT                   /product="60S ribosomal protein L7"
FT   CDS_pept        complement(100817..101536)
FT                   /codon_start=1
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030840"
FT                   /product="60S ribosomal protein L7"
FT                   /note="similar to ECU03_0950"
FT                   /db_xref="GOA:E0S693"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniProtKB/TrEMBL:E0S693"
FT                   /protein_id="ADM11228.1"
FT                   /translation="MEVAMREAPQSSIRKKEYQAKMAGIKTRQEKEFMERKKENAKYAE
FT                   ATTEKLLDKYYQQEREILEKKASIQEGFYVPKEAEFFVVILIRSKLRCPPKVKKVLQLF
FT                   RLKKTNTCMFVKNNKSTKRMLHIIKDYVAFGTIDMELLRKLMYTRGTGRNGNARVKLTN
FT                   EFIEDMFDGKIKCIEELVYHIYNGTEMFRDVNNFLYPFHLSPPRGGFKGKKSRNFNDGG
FT                   SVGNHQDLLGNLLKRMI"
FT   gene            complement(<101616..>103010)
FT                   /locus_tag="Eint_030850"
FT   mRNA            complement(<101616..>103010)
FT                   /locus_tag="Eint_030850"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(101616..103010)
FT                   /codon_start=1
FT                   /gene_family="HOG000150341" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030850"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0960"
FT                   /db_xref="UniProtKB/TrEMBL:E0S694"
FT                   /protein_id="ADM11229.1"
FT                   /translation="MKQLGFLKRLVSGQRDLEKTFVEKLLAGDIQDSIELGRMLFPRNP
FT                   MFLMTSLLLDFLGSPEDEAKKNLLLQSLKNSTIKSNLIWMLYKRGLLIKEMDHYVQRIV
FT                   FKDFLYYLTLKEAYIHGHPKLLGKETDLECMAFLLDHLDDWDLYQHALNNNIELPRRES
FT                   LNYEYYLLHRFKEKDKAIELLRSRICFKEIEFISGMVGLENHPDGTIDCLIQLARKGFD
FT                   EEVLRRAYEIYTKNKSVLNTKMIIAVLISSRKASYLGLALYLSFKHRKDFPENYEIFLI
FT                   FVFLCRYFCFYPHVLKCLDLMNVRNAQVPNLSFIWSDILFAKGIEDNWKRKEAIDNIQE
FT                   CVNDLNKSIKYFISVGNLAHVVDAIDLARSLKESVILLELKERKIIGTNASNSFHSLLG
FT                   TRCSYLFEKMTVEKIPKGKCMFLTDFYVSEGCSLEDVKNNGLWNVEEDFIIFFREMEEY
FT                   WKTINK"
FT   gene            <103188..>104492
FT                   /locus_tag="Eint_030860"
FT   mRNA            <103188..>104492
FT                   /locus_tag="Eint_030860"
FT                   /product="hypothetical protein"
FT   CDS_pept        103188..104492
FT                   /codon_start=1
FT                   /gene_family="HOG000150340" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030860"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_0970"
FT                   /db_xref="UniProtKB/TrEMBL:E0S695"
FT                   /protein_id="ADM11230.1"
FT                   /translation="MGEAGNGGLLSSAEARKKRRRLIEHIASEMRLIRREIERPRAMRD
FT                   APGFLYDFEKQIPFRHQEIRCASIPAKKADSKSGDELGKIRMAAEYAAESGVLMLIDVL
FT                   KQSKKIVFSKDWEIGYRENNVINILRQIEKKRRKGDLLQNPREHRIERADVEKTWKMMV
FT                   EEEARRKAQLDSIVHEISLAKRDRVIHVNTFLSSFIGTLNERTTDLEGRGISDGEGEGD
FT                   GVIYSRRRLSKMFIGGEVSYESVVLPTVGDDNPPPIFGRRLYIPSEKIESVTPRTQISE
FT                   RYKKYLANFSKLNSAQSGRSNFSMPQGSVASHPSSQHIFKKVSMEYLRCKSARDIVSHK
FT                   YRNVVIDRTVDLPKRPEGRYPKIHLQDGLGGDLCSSGSDDANVGYTFLIEAALGKVPSS
FT                   GQKGELEPTMGSENLPSGSNGTTGDEIENGRDKET"
FT   gene            <104757..>106457
FT                   /locus_tag="Eint_030870"
FT   mRNA            <104757..>106457
FT                   /locus_tag="Eint_030870"
FT                   /product="Ser/Thr protein kinase Kin1-like protein"
FT   CDS_pept        104757..106457
FT                   /codon_start=1
FT                   /gene_family="HOG000150339" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030870"
FT                   /product="Ser/Thr protein kinase Kin1-like protein"
FT                   /note="similar to ECU03_0980"
FT                   /db_xref="GOA:E0S696"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020673"
FT                   /db_xref="UniProtKB/TrEMBL:E0S696"
FT                   /protein_id="ADM11231.1"
FT                   /translation="MKYKEETPSYMYSEIEGTEEEIISLMDESEEINPSQEREMRGMIG
FT                   DFEYIENKWIGNYRFIRQLGTGSSSKVVLGCDPQSGEKVAIKIIPKRMNGTETSEVEMR
FT                   CDQRIFREVIISSVVNHPHIVRLKNFLYSPTHYFLIFEYVKGRQLYDIIISNGPLKEKE
FT                   GQRYFRQLLSAVDYIHKNSIVHRDLKIENILIDDNDNVKLIDFGLSNFYDNKTLLNTFC
FT                   GSLYFAAPELLQGQRYCGPEIDIWSLGVVLYATLCGCVPFDDENVQGLQEKIKDGDFKF
FT                   CKTISREAQELIRGMIVAQPSSRMGLDQVIGSEWVNGDQKGRINSYTAKRYPIMKINER
FT                   YIELLSRAIRFQFPNIEREIRRFHRICKEDMGTLEQIYWSRRPVVSLYYLVSENLGEDN
FT                   ENRIYEEEDETELPQGQPEAIHDFVRFIFSGERTCTRKHVKKEVLLESASQDTLVSLKG
FT                   KDNGLPRIRQTYLKGFFRGIRVKHIGSHNALKKILLDIFNANSIIYEVTDKSYFCSAYY
FT                   EDLECLFKVSMYFNVLLNEYYLTVTPLNSEKKLFKNVYEWISSGLRNRT"
FT   gene            <106770..>108488
FT                   /locus_tag="Eint_030880"
FT   mRNA            <106770..>108488
FT                   /locus_tag="Eint_030880"
FT                   /product="hypothetical SCP-like extracellular protein
FT                   domain-containing protein"
FT   CDS_pept        106770..108488
FT                   /codon_start=1
FT                   /gene_family="HOG000150338" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030880"
FT                   /product="hypothetical SCP-like extracellular protein
FT                   domain-containing protein"
FT                   /note="similar to ECU03_0990"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="UniProtKB/TrEMBL:E0S697"
FT                   /protein_id="ADM11232.1"
FT                   /translation="MTPIWLFLGCALCSLESDMLRYTNKFRKEHNMEELYNLPSLQKAA
FT                   DLQVLHMCKKSKLTHDGPSGEGFNLAGRLKKFDFVGLNIGENIAKQENDDYKEVVKLWM
FT                   KSEEHRNNILGDYVYSGVSTCIGKDGNRYWAQVFGKDISNTKIAKMRNEGKPLICLECN
FT                   MKDEDKSDRERKTHEEGEDLGVGDYIMVVPPEYGKEPEKREGSFGGVYEDARNENVGSI
FT                   ETQPDVESPSRGGKRIPEISLGRKRYPGQNIVRRPKYSSSHERNTRKEERELLSLGDYL
FT                   IPPQSESTEHPKTSTSTSESLYSTTTQKTVSTVTPSTSIRTSTIPIFTLVFKDSGNSTV
FT                   VPALQSLIDAIKGTSSQEKSSSSKTVFSVGSTLYSTSGISTFSSSIQSPLSSTTQTSSS
FT                   SLSSKEAISTVTVTSTARESVTVYLPKYQITTTTTTVPSERKDSKAPQNRDGSFNQGGL
FT                   RIESPKHLEFIGGAGSGGSISPVVKLDDRHNAGQNEKENDSGNEGGCKEGYNNDGSCIL
FT                   SKSLDDLKLKDTLENLVRKGKIHLHILSDEDCGDKEECYESKNRVDIGIPFSYKL"
FT   gene            complement(<108553..>110199)
FT                   /locus_tag="Eint_030890"
FT   mRNA            complement(<108553..>110199)
FT                   /locus_tag="Eint_030890"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(108553..110199)
FT                   /codon_start=1
FT                   /gene_family="HOG000150337" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030890"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1000"
FT                   /db_xref="GOA:E0S698"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:E0S698"
FT                   /protein_id="ADM11233.1"
FT                   /translation="MRTEKIESIQQVEESDFFVEKKPSGKRHVDDPSPPSSVWILIYLG
FT                   GSIISGILAYICHYSFILSKIEPNGKAQPPLATEKLLLCLLIGIMIWFMLELILTYFSI
FT                   TLKKIDEKQRFLQSTLIRNGWLISLVLTLLILSFVMGSYNHGTEIIDGESARTGEEGNA
FT                   ELPKEETHPGESGSSSARLVETKTPFIDKLSRLLLASSMFLGIILAKTILMERINYKML
FT                   FENYEDRIQKNYEDMKMLEELNRITGKKMESDPDVESWGSLVFKTVSPEKDTVDIQTLE
FT                   YFFGTDSARKIFERFDIYGDGRVTRSSFVLVYQDILNEDKRITMGMAQKVTIVEKLDIV
FT                   LSCILIPFGISATIPIVESEVNFVNFIPIQFGTLLSLNAIFASILTEMFRSLVFIFLVK
FT                   TFDVGDKILIDGHLHKVYDMGLLYTSFVVDKKVTVIPNAKIMDKTIVNLRKARTSLKQF
FT                   KFTFLNSLEFKDKMAELNSAIEKEVASDPNVYTGKFSVYGYDLKNNSSIGINIDVVFWI
FT                   QNQDIKTLKAQEDAFLIVLYGFIRDLGLVLE"
FT   gene            complement(<110317..>111096)
FT                   /locus_tag="Eint_030900"
FT   mRNA            complement(<110317..>111096)
FT                   /locus_tag="Eint_030900"
FT                   /product="14-3-3 protein 1-like protein"
FT   CDS_pept        complement(110317..111096)
FT                   /codon_start=1
FT                   /gene_family="HOG000240379" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030900"
FT                   /product="14-3-3 protein 1-like protein"
FT                   /note="similar to ECU03_1010"
FT                   /db_xref="GOA:E0S699"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="UniProtKB/TrEMBL:E0S699"
FT                   /protein_id="ADM11234.1"
FT                   /translation="MVSKQYEEALQKANLSDMAERYDDMAKEMKQAVVLAHEDKHVLNV
FT                   MARNLFSVAYKNLVSSRRSSWRMLCSERQKLEGKDQNVVYVIDEKIKVVEEELLKFCDE
FT                   VLDIITTYILSLEEARKNVEYFIFFLKMKGDYYRYKAEVITGAEHKEVSKHAAESYKEA
FT                   TEKARTLTPTNPIKLGLALNYSVFHYEILNDSEKACSIAKNAFDEAIKELDTLSEESYR
FT                   DSTLIMQLLRDNLTLWASREEGNVMGDEGKGDHPDEN"
FT   gene            <111189..>112208
FT                   /locus_tag="Eint_030910"
FT   mRNA            <111189..>112208
FT                   /locus_tag="Eint_030910"
FT                   /product="hypothetical protein"
FT   CDS_pept        111189..112208
FT                   /codon_start=1
FT                   /gene_family="HOG000150335" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030910"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1020"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A0"
FT                   /protein_id="ADM11235.1"
FT                   /translation="MDWYLKKYPDAKILADRLSMLAQTDGEDMSKYLDSENLSLADCIY
FT                   TERLYRSRDVKRTLRRVAAKEGSRIEKIVYEMLCKRKIVFDDYLLKLSFIKRFGRFKRF
FT                   FIDGKEPEYRMEMMVHKLLYLGENVVEEVEKEIVRVPGDKAWVYMGFLGSSVGRDVIME
FT                   VMSRVSIEFKPFVGSFLQKEDYYNKMCSVILKSPSEERGAVILSMGVLDKAQFYRSLLH
FT                   VWFSESGGKRRFNDLIEIMREVKVDRRMKTEIIDGYLNGLIYQRRVGEFMKLFKLAKRM
FT                   KICRDEHKLFEKLYNAVRKYKREGKLDLRRFLDGCKERKKKDLVSPYSWESIHEMYRE"
FT   gene            <112271..>113314
FT                   /locus_tag="Eint_030920"
FT   mRNA            <112271..>113314
FT                   /locus_tag="Eint_030920"
FT                   /product="origin recognition complex subunit 1"
FT   CDS_pept        112271..113314
FT                   /codon_start=1
FT                   /gene_family="HOG000149500" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030920"
FT                   /product="origin recognition complex subunit 1"
FT                   /note="similar to ECU03_1030"
FT                   /db_xref="GOA:E0S6A1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR020793"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A1"
FT                   /protein_id="ADM11236.1"
FT                   /translation="MVVVGREEEYLKLERYLDMFFSTETGGIVYISGVPGSGKTHTVLR
FT                   LMEKRQVKHLFLNAAGLRLKRDVYKWILTNLSCCTDPKRMYLKSLQKHFMECISHHVVV
FT                   IDEVDILIGRSQEVLYNLFDMPYLENSKLLLFVISNTMNLPERLFEPKVCSRIGGRRVN
FT                   FTPYTSAQLCEMAGSCGVNKGCVELVSKRIGGVSGDARKVRDVIERVKESERGSEAGIL
FT                   DVDDIMRKMYVPVYTYYLQNLSSYQKTIIFLVSGSEQDRMKTNELYDEFVSFCRRSGMK
FT                   EVGFFEYLDLLEVLVDYGLLGVRSLGKEIQCMVLREEVEKSLGSDKEYLEITGRAGSRR
FT                   CFLKNSG"
FT   gene            <113340..>113822
FT                   /locus_tag="Eint_030930"
FT   mRNA            <113340..>113822
FT                   /locus_tag="Eint_030930"
FT                   /product="transcription initiation factor TFIIIB subunit
FT                   Bdp1"
FT   CDS_pept        113340..113822
FT                   /codon_start=1
FT                   /gene_family="HOG000150334" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030930"
FT                   /product="transcription initiation factor TFIIIB subunit
FT                   Bdp1"
FT                   /note="similar to ECU03_1040"
FT                   /db_xref="GOA:E0S6A2"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A2"
FT                   /protein_id="ADM11237.1"
FT                   /translation="MDQKLKHFLDNSNFRRDRRNKKKKVETSGGKREAGQEEILMIKNG
FT                   QIVVNDANMYVDTHRDVEMEVMEDDRIVTSSTFSKKKGALRWSKKEIELFYKALEICGI
FT                   EFSLISSLFPNKERKHIKAKYIKEAKVNPERINEVLNEYKTFDQVAYNKLRSYLLE"
FT   gene            complement(<113860..>114549)
FT                   /locus_tag="Eint_030940"
FT   mRNA            complement(<113860..>114549)
FT                   /locus_tag="Eint_030940"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(113860..114549)
FT                   /codon_start=1
FT                   /gene_family="HOG000150333" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030940"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1050"
FT                   /db_xref="GOA:E0S6A3"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A3"
FT                   /protein_id="ADM11238.1"
FT                   /translation="MESSSRLLASKEIFKIILFVLCIYGATDYSQPKEWVKFIDKLAGR
FT                   SHIYITQISLYMTIMTLSLSYCVKHFGASRIKEVYRDFLSITLPLEGLVTTVFWTLNAI
FT                   DPTLLKNKDLYMAGVRTPLISEMSIHLFPFILLLIDQVGVNIYGARRHYWTFAIFGFVY
FT                   FMVIHYFQRLNNSWVYPFLGYMSISMRMALVAAATLLVFAYYKLFLQISRIINAKIHSS
FT                   TAKDKLL"
FT   gene            complement(<114652..>115341)
FT                   /locus_tag="Eint_030950"
FT   mRNA            complement(<114652..>115341)
FT                   /locus_tag="Eint_030950"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(114652..115341)
FT                   /codon_start=1
FT                   /gene_family="HOG000150333" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030950"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1060"
FT                   /db_xref="GOA:E0S6A4"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A4"
FT                   /protein_id="ADM11239.1"
FT                   /translation="MEKEKIKRMLKEILKVTLLGFCVYGTLDYALPEQVVQSINRTSGG
FT                   KFVYLTVLSLYLTIITTVIGYLTRTKVGKSLETTYKDLLALSFSLEGIVTLLFWILYFI
FT                   NPTLLKSRKLYSEGIQESLLTELSQHLFPLLLLLICQIDVRLKKRKRCISFVFGFGILY
FT                   FLETWYFYTVDGKWPYPIFKKMNTIGRILFIFMACLIGTGCYLGLLGVNDLVHGKYEPV
FT                   KEDNRSF"
FT   gene            <115501..>115971
FT                   /locus_tag="Eint_030960"
FT   mRNA            <115501..>115971
FT                   /locus_tag="Eint_030960"
FT                   /product="transcription initiation factor TFIIA-like
FT                   protein"
FT   CDS_pept        115501..115971
FT                   /codon_start=1
FT                   /gene_family="HOG000150332" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030960"
FT                   /product="transcription initiation factor TFIIA-like
FT                   protein"
FT                   /note="similar to ECU03_1070"
FT                   /db_xref="GOA:E0S6A5"
FT                   /db_xref="InterPro:IPR004855"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR013028"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A5"
FT                   /protein_id="ADM11240.1"
FT                   /translation="MLKIYEDIINEVISRLEHAEDEASISKSAIHELRNEWRERLIEYT
FT                   QGEWDEDRIVQRGGEQGYRHVRPSEGSGSVFGGNPTMEKEPGMFEDYESLSGSSGDSEI
FT                   IGKKVTAGNCMVCLYVKVNMSKGKWKCTFKQGFISIGKIDFVFNSAQGELEW"
FT   gene            <116045..>117082
FT                   /locus_tag="Eint_030970"
FT   mRNA            <116045..>117082
FT                   /locus_tag="Eint_030970"
FT                   /product="flap endonuclease-1"
FT   CDS_pept        116045..117082
FT                   /codon_start=1
FT                   /gene_family="HOG000193853" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030970"
FT                   /product="flap endonuclease-1"
FT                   /note="similar to ECU03_1080"
FT                   /db_xref="GOA:E0S6A6"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A6"
FT                   /protein_id="ADM11241.1"
FT                   /translation="MGIKQLSKLLKENCAKGIKERPLAYYSSKRIAIDASMSMYQFLIA
FT                   VRSDGSSLGNEDSPTSHLVGFFYRTIRMVELGIIPVYVFDGVPPEVKMKELEKRSERRA
FT                   AADKEYKEASEMGDKKLMEMYDKRKTKVTGMHVEECKRLLGLMGIPFETAPSEAEAYCA
FT                   FLCKKKAVYGVATEDMDALTFGSPVVLRNFSGSQSRKLPIVEYNLPELLESLSLEHEEF
FT                   IDLCILLGCDYCGTLKGIGPKRALGLIKKHGGIEKILQSENLEVPDGWRYRDAQRIFGS
FT                   LPEIGDAREFNISWGSIDRNGIVSFLVEEKGFDLERVNRGIEKLVNSRKKGVQGRLDGF
FT                   IARSR"
FT   gene            complement(<117097..>117948)
FT                   /locus_tag="Eint_030980"
FT   mRNA            complement(<117097..>117948)
FT                   /locus_tag="Eint_030980"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(117097..117948)
FT                   /codon_start=1
FT                   /gene_family="HOG000150331" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_030980"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1090"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A7"
FT                   /protein_id="ADM11242.1"
FT                   /translation="MYGTAKIVGECFKETICEITRLIDKNGEHLLLCGPDQEILQAIVG
FT                   VVKSHAEKISRTVVKVLPTTPKDESPDGKVFFIDIEGEMPISRQLHVYHYLEKTRTHPC
FT                   CLLLVSNSCTSLDRLERRIKSRFNHRIFFTGFLPFELYRTLHMQLAATDNEEEIQRQYN
FT                   IDPSISVLLKKIVLKKYSIPEYSIETLYSLLNPVHVALTMMAFKRRIKYISCVPEFRAF
FT                   TSDANELRGVTNMEILFYFLDILDFGLIDREGVLLVDMSSFKKHVSGCRPLYLRNLMYK
FT                   NL"
FT   gene            complement(117986..118057)
FT                   /locus_tag="Eint_030990"
FT   tRNA            complement(117986..118057)
FT                   /locus_tag="Eint_030990"
FT                   /product="tRNA-Phe"
FT                   /note="tRNA Type: Phe, Anti Codon: GAA, Cove Score: 73.17"
FT   gene            <118133..>120268
FT                   /locus_tag="Eint_031000"
FT   mRNA            <118133..>120268
FT                   /locus_tag="Eint_031000"
FT                   /product="phosphatidylinositol-4-kinase catalytic subunit"
FT   CDS_pept        118133..120268
FT                   /codon_start=1
FT                   /gene_family="HOG000149499" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031000"
FT                   /product="phosphatidylinositol-4-kinase catalytic subunit"
FT                   /note="similar to ECU03_1100"
FT                   /db_xref="GOA:E0S6A8"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A8"
FT                   /protein_id="ADM11243.1"
FT                   /translation="MDHDPNNASLRDLLSSPHTDLLQIMQYMHEHPSVGVWQYICSRIR
FT                   HSSPQIRYLPQLVHVFLYNKDRMSSKPMHALLSHWAGKDREFCCALYFHLRSALESNSD
FT                   IRSISCYFLICDIFETERKRMCRNTRILELQYRYKTKTGRTLGTLVARKGYPPLRGILL
FT                   FFVKAVSWMVHPRLFKRIHDYEEMFLETREVCNINVKRDLRFGNAFDGPGVSSSISFLE
FT                   SLVEIPSRLKKLPRHLRQRGLDMEIKLLNHNLPAKVSLPFHSGRFVLTARVEESFLLDS
FT                   AENSPFLVVFETALEVPRRSCAKEEIKDALFLKQQLDAVNGLSSLSEINVVKENVMTSI
FT                   EKILMTERYENTSLENSPNLEAWRSDEEKIDKHLDDIHVQQKISKNSVDAGMLFMNHRS
FT                   YSAGQLAEGNSSFGKSEEEKKLGGSASYRRHSGWILKKAELRRTSLFNDVAGWTAESVI
FT                   VKTGNSLRQELMAHQVLQEMKKIWRKENSPIWVQAYQIYLVSDTSGIIETVVDALSIHK
FT                   IKKKMMSENKNYSLKNYFTESFEPNSEKYRSCLRNFLYSLVGYSLATYILQVKDRHNGN
FT                   IMIDGQGHIIHVDFGFIMGNHPGFYCVEAAPFKFSKEYLELLEGLMDEFKDLFLQGYMA
FT                   LRKHSSSLFRIMETMPGSSSVECFNRRELQNFKDRFRMDLNEERVEEHVTYLINKSLNS
FT                   MGTGLYDSYQYFSYGYL"
FT   gene            <120310..>121143
FT                   /locus_tag="Eint_031010"
FT   mRNA            <120310..>121143
FT                   /locus_tag="Eint_031010"
FT                   /product="hypothetical protein"
FT   CDS_pept        120310..121143
FT                   /codon_start=1
FT                   /gene_family="HOG000150330" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031010"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1110"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6A9"
FT                   /protein_id="ADM11244.1"
FT                   /translation="MLLRRVRLPNKPLVILSWKNSVYIGDAHGVVYEMKHPYIAPVAIF
FT                   QSPGPVSALDGAECLYYGNWDGDIGIVGGGKINLGNHMVKCMVVHGDTVYASVGLMVYG
FT                   LSLELKIKCSYEVKHKVLCMTSFQGSVYCGMGVSFLSRIHNGLEIVGRSLHDTSIFCIS
FT                   GEYTGSADGKVLKQDYDELENAKEIYRGKNWIRSMYNQHLFSDGRDVMGDIDGLKGSLG
FT                   SGVKLMYSHEEDVVGVVRVGGMIISIGLDYCCTILEVEPSLSMEEEKELAELMNG"
FT   gene            complement(<121571..>122080)
FT                   /locus_tag="Eint_031020"
FT   mRNA            complement(<121571..>122080)
FT                   /locus_tag="Eint_031020"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(121571..122080)
FT                   /codon_start=1
FT                   /gene_family="HOG000149498" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031020"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1120"
FT                   /db_xref="GOA:E0S6B0"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B0"
FT                   /protein_id="ADM11245.1"
FT                   /translation="MNLMFLLVGPIIPMEAGSDSDTALSIVSLGLAIEIALAVYGACEG
FT                   MVSSGAASILCSQNRSILGPTYFIMIMISTIFFSSFLVALIIATNIDEKLDMGKSISYF
FT                   SACMMVGMTAAISGKVCSALGKRGFRILSEKPSFLPILIILFGMIEFVIIVVLSCALLM
FT                   VYQTRG"
FT   gene            <122113..>122721
FT                   /locus_tag="Eint_031030"
FT   mRNA            <122113..>122721
FT                   /locus_tag="Eint_031030"
FT                   /product="hypothetical recombinase-like protein"
FT   CDS_pept        122113..122721
FT                   /codon_start=1
FT                   /gene_family="HOG000150329" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031030"
FT                   /product="hypothetical recombinase-like protein"
FT                   /note="similar to ECU03_1130"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B1"
FT                   /protein_id="ADM11246.1"
FT                   /translation="MGLLKYHGVTELSGKPGSGKTAIAIEESKEFPTIYLTTTAFCIER
FT                   YKGSSKEVMDRVVIKYIPTIGHLASFAMNSIERIVVESNTRLIIIDSLDHLLATEGMGM
FT                   SRGVLFGIINKLKRVSQKHLVNILVVTCHYGTWTVGSFCIPNPVLGLQWMYMVNTKYIC
FT                   SRNGEKRTLKLVRSPLASSGTWEFEIGPSRVYIVSEAFE"
FT   gene            <122778..>123149
FT                   /locus_tag="Eint_031040"
FT   mRNA            <122778..>123149
FT                   /locus_tag="Eint_031040"
FT                   /product="hypothetical protein"
FT   CDS_pept        122778..123149
FT                   /codon_start=1
FT                   /gene_family="HOG000155305" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031040"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1140"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B2"
FT                   /protein_id="ADM11247.1"
FT                   /translation="MTDRTGPPLRILSDSLRKFRYISGAMFYGRREVSLIEVAGVCVHR
FT                   DGKLARMLDFCGEVLIETGGQEIFLDLAYLLVCRVYMKDGRMNLCCKSARRLGIFEEMF
FT                   FWAEASNLRRSLKYNRNRH"
FT   gene            complement(<123159..>123677)
FT                   /locus_tag="Eint_031050"
FT   mRNA            complement(<123159..>123677)
FT                   /locus_tag="Eint_031050"
FT                   /product="calponin H2-like calcium-binding protein"
FT   CDS_pept        complement(123159..123677)
FT                   /codon_start=1
FT                   /gene_family="HOG000232113" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031050"
FT                   /product="calponin H2-like calcium-binding protein"
FT                   /note="similar to ECU03_1150"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B3"
FT                   /protein_id="ADM11248.1"
FT                   /translation="MDKQQEEVTLWIQTVLGEKFEAGTFHDLFKDGVRLCRFLNKVSKL
FT                   DVKYKESKQIFVQRENICSFINGLKKLKMNEYELFQTNDLFEAKDLKQVVICLYALSRQ
FT                   LQKEKIFKGPFIGPALATKSKIEFSKEVLDRSKYAVHLQMGYSDPELLEKPENKIVSNV
FT                   SKDLKTSNL"
FT   gene            complement(<123782..>125335)
FT                   /locus_tag="Eint_031060"
FT   mRNA            complement(<123782..>125335)
FT                   /locus_tag="Eint_031060"
FT                   /product="Phosphoinositide polyphosphatase"
FT                   /note="Sac family"
FT   CDS_pept        complement(123782..125335)
FT                   /codon_start=1
FT                   /gene_family="HOG000149497" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031060"
FT                   /product="Phosphoinositide polyphosphatase"
FT                   /note="Sac family; similar to ECU03_1160"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B4"
FT                   /protein_id="ADM11249.1"
FT                   /translation="MNMGTSLKVSTSPEEIMLENIDKNTTLILKRQKMDSGKSVYHSYG
FT                   VYGIVTISKSSYLILVVDAVLRGMMYEHAVYEIQDVEIIRLKRSKTENFSSEMKEVRKF
FT                   LRNTGIYFSTYPLHKSISIKKDDDLDFLFNSLPLERFLKHVGDQGSLFSLSCIQGFFGS
FT                   IDVGAVCLRLISRRSWRRAGARYFSRGSDSSGYVSNYVETEQIVYEGEKTTSHLQVRGS
FT                   IPLMWKHVLGREYNPKIVISNRKILHLADDIMRSKYGDVLYLNLIRSSGYEGELHDAYE
FT                   SELLGNNKKGVHFNFFEEGGIFEGDTQERFLGLVDETLSLFGYKGPESSQNGVIRTNCI
FT                   DCLDRTNISQFIIGEHVLSKQLSHFDIGNKENIYDQMKYLWYKNGNSLSMQYSGSFALK
FT                   SHFLSRRKQRPIDTLRDSAIGLQRYFINRLCHGSLQVTYEILTTDLEGKKVNLHRDRMG
FT                   AIKTIFLFLLLTTCTASWAVTGIFVLSLLFSTLVTSIVTVVTMIVFLDFLIQKPKGATQ
FT                   "
FT   gene            <125647..>126330
FT                   /locus_tag="Eint_031070"
FT   mRNA            <125647..>126330
FT                   /locus_tag="Eint_031070"
FT                   /product="Homeodomain-containing transcription factor-like
FT                   protein"
FT   CDS_pept        125647..126330
FT                   /codon_start=1
FT                   /gene_family="HOG000112857" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031070"
FT                   /product="Homeodomain-containing transcription factor-like
FT                   protein"
FT                   /note="similar to ECU03_1170"
FT                   /db_xref="GOA:E0S6B5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B5"
FT                   /protein_id="ADM11250.1"
FT                   /translation="MDNFGGNFFNSYNNNSTRETEGSQYFDPYFVKHRKRTTKAQLKVL
FT                   EETFETNIRPDANMRKKLGEELGMTPRSVQVWFQNRRAKIKKLTQKKMMQQENTDNTKG
FT                   QETAHTPSPSKESKYNGYHPYMPIQGPLEEFNVYPRDNSIYKHAIPQGMGSPVMYEGFG
FT                   YRGHEEYGYPYVQRYGNGEYYQMQYPYGMMQAQWHQPPGFRDEDYYRSTRKQQYRGGAP
FT                   NPEKM"
FT   gene            complement(<126846..>128438)
FT                   /locus_tag="Eint_031080"
FT   mRNA            complement(<126846..>128438)
FT                   /locus_tag="Eint_031080"
FT                   /product="subtilisin-like endopeptidase"
FT   CDS_pept        complement(126846..128438)
FT                   /codon_start=1
FT                   /gene_family="HOG000149496" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031080"
FT                   /product="subtilisin-like endopeptidase"
FT                   /note="similar to ECU03_1180"
FT                   /db_xref="GOA:E0S6B6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B6"
FT                   /protein_id="ADM11251.1"
FT                   /translation="MFLMGIMVLIVSQRVWGSEDVSTGEIIGLEKSIQEGQEENPPGIL
FT                   FQGNKDSYEAGNPTDIPSIEVQTEVRTVVKEVVVEVEEPRKDAQIPSVARYEGQIKTGS
FT                   NLDDTQCKGNDNYTFGRERCYILTKDVHDGDLSNISAFVEGQNGKIKRQYTKNVTGVSF
FT                   CSNNENVMKKGSGIGMHIEEDKIYGVSAFQNSIPNYMYLMKYYENIIFNNYFYDNWIFR
FT                   VLQIKRMMASFFGFYEYYHTGKGVSIFLLDTTVKPVNNVCNLSGRLESCNTHGDTMASL
FT                   LVGRDTGFAKDSHLNVLDVVGCDGKVMLSDMIYGLESLESKGGPGILVFGVSGPYSEAL
FT                   NAVVDHISSRGMVVVTPAGNLHDQSCNYSPGSSKSVINVGSVNKYAGVSKFSNHGDCVR
FT                   IFALGEEVLRENSAAGTSLSAAIVASSIALFLETSPRATFSQIWGYLNQNSFWNSRGSY
FT                   NVLKIPRLECGSRSQRSIFHFWGFPSDVITIVFIFLAIFILSYLIFIGIRYFRRRGEAH
FT                   EDSILFDPPMDRF"
FT   gene            complement(<128585..>129178)
FT                   /locus_tag="Eint_031090"
FT   mRNA            complement(<128585..>129178)
FT                   /locus_tag="Eint_031090"
FT                   /product="thioredoxin peroxidase"
FT   CDS_pept        complement(128585..129178)
FT                   /codon_start=1
FT                   /gene_family="HOG000022343" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031090"
FT                   /product="thioredoxin peroxidase"
FT                   /note="similar to ECU03_1190"
FT                   /db_xref="GOA:E0S6B7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B7"
FT                   /protein_id="ADM11252.1"
FT                   /translation="MIQIWNVFPYICRKINSTLMKFPKVLTSNKYKALVDGEIKEISLE
FT                   DYRGKYVVIVFYPLDFTFVCPTEVNRFCDLKEEFLKRNALVLFVSCDSVYSHRAWASIS
FT                   RENGGILGVSWPMIWDMKRELCNQFEMFDEENGHPMRGTVILSKDLDVKHLSINYHAVG
FT                   RSVSEILRLIDAITFNDENGEICPVEWKKKMNNH"
FT   gene            complement(<129195..>129614)
FT                   /locus_tag="Eint_031100"
FT   mRNA            complement(<129195..>129614)
FT                   /locus_tag="Eint_031100"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(129195..129614)
FT                   /codon_start=1
FT                   /gene_family="HOG000155306" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1200"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B8"
FT                   /protein_id="ADM11253.1"
FT                   /translation="MFEAINSIDNKVIRKSEDHEKGMILLEYTKALKTLDIGSFLKYRV
FT                   KHDVNLGLYKRASGYLISNYAIKKTLEEIELNMERYKLLEYKESVFIMARRNIMEKENF
FT                   VKARKLLNLAREKGFFCNELYELEELLNNEWYPKA"
FT   gene            <129744..>130895
FT                   /locus_tag="Eint_031110"
FT   mRNA            <129744..>130895
FT                   /locus_tag="Eint_031110"
FT                   /product="60S ribosomal protein L3"
FT   CDS_pept        129744..130895
FT                   /codon_start=1
FT                   /gene_family="HOG000107319" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031110"
FT                   /product="60S ribosomal protein L3"
FT                   /note="similar to ECU03_1220"
FT                   /db_xref="GOA:E0S6B9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6B9"
FT                   /protein_id="ADM11254.1"
FT                   /translation="MSCRKFNAPRHGSLQFCPRKRSKTIRPSVGAFPADDISQPVHLTG
FT                   FMGYKAGMTHVIRTKTQVAKNKQLSREVMDAVTVVEAPPMVVYGIVGYERTVTGLHRLP
FT                   IVTASYVNDGVLRRMFGNKYMEKEAAAQFCRGEVTESRVEEIKKRAECVRVLVQTQPEM
FT                   VKTLGLKKAHIAEIQLNGGSICEKVEWALERLEKEIQIAEVFGENENIDVIGVTKGKGF
FT                   QGTVKRFGVRKQPRKSRKGIRKVACIGAWHPSRVMYSVARAGQMGFHRRTEKNKRVYMI
FT                   GNGSTKIKTEFDLTEKAISPMGGFPHYGEVKNDFIMVKGAVVGPRKRVVTLRKSLTQQR
FT                   PSEELVIKFVDTSSKIGHGRFQTSAEKKAFYGAKKAETVAEVH"
FT   gene            <131017..>131997
FT                   /locus_tag="Eint_031120"
FT   mRNA            <131017..>131997
FT                   /locus_tag="Eint_031120"
FT                   /product="WD40 domain-containing protein"
FT   CDS_pept        131017..131997
FT                   /codon_start=1
FT                   /gene_family="HOG000150328" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031120"
FT                   /product="WD40 domain-containing protein"
FT                   /note="similar to ECU03_1230"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C0"
FT                   /protein_id="ADM11255.1"
FT                   /translation="MISSIGFLPGGVSIERLKEFVYDEDIHRALDYLGIPVVDKSKMAC
FT                   DDDIDESEEIVENDIIVFCTPNEDDVSFLQFYVQNRECTNIFLHHDTYVFSTICDSTQA
FT                   VIGGETYVALATFEKDIMVFDPFVRNPVLPQVLLKGHEEAVLSIECSNGVLFSGGLDST
FT                   IIEWDTEKALPKNRIQAMGPVNKLGTLNSSVIYSVENSLYWTDREIRFDGEVERIRIMD
FT                   NKMLVSDSTGILRHYDLRNVSDPVMEKRIHEDSITGIDVLGSNVYTGSLDGSIKIVSLE
FT                   TFDVMNSEDVEEKIFSLKVHEDGFYVYGGEKNEPELRYIDCSKDE"
FT   gene            <132066..>133016
FT                   /locus_tag="Eint_031130"
FT   mRNA            <132066..>133016
FT                   /locus_tag="Eint_031130"
FT                   /product="Adenine nucleotide alpha hydrolase"
FT   CDS_pept        132066..133016
FT                   /codon_start=1
FT                   /gene_family="HOG000225864" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031130"
FT                   /product="Adenine nucleotide alpha hydrolase"
FT                   /note="similar to ECU03_1240"
FT                   /db_xref="GOA:E0S6C1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020554"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C1"
FT                   /protein_id="ADM11256.1"
FT                   /translation="MACTRCGVSQAIVIRPKDKSKVCKACFFNGFEEDVHETITSSKMF
FT                   KEGDKIGIGVSGGKDSTVLAYVLDLLNKRHKYGIELILLSVDEGIAGYRDHSIETVCKN
FT                   SKSFGLKLRIVSFEEIFGVTMDGIAHKTGKRGNCTYCGVFRRQALEEAAREMGVDMIAT
FT                   GHNADDMAETVLLNVIRGDISRLGRCTREKTKEQKNGDGKVISLSRLKPFKHIYQKEIV
FT                   LYAFYKKLEYFSTECTYSFGASRGDLRMLVKQLEREDPRVILEVIRSGDLLQQKECMDR
FT                   TPGECVMCGHSTSSGDTICNGCTLIKRLGNTKPNY"
FT   gene            complement(<133010..>133855)
FT                   /locus_tag="Eint_031140"
FT   mRNA            complement(<133010..>133855)
FT                   /locus_tag="Eint_031140"
FT                   /product="phosphatidylinositol
FT                   N-acetylglucosaminyltransferase"
FT   CDS_pept        complement(133010..133855)
FT                   /codon_start=1
FT                   /gene_family="HOG000150327" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031140"
FT                   /product="phosphatidylinositol
FT                   N-acetylglucosaminyltransferase"
FT                   /note="similar to ECU03_1250"
FT                   /db_xref="GOA:E0S6C2"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C2"
FT                   /protein_id="ADM11257.1"
FT                   /translation="MLWKRCLYLQQEYPINYMEVHQVCKRRGVNEIYEDINRMVIRISI
FT                   VMLSLSLFKVMMLEDKPGMPKSSWFSFISTFIENFLENREDTGINLKPNFMLLTFAYLL
FT                   SPLIRTLTLEIHPTTLYVYFTITQLFFIIDSVSASIYNTGSPIEVKDEETPLSLEESIN
FT                   IPKRTSSNQILGLTSYFLGFILLSSRFNEPSSVFNLLCSTFMGYIILLNHIERLGIHRS
FT                   TWATALVYVFVSIMTFLPDVRIFCVYSCIVTFVYWVSHISVWLLEKDLDRKAACSSKPQ
FT                   "
FT   gene            <134175..>134726
FT                   /locus_tag="Eint_031150"
FT   mRNA            <134175..>134726
FT                   /locus_tag="Eint_031150"
FT                   /product="putative endoplasmic reticulum membrane protein"
FT   CDS_pept        134175..134726
FT                   /codon_start=1
FT                   /gene_family="HOG000149495" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031150"
FT                   /product="putative endoplasmic reticulum membrane protein"
FT                   /note="similar to ECU03_1260"
FT                   /db_xref="GOA:E0S6C3"
FT                   /db_xref="InterPro:IPR000348"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C3"
FT                   /protein_id="ADM11258.1"
FT                   /translation="MKVLLFAIGVLCRRIKLEPKEQFVFRDKVTANQMYKFMYQAPRSG
FT                   KIEMTVFDTKGRQMIKTRDPYSVLYSKMNEDGEIVISVKNNSSKGINFGYRCPDTSKKA
FT                   QGDLGPISVDLVSELQEVLETIIQAQRVHIKKHEEHARMVAGSRKWVTRLLIFETLFFT
FT                   GVLYFLHKDMLKMFETKREV"
FT   gene            complement(<134723..>135385)
FT                   /locus_tag="Eint_031160"
FT   mRNA            complement(<134723..>135385)
FT                   /locus_tag="Eint_031160"
FT                   /product="cytidylate kinase"
FT   CDS_pept        complement(134723..135385)
FT                   /codon_start=1
FT                   /gene_family="HOG000242850" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031160"
FT                   /product="cytidylate kinase"
FT                   /note="similar to ECU03_1270"
FT                   /db_xref="GOA:E0S6C4"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C4"
FT                   /protein_id="ADM11259.1"
FT                   /translation="MKVYKIAVDGPAASGKSSTSDLVAKKLGFSHLISGNLYRAVTYAL
FT                   ARQFEKVCPKDENQKKFVLGLNIEVRDNRVFIDGKDVSGHLRGEKIDNNVGSVAKEKYV
FT                   REKVSEIQRSTIDLEKKGIIVDGRDIATEIMPDADLKVFLTASPETRARRRYKENGSES
FT                   YEKLLDAISKRDNDDRTREHGPLVASSGSVVIENDAMTLEETANEIIRLFRRVESFN"
FT   gene            complement(<135423..>136694)
FT                   /locus_tag="Eint_031170"
FT   mRNA            complement(<135423..>136694)
FT                   /locus_tag="Eint_031170"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(135423..136694)
FT                   /codon_start=1
FT                   /gene_family="HOG000150326" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031170"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1280"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C5"
FT                   /protein_id="ADM11260.1"
FT                   /translation="MANEYRDGYGSKQPKIPSSNTRGYKKKSLDIVHLDRSGDVDKAVF
FT                   ETYRKSNIVEVMEGPIESIMLKKKIIRVLGRIKTDDLFLYNTGKCITTVSLPSKHSKYI
FT                   FVGVKKGFERESTFKFSSEASEVYLFDQELNLRRILSFSFGYCRKIEARQEEDVIRCVA
FT                   LFSDGFIRRFDFEGEIRNMVQLETSGVVNFEIDWDEDIIFATDGGILVWIRQNSVVSVF
FT                   NEIKGMITSIAIKKKTRKGKDGEHSTGSPNKGSLCFYALGLNGKIFRFGNEFQEEERIS
FT                   FPSGYTFIKYLSQTDTVIIVDTLNNVTKILHDEGSHRRATVMFNYSLSCCRPNEKKILI
FT                   GGFDGTIKHGKINKRKTKTKTLFQLVRKGNEVMLVHSEEELKAFDPKGRLFNDSSERVI
FT                   DLWIGETHLFAAYECGIVVGFSLL"
FT   gene            <136741..>137871
FT                   /locus_tag="Eint_031180"
FT   mRNA            <136741..>137871
FT                   /locus_tag="Eint_031180"
FT                   /product="molybdopterin and thiamine biosynthesis E1-like
FT                   protein"
FT   CDS_pept        136741..137871
FT                   /codon_start=1
FT                   /gene_family="HOG000281219" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031180"
FT                   /product="molybdopterin and thiamine biosynthesis E1-like
FT                   protein"
FT                   /note="similar to ECU03_1290"
FT                   /db_xref="GOA:E0S6C6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR007901"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C6"
FT                   /protein_id="ADM11261.1"
FT                   /translation="MVFESDLPEATLERYSRQIIVPGIHVKGQKSLGSSGVLVVGCGGL
FT                   GSPAILYLLSCGIGRIGLVDFDKVEIHNLQRQVIYTEADVSQYKVTAALSFVKRANSLI
FT                   KAVGYNEFLGRENVERIVAPYDIVLDCTDSICTRYLLSDCCQALSKSLICGSVLRWEGQ
FT                   LYKLTPDGPCYRCLFPDMRERTLTCEDAGVVGPICGIIGSLQALEAIKTIMGNTEPKMT
FT                   IYNGITSNFVDSKLRSSRNDCIVCSRKCIPEDLYFPTAKCTAVSDDKATNQNVETINWE
FT                   DILNNLDSYLLIDVRPPIQHEMFRIKGSVSIPLADLPDKIGDIEASGKKIGVVCKRGIS
FT                   SRKGAWILNMNGIEAFSVNGGVDRLKSLLRKTGAGP"
FT   gene            <137903..>138403
FT                   /locus_tag="Eint_031190"
FT   mRNA            <137903..>138403
FT                   /locus_tag="Eint_031190"
FT                   /product="hypothetical protein"
FT   CDS_pept        137903..138403
FT                   /codon_start=1
FT                   /gene_family="HOG000150324" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031190"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1300"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C7"
FT                   /protein_id="ADM11262.1"
FT                   /translation="MSGKSLKEVLNLEIFRDKKICVDEVLPQNVDFLIVDLSDALGLSI
FT                   SAFSEETDHYRKIAKSRNKQVSVNSAYDGDCMEPDIMDDVWSAMNIWGIDGCGKIQVYR
FT                   SGTCKKSDWYKYDIVIRVQPLDSGISTDIDGKILIFGRGRKYLELRYKILRDRVDYYTQ
FT                   QFE"
FT   gene            138490..138562
FT                   /locus_tag="Eint_031200"
FT   tRNA            138490..138562
FT                   /locus_tag="Eint_031200"
FT                   /product="tRNA-Val"
FT                   /note="tRNA Type: Val, Anti Codon: TAC, Cove Score: 66.79"
FT   gene            complement(<138613..>139548)
FT                   /locus_tag="Eint_031210"
FT   mRNA            complement(<138613..>139548)
FT                   /locus_tag="Eint_031210"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(138613..139548)
FT                   /codon_start=1
FT                   /gene_family="HOG000150323" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031210"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1310"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C8"
FT                   /protein_id="ADM11263.1"
FT                   /translation="MDTLKKSQDVDGTKRKDRYSKKRERGVFWTFFWLTWTCIVIVILG
FT                   LIRWDFIFNAIYRIFPPSRYILWPFKRFLEFGLVWSNIEKQAKKIEEVKMVLEIRKAFC
FT                   IIYTLLIFANITLGFFFKSVISVFKMKTIDLRKVLMLIVRVSILVILLKGKNEKKMKDN
FT                   LGPEHVIRFVKAQYFFSSAWSLLENIESITFIEILAEVMGCWVVNVVVSHENQDIVENL
FT                   LNFPKPVNFAIALVLTPFFYIMIMFYLLELTKRIYPFFRRELEISDEFASSCNIAISVV
FT                   LIILFIWYAYYELSVVINMLEGKKRNYIIF"
FT   gene            complement(<139732..>140592)
FT                   /locus_tag="Eint_031220"
FT   mRNA            complement(<139732..>140592)
FT                   /locus_tag="Eint_031220"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(139732..140592)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031220"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1320"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6C9"
FT                   /protein_id="ADM11264.1"
FT                   /translation="MNSIIDVKDGEEEDRFLIRPSNKEKIQKIVFLFYITIMAYILIQF
FT                   LEVFPLQTSTKKMVFRIISNVSMALPCIKMAYTILMYKVWDSSSEDFRKLEILQCAKAL
FT                   VDLVLMMFVIQEWRSKKFQMTSEKTGSAILISYVLFLSQILSEDFESGSITAILSGGIL
FT                   TKTVTIIEEKQFQKFQSLLKIAIDFISRGIPDVSAKKDILKALEVVFPVFFISFFVMII
FT                   IGIFMKFEKKLLKNFKLPRKILTVACGLILFLLSFFVFEKGIDMAKELGQKPFLSSRFL
FT                   SFRFR"
FT   gene            <140725..>141972
FT                   /locus_tag="Eint_031230"
FT   mRNA            <140725..>141972
FT                   /locus_tag="Eint_031230"
FT                   /product="26S proteasome regulatory subunit 7"
FT   CDS_pept        140725..141972
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031230"
FT                   /product="26S proteasome regulatory subunit 7"
FT                   /note="similar to ECU03_1330"
FT                   /db_xref="GOA:E0S6D0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D0"
FT                   /protein_id="ADM11265.1"
FT                   /translation="MNGQKQENIIEEKDVGFILSYGRNYYAEGIMEKEAEIRRLFEQVS
FT                   LKLGTKEVETGLAPPMCWDLLGDRNRIQSEPNLQVARVCKVLEGYQEPRYMIGIKMIAK
FT                   FIVGKGKRVDASLIQEGMRVGVDRNKYQIILPLPRKIDASVTLMQVEERPDVTYNDIGG
FT                   CKEEIEKIREVVEAPLLNPERFIALGIDPPKGVLLYGPPGTGKTLLARAVANRTNACFI
FT                   RVIGSELVQKYVGEGARMVREIFAMAKGKKACIIFFDEVDAFGGTRFDDDDDNEVQRTM
FT                   LELINQLDGFDPRGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRTSILKIH
FT                   AKTMSVDKDIRFDLIARLCNNATGAELRSVCTEAGMFAIRERRKIATEADFLKAVDKVI
FT                   KGYAKFSSTPRYLTYN"
FT   gene            <142060..>144615
FT                   /locus_tag="Eint_031240"
FT   mRNA            <142060..>144615
FT                   /locus_tag="Eint_031240"
FT                   /product="hypothetical protein"
FT   CDS_pept        142060..144615
FT                   /codon_start=1
FT                   /gene_family="HOG000150322" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031240"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1340"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D1"
FT                   /protein_id="ADM11266.1"
FT                   /translation="MDGNVLGVLGIPLELVFEEGLDAEKQASVIRRVEEKTCFRLKREM
FT                   DIDILISEVANDETSTMETLKSYLGKGLFGGKFGFLDAVSVIVCSEKISVDEMSKHYVP
FT                   IDEIMGEEVEEVFRRIADLEGRKRIERQANRWSLKSLKDIFKSNPDEDKRFADGLFVLE
FT                   RYKEAYRIYSRYNGVDEFSCYCIEMSIYCLILSKKSVPSSIVNSLGMFGSEKVCLVRIT
FT                   SIAIGFSDILALEMLALLQEKSLFKALAQESLAQVLDGKKYHRKKIEMWFNSSLEFREM
FT                   KYIGRSIRCCECYLDLSNFNFINGILPELERNILLSPNRYIKETLELMKGNCSPGLEDG
FT                   VIEKSKEEIVIWREYQGSMCNFQGVANVVESIFVQFKGRGLVSILQKGEETPKTYWTNQ
FT                   KVTFDGPGEFIIEDITFNAWEVEYKVKLGIPIDIREDTPFMHVEMKDVHEVLCGELYFL
FT                   SCKIVRNHNSRVKILFDNREFTTSSNMFGFEMVFQAVGVYSCRIILEAEGVITYKDVMF
FT                   TVIPSFSIDTFNYKYCLPLVFLKIESHIEENSRVRSCLALSKDLEVSGLDTTTGSFYSY
FT                   KEYAIEYFRKNIVGVGSGDLGQTLGVEKEKPILPENLQKLLHGMDKSPPVTSDLLFSDL
FT                   IPVMEKKMIIPGEGTYSFCTFLQGKKPLRELLSPRAKEPDKVSKRETNEVILYSLKNES
FT                   LGTIFDGSLEEQPGKISMRIEIEIPPKRVCVFVVKGIFEALFSPEGLSDEGIIKPICPF
FT                   VYITHFSPARLKEPTIIYLCVSNYYEQHVLDVEISSPTIAICSSDSKFRVEKLSFSLFE
FT                   VRSAFKKRKKYEESDIKISIKVENEEIDHECLVELPLVS"
FT   gene            <144661..>145728
FT                   /locus_tag="Eint_031250"
FT   mRNA            <144661..>145728
FT                   /locus_tag="Eint_031250"
FT                   /product="N-myristoyl transferase"
FT   CDS_pept        144661..145728
FT                   /codon_start=1
FT                   /gene_family="HOG000149494" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031250"
FT                   /product="N-myristoyl transferase"
FT                   /note="similar to ECU03_1350"
FT                   /db_xref="GOA:E0S6D2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D2"
FT                   /protein_id="ADM11267.1"
FT                   /translation="MEEKHKFWNTQPVGKNGLGIISNERSVSLEKPKLPGGFRLEELES
FT                   IEELARFLEENYVEDVHSGHMLKYSKDFLEWVIGSDEARKKYSVVLRLCGRMVGFIFAQ
FT                   EHWIVIREQKNRVVGVNFLCVSQEMRGRGLAPILIKEVTRQANVDGIFQGVFTNGIELF
FT                   FNISHGRYYHRPLNGENLFMSGFSDRIIKSRKTHVREGTRVAEEKDMVDIEKLYLQESE
FT                   KHMFYEEIRSSNISSTFKTVKNVIHTYVHESGGKIDGFGSFFIIDTIEKKSKRKVQGGY
FT                   LYYRGGRDIKEMVEDLIYFAEKEGCDVFTCLDTMGNSSFLADLGFFPGSGEIRYYLYNW
FT                   STREVPKDKVFFILP"
FT   gene            <145817..>146734
FT                   /locus_tag="Eint_031260"
FT   mRNA            <145817..>146734
FT                   /locus_tag="Eint_031260"
FT                   /product="hypothetical MYG1-like protein"
FT   CDS_pept        145817..146734
FT                   /codon_start=1
FT                   /gene_family="HOG000208845" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031260"
FT                   /product="hypothetical MYG1-like protein"
FT                   /note="similar to ECU03_1360"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D3"
FT                   /protein_id="ADM11268.1"
FT                   /translation="MKLVTHNERFHYDEILASCVLLRIYPDAEVIRTRDDSIISQGDIV
FT                   YDVGRVFDPQSGRFDHHQRTFSETFSPKYRTKLSSSGLIFKYFHKKLLALYGVEESCRI
FT                   YELVVDKIYSEFFLYADAIDNGIDIYGEIRPRSIADLVSLFNSDEPNEDLENQRFLEAL
FT                   KIVDKDLDNYLKRIRTWIDSYEYVESKIKETNGPILVLDKHYSTDLVLEIEGSHQKDFK
FT                   FMVFPLRNAYRVMAIPKCKGSFETKNPLKKEWRGLVNEDLVRVSGIEGCTFVHSSGFMG
FT                   INSSLENALKMCSESLPNNRNLNQ"
FT   gene            complement(<146759..>148003)
FT                   /locus_tag="Eint_031270"
FT   mRNA            complement(<146759..>148003)
FT                   /locus_tag="Eint_031270"
FT                   /product="histone deacetylase 1"
FT   CDS_pept        complement(146759..148003)
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031270"
FT                   /product="histone deacetylase 1"
FT                   /note="similar to ECU03_1370"
FT                   /db_xref="GOA:E0S6D4"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D4"
FT                   /protein_id="ADM11269.1"
FT                   /translation="MSSKRVVYFYDPEIGNFSYAMGHPMKPLRVKMTHTLLVGYELYKY
FT                   MDILRPFQASYENLTNFHSVDYINFLSSVSSENMEEMIKDLHKFNIRDDCPVFPGLYDY
FT                   CKLTAGGSIYAAQKISSGKYDVAINWAGGLHHAKRSEASGFCYVNDIVLGILELLKYNK
FT                   RVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGDYFPGTGMVSDIGLAKGRGYSVNVP
FT                   LKDGIDDESYFSIFKPVVSKVIEVYRPNAIVLQSGADSLSGDKLGCFNLSHLGHSRCIK
FT                   FVQSFNIPLILLGGGGYTIGNVSKAWAYGTSVVLDVDIPKEIPYNEYFDYYAPTYKIDV
FT                   PTSNIANQNTRESLDSIIASVYENLRGISHAPSVQMIDIPPSFISDESDDEELSKKKEG
FT                   EDSDDYETFDSKEDP"
FT   gene            complement(<148083..>149126)
FT                   /locus_tag="Eint_031280"
FT   mRNA            complement(<148083..>149126)
FT                   /locus_tag="Eint_031280"
FT                   /product="pelota-like RNA-binding protein"
FT   CDS_pept        complement(148083..149126)
FT                   /codon_start=1
FT                   /gene_family="HOG000150321" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031280"
FT                   /product="pelota-like RNA-binding protein"
FT                   /note="similar to ECU03_1380"
FT                   /db_xref="GOA:E0S6D5"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D5"
FT                   /protein_id="ADM11270.1"
FT                   /translation="MKLEKNKIDQKCRSGSIKMTPEHQEDIYTLSSVIEVGDMVTSVTT
FT                   RKIQIDGKTQHRVTLTLKIKVEAINVDLESSTIYLKGKTVLINEYVKLGSYHTIDITLG
FT                   QPFSLEKDEWQEMSIRLLKEAAKPQLETAFVVFYEKECVVSIVTRSKISIVLKQEMKNK
FT                   KFTNVIKTLEKYADKISLFVVASAFEIRNEFYKAVVNSKELKKIQSSFCVVKVPPECRG
FT                   CSNSKVINTILTDKDLSKTFQGVQYIDDLREVDNFFVKFAKGSDLVCIGMESIREAMDY
FT                   GALDRLMITDEKMRPNDVEKRREMELFCREIQGMNCKISIVPVAHFSGEKLKEMGGICG
FT                   LLKFSYR"
FT   gene            <149235..>150035
FT                   /locus_tag="Eint_031290"
FT   mRNA            <149235..>150035
FT                   /locus_tag="Eint_031290"
FT                   /product="putative sugar kinase"
FT   CDS_pept        149235..150035
FT                   /codon_start=1
FT                   /gene_family="HOG000150320" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031290"
FT                   /product="putative sugar kinase"
FT                   /note="similar to ECU03_1390"
FT                   /db_xref="GOA:E0S6D6"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D6"
FT                   /protein_id="ADM11271.1"
FT                   /translation="MNKELEDVVSSIKSKLQALTSNKKGDSGTVLIIGGSRLYTGAPYF
FT                   VSLAAFYTGCELVYVFSEEESIIPLKILLPESIVCGIEYQEWLLEKVSACVIGPGLGRP
FT                   SEETQEEIRKILLHLSRRNVPVVVDGDGIRLAEKLGIENFGTVIITPNINERKHVEKIE
FT                   KRFFYVLKGSTDVILWSGREIKIEDEGCPKRIGGQGDILAGTIASLVSKCKAPAMEIDV
FT                   LGSILLGCMMVRKAGRLAYQKYKRGLITRDILEELKTIFKIEFE"
FT   gene            <150424..>150708
FT                   /locus_tag="Eint_031300"
FT   mRNA            <150424..>150708
FT                   /locus_tag="Eint_031300"
FT                   /product="homeobox protein HD-9"
FT   CDS_pept        150424..150708
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031300"
FT                   /product="homeobox protein HD-9"
FT                   /note="similar to ECU03_1395"
FT                   /db_xref="GOA:E0S6D7"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D7"
FT                   /protein_id="ADM11272.1"
FT                   /translation="MKGRYKLSKKSRLSRAQRDFLNAYFEMNPNPNAQERESIASQSLI
FT                   SKEKVRNWFQNRRSKERGDDKVSSCLSISDANFTETGVHPMSNDLYIRR"
FT   gene            complement(<150840..>152381)
FT                   /locus_tag="Eint_031310"
FT   mRNA            complement(<150840..>152381)
FT                   /locus_tag="Eint_031310"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(150840..152381)
FT                   /codon_start=1
FT                   /gene_family="HOG000150319" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031310"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1400"
FT                   /db_xref="GOA:E0S6D8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D8"
FT                   /protein_id="ADM11273.1"
FT                   /translation="MEDLRTFIASNVFSAYCSEMPSLENSGAFKSGIVLLDLLQNAKPA
FT                   NEIEKSRLNYMMNLCLKDPQPFCIPRELSGLERACMMLSFKEYEKIDLSMYGFRYELVG
FT                   CVPTNEGAYGNSILIVRCNGTSNEKKHVYSTEKYKFENEIVPSLSVGEQSILLVEMIRV
FT                   FNTEICPDLRRLKVQAYIDRVLFPWNEKSEVVKMTAHYYLMMLNLEPYDLEFTHERITD
FT                   SIFEIPFVFHSEWEKLLGDAYYNCSAYSKALVYFQKYRCNTKIINCLVKLNRNDEAVER
FT                   ALEEVRSIGDPTSHESKVRLCNMNIILGIITGEENYFDRALSIYHSYEPLRAKGVYFLK
FT                   AGDTEKAIISFKKALEIVPWNTEIQFLYASALTSAKRFSEAEVVYERLVADDQRNAVFL
FT                   RNLAMCRIQLQDIKNGLISLKKASMYDQNVMEAYFLMSIKYNIPKEIKYSLERVDSFEG
FT                   LEDGVMYLVENKILCENEVKSALMRNVRIGDLAESLIKRIDSRTHVSLTPAGKPK"
FT   gene            complement(<152452..>154488)
FT                   /locus_tag="Eint_031320"
FT   mRNA            complement(<152452..>154488)
FT                   /locus_tag="Eint_031320"
FT                   /product="Cdc48-like AAA ATPase"
FT   CDS_pept        complement(152452..154488)
FT                   /codon_start=1
FT                   /gene_family="HOG000198544" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031320"
FT                   /product="Cdc48-like AAA ATPase"
FT                   /note="similar to ECU03_1410"
FT                   /db_xref="GOA:E0S6D9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6D9"
FT                   /protein_id="ADM11274.1"
FT                   /translation="MKYVVGSIKIEQVERGKINKIYIPRTSGLDPSEFILVDSKYAFKF
FT                   DFTDGCNAQLSKIQREFLNKSVGKDEISVKHLNVVECDPISLLKLDIEIINLEKVDLDA
FT                   KELVEKFKNIYVSFPFNIDQKFYLYIGDLGFKVFVREMFTALDKRYGILLKNTEVFINS
FT                   VSERLVLSNNSRENMLLDPNFNFESLGIGGLKQEFGKMFRRAFVQRAFDSDVIKKFGIP
FT                   HVKGIILYGPPGTGKTLIARKLGSLLNARPPKIVNGPEILNKYVGQSEENIRNLFKDAE
FT                   EEWKVKKEDSNLHIIIFDEIDAICRRRGNSSGAGVGDQVVNQLLSKMDGVESIENILVI
FT                   GMTNRLDLIDEALLRPGRFEIHLEISLPDEESRIEIFRIHTKTMESHDYLDKSVDLNKI
FT                   AKLSKNYTGAEITAVVKSAVSFALERKVHGEKDDKERMSVVGDKNIKVYMNDFIQALDE
FT                   VKPSFGINEQDFYRFEKTFYETPIFTQGIEHGKNLLQKLRKTNLYSTSSLLFHGFPGTG
FT                   KTTLAVKAARSSMFPFIKIISPRDIIGLSEYEKVNYIKGKFMDAYKSEEAIVILDDIEG
FT                   LIDFVNIGPRFSNAVLQALKIFIKEESKKKMFVFGTTSSIEVMKECGIYECFQSSYEVE
FT                   KIGFPDYEILCNQNPCFSDICYEEPMSIKQLLSLLDEPDVSFQ"
FT   gene            complement(<154552..>156426)
FT                   /locus_tag="Eint_031330"
FT   mRNA            complement(<154552..>156426)
FT                   /locus_tag="Eint_031330"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(154552..156426)
FT                   /codon_start=1
FT                   /gene_family="HOG000150318" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031330"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1420"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E0"
FT                   /protein_id="ADM11275.1"
FT                   /translation="MGEMFLASRLRLLILKEPLLRPPQQSPFRLFIQETKTNLRFDIYL
FT                   FLLLLITCFGLALIFFRSSRDGGNVLLYTIGFLLIFCSYNLQKVIEANRMLGKSLPNSN
FT                   SSTWFWSAWGNPWRVKFRDSFERSHLSNLLSHISLTGHSEKESTASHLALYKNLGTEEE
FT                   RQKEENPSTKGRDIRKKTTLATLERKSPSIPVEKKSSVKERTYSEGVSGGGHQVSMVFK
FT                   AQGQSTINRNAGNGEKRKVFLGNLMKIFQFKAENDENLKRHVLNLRNIEIQVERILEEF
FT                   TNVFKLFMKEAEKIEDEMVEFNASTRYLNISLNELRMEIKKYFSNLPNARASQEILNYL
FT                   STLARNYQDSENTGGGDIRPVIRYENKIMFFLGVQMVLCLVLFLAALARLEAITSILKP
FT                   IVSVGLIVVTLSSVPFLLNGQMLDRSCKSGSIKGCSFTSTHIGGVTRLEVVSKANGLES
FT                   QLGAILKESEYIAEILRLYVKSMMDTRVNAKMSVFSNLFNKILFVYDDFDHLTKRKVEK
FT                   GMFFSYIKMMSRLLENITGLLEFSERKDMVDIYVNERAFLFWLSADKDSVVESIREITE
FT                   AGPQNRSEMPPKWCVCALEGICDGKDGMDILFLLTLIGGPAFLIFLYL"
FT   gene            <156543..>157148
FT                   /locus_tag="Eint_031340"
FT   mRNA            <156543..>157148
FT                   /locus_tag="Eint_031340"
FT                   /product="Rab GTPase"
FT   CDS_pept        156543..157148
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031340"
FT                   /product="Rab GTPase"
FT                   /note="similar to ECU03_1430"
FT                   /db_xref="GOA:E0S6E1"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E1"
FT                   /protein_id="ADM11276.1"
FT                   /translation="MDSECKYLFKIILIGNSGVGKTCLMKRYTDETYSFTQSSTIGVDF
FT                   KIKSLEVEGERVKLQIWDTAGQERFRAIISNYYRGAHGIIIVFDMGSKESFNNLGDWLS
FT                   EVRKNTNENVEIIILGNKVDDKEKIVITEEEIERFLGENNIEKSSFYMTSAKDNICVND
FT                   SFEYLTRKLIDKYKKIGFGTGKESFKLNVGDPKKTCCL"
FT   gene            complement(<157170..>158552)
FT                   /locus_tag="Eint_031350"
FT   mRNA            complement(<157170..>158552)
FT                   /locus_tag="Eint_031350"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT   CDS_pept        complement(157170..158552)
FT                   /codon_start=1
FT                   /gene_family="HOG000149492" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031350"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /note="similar to ECU03_1440"
FT                   /db_xref="GOA:E0S6E2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E2"
FT                   /protein_id="ADM11277.1"
FT                   /translation="MGVQINCTEAEEDIFNLIRSHAKEFGNVTPRVAGGWVRDKIMGHP
FT                   SFDMDIALENISGYKFAAGLMKSSTGQKLTEVHVIKDNPEKSKHLETAVVRINGFCVDF
FT                   VNLRNETYSETRIPNVNPGTPQEDAFRRDLTINSLFYNLFTKEVEDYTGRGIDDIKNKL
FT                   LITPLDPRTTLFDDPLRLVRIFRFHSKLGFKIDGKIEEALMDERIKRALGKKVSNERIH
FT                   IEIFKILHYPRGQYGLLEIVRRGYVSPVFKPPVERETPYEKGLMFCETVEKITNLWGRT
FT                   YRREILNLYTVLCFFSRSTVPNGKSLLFSNAYIMKISLPSSRRFVKTINKIEESLVFLS
FT                   GYDMKKIGDEDLIRIVRFMGETWYESLVIYSAIEYIEDNHEKYEDGLRVVYSIIQQEIG
FT                   ECYLVKPIIDTRCLAETLGIPKSDTGFYIEESVVYQLLNRTSEPEEIINYLRRIKTSRN
FT                   VN"
FT   gene            complement(<158635..>159543)
FT                   /locus_tag="Eint_031360"
FT   mRNA            complement(<158635..>159543)
FT                   /locus_tag="Eint_031360"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(158635..159543)
FT                   /codon_start=1
FT                   /gene_family="HOG000150317" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031360"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1450"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E3"
FT                   /protein_id="ADM11278.1"
FT                   /translation="MKKKLYIGEILSLLGALQLYLSSDHLEAHFMVILTIENFLSSLIV
FT                   LMMSVPFAIKNTTFKEAVQIQPEYLPLGLFAFGEYSSWYRGAGMTSLKTAMAARGLCYP
FT                   LSVLLMFMLSRTAKENILRNFSFVLVVLMNVYKSVQYSNDGFFDVLFGIIYLSLYVIFS
FT                   VSSDFMTVCMTNRSGLPKFLLASSFYIWIYSFIILVDSGLRYNDIHVFIEKNTSKSILL
FT                   LITSLLLRVLSAYYIQRFGIVAYNTTKISNYIYFIILRSFTGLERIWRAEDTLFHLSIY
FT                   FLILFFIKFEESQEGRLGLGL"
FT   gene            <159965..>160399
FT                   /locus_tag="Eint_031370"
FT   mRNA            <159965..>160399
FT                   /locus_tag="Eint_031370"
FT                   /product="histone H3"
FT   CDS_pept        159965..160399
FT                   /codon_start=1
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031370"
FT                   /product="histone H3"
FT                   /note="similar to ECU03_1460"
FT                   /db_xref="GOA:E0S6E4"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E4"
FT                   /protein_id="ADM11279.1"
FT                   /translation="MARTKQSARKTTGGKAPRKQLSAKSARKAVAPASGGGAKKSRYRP
FT                   GSVALKEIRRYQKSTDFLIRRLPFQRACRSVVKECSNTTDIRFQGPALGSIQEALEAYL
FT                   VSLFEDAMLCACHAKRVTVFPKDISLVLKLRSRHVKSISD"
FT   gene            <160502..>160987
FT                   /locus_tag="Eint_031380"
FT   mRNA            <160502..>160987
FT                   /locus_tag="Eint_031380"
FT                   /product="hypothetical protein"
FT   CDS_pept        160502..160987
FT                   /codon_start=1
FT                   /gene_family="HOG000150316" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031380"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1470"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E5"
FT                   /protein_id="ADM11280.1"
FT                   /translation="MYIKVSGINKMINRYDLNKVFTFTRPIYKTIEHSPDVRFYFYSTL
FT                   HEIAMAEKLNKRSLIECLEVSFIKNPLKEKSCLSISSSRSSCCLYTVCDRDVSIDMIER
FT                   LFGLPARCYFRWGEFKEIYIIEFKEAVEIKKADFTKYVFAFEDYIDYVIENGLFDQE"
FT   gene            <161041..>161352
FT                   /locus_tag="Eint_031390"
FT   mRNA            <161041..>161352
FT                   /locus_tag="Eint_031390"
FT                   /product="hypothetical protein"
FT   CDS_pept        161041..161352
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031390"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1480"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E6"
FT                   /protein_id="ADM11281.1"
FT                   /translation="MENQCHIFPFFIPEVSKVKVEYFDLNEDTGTIRGIFCVKKKLEMD
FT                   IDVFICNKIVTDPFFFWEPACSGSVFEKGLELVRRGLGFPKEDRKGPTLEKMITKVKK"
FT   gene            <161436..>162029
FT                   /locus_tag="Eint_031400"
FT   mRNA            <161436..>162029
FT                   /locus_tag="Eint_031400"
FT                   /product="60S ribosomal protein L18"
FT   CDS_pept        161436..162029
FT                   /codon_start=1
FT                   /gene_family="HOG000213425" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031400"
FT                   /product="60S ribosomal protein L18"
FT                   /note="similar to ECU03_1490"
FT                   /db_xref="GOA:E0S6E7"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E7"
FT                   /protein_id="ADM11282.1"
FT                   /translation="MHFTSAMKRVRLPSSAVAVRKEPRSKNIYLRALSDFYTKVADNTS
FT                   VLAIKKISKRLKMSKSDRRPVKISKIVSEIGESKDKVAVIVAKVLDDDRIMEIPPLKII
FT                   ALQWSKGVKEKIERYGGSIGTLDQLFEVCPNMDDIHLISSSKFARRSAKFWGPAPGEKG
FT                   STTYPRANQKCHNREKRVMMKGRKAPQSKRTSEE"
FT   gene            complement(<162070..>162411)
FT                   /locus_tag="Eint_031410"
FT   mRNA            complement(<162070..>162411)
FT                   /locus_tag="Eint_031410"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(162070..162411)
FT                   /codon_start=1
FT                   /gene_family="HOG000150315" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031410"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1500"
FT                   /db_xref="GOA:E0S6E8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E8"
FT                   /protein_id="ADM11283.1"
FT                   /translation="MSIFSLLGVKKGASKEEVRMKYLKRLLLIHPDRSKGDINEYIKLR
FT                   ESYEKYERGEEYEEVPYFVCNRDDIGSIVCRCGGKYKVLNEENSRVECEFCSCFIEIED
FT                   FLRLPAPDK"
FT   gene            <162594..>162992
FT                   /locus_tag="Eint_031420"
FT   mRNA            <162594..>162992
FT                   /locus_tag="Eint_031420"
FT                   /product="hypothetical protein"
FT   CDS_pept        162594..162992
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031420"
FT                   /product="hypothetical protein"
FT                   /note="similar to NCER_100139"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6E9"
FT                   /protein_id="ADM11284.1"
FT                   /translation="MLILSLLMSVGAYYLPPTRHAFIISARTLPPYRLDSFPFTQVGPY
FT                   KTSGDPIIFARPSRVDKETSTEGNEKSVSGEKKEESKKGLSNIIFGSTVCRFFFYTAMA
FT                   VIIFFIGYQTRKSHEGGSYVRLPTTSNN"
FT   gene            complement(<163120..>163482)
FT                   /locus_tag="Eint_031430"
FT   mRNA            complement(<163120..>163482)
FT                   /locus_tag="Eint_031430"
FT                   /product="CCAAT-binding factor subunit B"
FT   CDS_pept        complement(163120..163482)
FT                   /codon_start=1
FT                   /gene_family="HOG000150312" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031430"
FT                   /product="CCAAT-binding factor subunit B"
FT                   /note="similar to ECU03_1510"
FT                   /db_xref="GOA:E0S6F0"
FT                   /db_xref="InterPro:IPR001289"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F0"
FT                   /protein_id="ADM11285.1"
FT                   /translation="MQHRDIMDQGPNTRYGDISFEDEQLRDVGYPDKSNYGAYDYSFPF
FT                   SDQPFQPLYVNAKQLNWIKKRKSRRDILDTLMITNKRNYLHESRHKHAMKRLRAPSGRF
FT                   LTKEETEELNRKNNIN"
FT   gene            complement(<163671..>164780)
FT                   /locus_tag="Eint_031440"
FT   mRNA            complement(<163671..>164780)
FT                   /locus_tag="Eint_031440"
FT                   /product="WD40 domain-containing protein"
FT   CDS_pept        complement(163671..164780)
FT                   /codon_start=1
FT                   /gene_family="HOG000150311" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031440"
FT                   /product="WD40 domain-containing protein"
FT                   /note="similar to ECU03_1520"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F1"
FT                   /protein_id="ADM11286.1"
FT                   /translation="MDRFLINKKETTSRYAQRNFYDLGTKEEMYEARFACSMGEIPYLS
FT                   TVGSQNLGPRIIIQPYRQLKVKSLPDDFYSSLIDWSGENVFFTADNCLFVHNFFSSKTL
FT                   QICNLSSLGITSVKYNPTTSTVALGTSIGVMLNVDIASLKITRYSFHRSRIGVIESENA
FT                   NIITGSRDRKIKITDLRSEKAVATILHHRQEVCGLSISKDLRFLASGGNDNRLYIYDYR
FT                   NLSHPLKQCSSHKAAVKAISWSPLSPNLLVSGGGTADKTIKLWDMNLVNSSRSSSCLIR
FT                   SVDYGSQICNLRWLKSNKILSTHGYSKDDIRLSQMSSFKVERYFLGHKNRVIHFSCSDD
FT                   EKYFVSGSSDSNINFWELDGERDDEIKIR"
FT   gene            complement(<164927..>168700)
FT                   /locus_tag="Eint_031450"
FT   mRNA            complement(<164927..>168700)
FT                   /locus_tag="Eint_031450"
FT                   /product="Mot1 helicase-like protein"
FT   CDS_pept        complement(164927..168700)
FT                   /codon_start=1
FT                   /gene_family="HOG000150310" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031450"
FT                   /product="Mot1 helicase-like protein"
FT                   /note="similar to ECU03_1530"
FT                   /db_xref="GOA:E0S6F2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F2"
FT                   /protein_id="ADM11287.1"
FT                   /translation="MNRLEKFFTTLNTAQSKVLKEYTTDELVSQIKEYVDFTPYILKQT
FT                   YRLLCGQGSEDRKNGARILKSLMFQFKLVTNFKIEYKKGTSIYLGSTGEQFNVQAPSVQ
FT                   EQKRMIKKIAKLEHVETNFLSDIDFKAGSGETIKRQKVEEKPIENVFDFFEQISDNLLS
FT                   YEWYKRHGAFLAFAAMFSEIDKREGEIQIRIDSKLFSKIYEILVTDKFNDFVEDRTVAP
FT                   VRDAAAYLLSYIYPLIGPNDIIEQLLRFLDNEDWQVQFSGLIALGYLKEFVEDKNGLCK
FT                   KLVSLLSSPDEDIKLLSAELLCHFSIIDGIDTVLDKCWQNIESEEVISVSKTSNLSLLT
FT                   KIYRENPEFSIPPERLKDIFPCFTSPVPEVRTSILNMVENLSEESIDFLVAEVVLIEEK
FT                   EEIRKLAIKILKKRKDLPRNLIIHFMNVIGGSLYEPYREDDFVSYEDLYFTKSGINVIG
FT                   KDEILKNRCLLFECIMKNEFPDLQTGNETMIDRTFLALYRSAQELHKGGTPMSGSIEEL
FT                   GDYFGKCKDLRMAPQKEFKKKLSNPEIHSIHPMVDPLYIDYVRMIASIEFPSLCNAPAL
FT                   FEVETCIQFLDLFSKMIVEYYDAKKISVDNFLQVAYERLSSGRNGFLRFFEGFDGRFLD
FT                   HPFFLQVGSLENRLDFFSKTVHIYTKASQIQKIAFIFDDALQERNITVINGFMKSLEFN
FT                   EKFVRKALENLDVELLDAVLMNGDHSFNPLFVRPLLKNISSDVNRKTSSRLFSKIIPTL
FT                   GFRTNEKISKDLLEVIENEKKSLDSLLDVRKIPEYHIKCPILVKLRDYQIEGVRWLNFL
FT                   HSFSLNGILADDMGLGKTLQVLTFLCSEIYKTKKKILVICPSSLTGHWKAEVKKFFPFV
FT                   TAEIYRRENRGEYGILISSYETFRNDYLSFIEKDWFYVVVDEGHVLRNKHTILYSRMNM
FT                   IKCSRKIVLTGTPVHNSVEDLVSLFNFLMPNYIGSEKEYGSLNVKMSDTEIEKTQEKLN
FT                   LLHKKVLPFILRRLKIDVLKDLPPKIIRDIIVDLGPAQEKLYREINERGGKEKLEDVDL
FT                   EYGKIDQKNVGFKRTRDLLLAVSHMSHFKDSSEVSCKVKALEDIISLCGGEDLRSKILI
FT                   FFQFKSSIDFVIKDIMEKYKFKYSRLDGSVPSSTRAKIAEEFNTGTTQILFLTTQVGGL
FT                   GLNLTGADTVVMYEHDWNPFNDLQAMDRAHRIGQKRTVNVFRLIAKNTLEEKVMNLQSF
FT                   KMFVANSLVSQQNADIETMDTKDLLERFQVLG"
FT   gene            complement(<169282..>170274)
FT                   /locus_tag="Eint_031460"
FT   mRNA            complement(<169282..>170274)
FT                   /locus_tag="Eint_031460"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(169282..170274)
FT                   /codon_start=1
FT                   /gene_family="HOG000150309" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031460"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1540"
FT                   /db_xref="GOA:E0S6F3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F3"
FT                   /protein_id="ADM11288.1"
FT                   /translation="MSQEENNEKLSHAAEKKESKDSKNNRVPKYESESFFDDSENVAYS
FT                   SQYRIAGEYRPVRQVIIIERQPTLGDVLQKMAVIAVYALVIQTFFAVWKGINKKSHDFC
FT                   VFFILLLFPPGFFLYIQSYFLPLCWLGFSGFILFNTVRVLKGSLGKDVMRDIYGVFKTL
FT                   FIISNLGILLGQSLTFIFFYLNPKNLGYSLSILLFFLYFGLLSREVIFFLSETVAISTG
FT                   FYSKEGVPGKGNNNSLCMICTKSFNGSEKIHTLVCTHSFHEDCIKGWCLLGKKPFCPYC
FT                   KKKVESSSLPPELWHKAEVWFYPLINTLRSFIVLTLVLTAIILYKIKYQ"
FT   gene            complement(<170394..>171062)
FT                   /locus_tag="Eint_031470"
FT   mRNA            complement(<170394..>171062)
FT                   /locus_tag="Eint_031470"
FT                   /product="leucine zipper domain-containing protein"
FT   CDS_pept        complement(170394..171062)
FT                   /codon_start=1
FT                   /gene_family="HOG000150308" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031470"
FT                   /product="leucine zipper domain-containing protein"
FT                   /note="similar to ECU03_1550"
FT                   /db_xref="GOA:E0S6F4"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F4"
FT                   /protein_id="ADM11289.1"
FT                   /translation="MREIDHFMESREKNINYENEYPKSTHGIYDSKPIIDGNQPYIHPY
FT                   YFFGPSFLENRIPIHQEKYRYIAEQENQFCHPMDIFESSIRQSDQERIKSIWKKERNRI
FT                   AAKRWRDKRIAHLRELERKEGIMICEISELKEAIYDYDNILENILQYIQECLNMEERHE
FT                   NLVFLLNRLCNLKKFSTPKPVYLRDISHLFPKNLSVTNERIDKVTEAIRCSLSKLLGKD
FT                   "
FT   gene            <171440..>171979
FT                   /locus_tag="Eint_031480"
FT   mRNA            <171440..>171979
FT                   /locus_tag="Eint_031480"
FT                   /product="RAS-related cell division protein 42-like
FT                   protein"
FT   CDS_pept        171440..171979
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031480"
FT                   /product="RAS-related cell division protein 42-like
FT                   protein"
FT                   /note="similar to ECU03_1560"
FT                   /db_xref="GOA:E0S6F5"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F5"
FT                   /protein_id="ADM11290.1"
FT                   /translation="METIKCVLVGDPSVGKSWLISTFITGRNPEGYIPTLFNNYSKVVS
FT                   TGDKKYNMTLWDTAGSEEYNKLRSLSFQETDVFLVCYAVNNILSFHNTRRWIEELAEYD
FT                   VPMILCGTKCDIIDGNIVDRNLPIKLSKEYKLYGFMECSSIELINVKRVFDVALEAALK
FT                   PRKSKFRSIWFCCKCG"
FT   gene            <172080..>172559
FT                   /locus_tag="Eint_031490"
FT   mRNA            <172080..>172559
FT                   /locus_tag="Eint_031490"
FT                   /product="Ca2+-binding protein"
FT   CDS_pept        172080..172559
FT                   /codon_start=1
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031490"
FT                   /product="Ca2+-binding protein"
FT                   /note="similar to ECU03_1570"
FT                   /db_xref="GOA:E0S6F6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F6"
FT                   /protein_id="ADM11291.1"
FT                   /translation="MRRRQRRQSSNIFHMLTKNQIVELREAFNFMDVNSDTFVDRADLE
FT                   SFLESIGAPFSSEEIDEMMAEGGDSMTYMLFLTMIGERLSCTDTEKNIFNALKEFDDNG
FT                   DGTIDEKLLRTWLTEKGDQMAREDVDLLLRGCAENGRVDCRSLATKIKYGEIITE"
FT   gene            complement(<172623..>173264)
FT                   /locus_tag="Eint_031500"
FT   mRNA            complement(<172623..>173264)
FT                   /locus_tag="Eint_031500"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(172623..173264)
FT                   /codon_start=1
FT                   /gene_family="HOG000150307" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031500"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1580"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F7"
FT                   /protein_id="ADM11292.1"
FT                   /translation="MEYKMQKDQELLTLIDNIEKSYDPSSQNYKFKYVFYNKVDGPFAR
FT                   PLDFPETLWNISLTSDPTMMPVLLKGDEIEHRKSLQMDACRRINDSYDFLRKKIGGLRM
FT                   RSEKLKSKIDGCLQIYRKIFGGVYNRLKKEEGKCTLLDRIYRTYLPLEKKEKLAVIQNK
FT                   GEVIDFLEDLRGMGEKILRDVDNALQERQKQTVILNELDKVQETFPRNPW"
FT   gene            <173339..>174691
FT                   /locus_tag="Eint_031510"
FT   mRNA            <173339..>174691
FT                   /locus_tag="Eint_031510"
FT                   /product="ankyrin repeat-containing protein"
FT   CDS_pept        173339..174691
FT                   /codon_start=1
FT                   /gene_family="HOG000149491" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031510"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="similar to ECU03_1590"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F8"
FT                   /protein_id="ADM11293.1"
FT                   /translation="MKLEKSAIMRKKRQGYSEFIVDDTNWNGQRTMLIKLHSIYQMYRS
FT                   AGVIGDVPPDMPSKSLLKASRGTIAAGYKLHLVKMALIDERPFKFNFESRRYYFKNVNI
FT                   VFLLGMIKNKPELVYSMLSNGFPNNINSSIFGSPMFPTYFHLACAMHHNILSVFLKFSP
FT                   SYSLCWNGLTPQMIASFSGKSLESKQPFNFVSMKQYLLLNSFRGFKITETDEKPIFLID
FT                   FLCMENDMEEARRVLNRNPELSRVSKICYLAQDNIEWIMFLSRYQTSVHQEFNGISPLH
FT                   ISSINGNFEGLVALVALGSYINSRDRQGNTPMHYCAMMQHFRCLELLIRLGGNMNMVNR
FT                   EGISTEDILISQGKVFDIKEVDLELPEALFQTLGDSVEFRHHLSIIDRIKYNCNHTIVK
FT                   KNRFTITSLLNLPHKIDYTEDLIQKVQGVKDTRRDSYSPRQSLQIFLKNIQ"
FT   gene            <174714..>175166
FT                   /locus_tag="Eint_031520"
FT   mRNA            <174714..>175166
FT                   /locus_tag="Eint_031520"
FT                   /product="transcription initiation factor IIF auxiliary
FT                   subunit"
FT   CDS_pept        174714..175166
FT                   /codon_start=1
FT                   /gene_family="HOG000150306" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031520"
FT                   /product="transcription initiation factor IIF auxiliary
FT                   subunit"
FT                   /note="similar to ECU03_1600"
FT                   /db_xref="GOA:E0S6F9"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6F9"
FT                   /protein_id="ADM11294.1"
FT                   /translation="MEGYGSCRVVIGNEARMIPEEERVIPELTHEWKAYVKASPEIVKR
FT                   VEFKLHDSFSNRLVNAEYPFEVVERGWGEFSIQIKIFLFNGEKIMTSHFLQLHGDSDVV
FT                   ISERVDEIVFKGESSPDTPLDEEEEEYERIETSILGMLEKFKEINE"
FT   gene            <175558..>175992
FT                   /locus_tag="Eint_031530"
FT   mRNA            <175558..>175992
FT                   /locus_tag="Eint_031530"
FT                   /product="hypothetical protein"
FT   CDS_pept        175558..175992
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_031530"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU03_1610"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G0"
FT                   /protein_id="ADM11295.1"
FT                   /translation="MVNQILFKTSYEKLLQPIRKFSKSIKVKRLESSMGETSKKDCNHS
FT                   TNSQCEACCEKNKACEAKDKTKGSVNEAKDKTKETVQETKDKTRNAAENVKDKVDNKDK
FT                   NEVYDNIKEKGSEAWDKTKEVAKNMKEGFKDLANNDKQKK"
XX
SQ   Sequence 176815 BP; 52335 A; 35451 C; 37747 G; 51282 T; 0 other;
     aatcctaccc catcccacat ctccctaaca tctctactcc atcaagtaga acaccgaact        60
     cctggaggat acacaaactc ccccctccga catctgctct tccgacagat attctttctc       120
     cgctgccagg gaactcatag cacttcttac ctcttctact tttgtaaccc tgaacatcag       180
     gtgatagata acatgctctc ccttcccgtt cttgaagatt cctacttcta ctattccaac       240
     ctccctcctt cctcctctct caagtgttgc agttgccatc ttctgaatcc tgttctcatc       300
     tccacccaaa tctatgaaaa atctcgattc atctggactt cggagcagtt ctacaacttc       360
     tactatgtca tgtacttcct tctgctcacg aatctctttt atgtttcctc ccttccactt       420
     ctcctctttc ccattgtcta gttctttctt gatcttgtct gcatccttac tccatcgtgt       480
     aattctcttg tgcaacttgt agttcggcct ttctgattgc tttcccttac tctttccaga       540
     gtccgaggga atagaaactc ctccgaccgc ccccaccagc tcttcctcct cttccttctc       600
     tccctcttct tccttcttct cctctgctgc cagtctcttc ttcctgcccc cccccccgac       660
     ttttcttctt ctttcgtcct cctgagtctt ctgattctcc tagcagttcc ctctcaatct       720
     taagtcttct ttcttcctca gccttctgtc tcctccgaac tgcatcagag accttctcaa       780
     catattctaa atctatttct tcaccatctt tccctatcat tatctgcttg attatctctt       840
     caacaacatc tttacttctt tccttgcatg tggttaatag taacccaacc gaaataattc       900
     tgtattccaa gtatagatat tcacaagctt cttcttcact aatactgttc tctttcaata       960
     ccttctttac ccatccttca accatgcatc ccatcaactc tacttcttct ggggtctcgt      1020
     acaacttgga acatgcctcg catacaatcc tttctgcatt aattatcttt ttccaccaag      1080
     acctattgca aagtctctct ccatatttct taataccata gcatacgact attttttttc      1140
     tttttttttc ttcatcttct tcctcctctg cctcttctac catcttctct acctcactaa      1200
     taatggcttc tccaaacttt gtcatctctc tgttctctac ctcctcgcat tggaaaactc      1260
     tcttgtatgc catcataagc aactcactga atgtcttatt tctcttctca tatattttcc      1320
     ataaatccaa agatattttc tgaaggtatg gaactatctt ctcagaaaac atcctcttaa      1380
     atcgatcatc atcggtatat aacagatctt tagctgcaaa catccatact cccattgcca      1440
     gattcccact ctcaataaat tctctaacat ctatcatagc ttgaagatcc ctcctcaggt      1500
     cactgaattt tgttgttggc tgtacaatga gcatcccggt tcctcggaac aacaatggaa      1560
     aaggcattga ttcactttct gtccctttca gtttaacaac agaggttatc atgcttccag      1620
     ccacagagga ctctaccatt gagcaagcga ttatgtcgaa aaatttaaat accaatatct      1680
     ttttccatac catgtctatc actccacttc tcgaaaagta ttttactttc tccttttcta      1740
     ttttactcta aaattctctc catgatccaa tcatatttcg ccccattaac aattcttttt      1800
     aacgccctac tccagaaatt agacctattt tttgtctctc cttccgatct tcttctttta      1860
     tttgctattt gataattagc caatcaacac agaagacctt aggcttccca gaaaggagat      1920
     tatgtgtctt catttcaccc ctttccattt cagggcccgc cctgagatca tcttctgttc      1980
     ctatttcaac agctctatat tgtctatctt taatggaaac cctttggctt tatatatctg      2040
     ttttctcaaa cttcttttta tttctaagaa cgcccacatg tgtccaagct agatattgta      2100
     aatccatgaa tttattccac caaatagtaa tctctatcca gctaatcttc atgtttttta      2160
     ccaagacaaa tgattcctgt cctattgaac cttttttgcc ttttgctcta ttaatcacac      2220
     attataactc tttttgaaga ctattagttt tctccttagt tgtttttggt ggatatggcc      2280
     taattgcgat atttttacac tttacagctg gccatcaatt ctatgcaaca ttctgatggg      2340
     atcaaatctt ctaactctga ggaataaact ctttttctac cattgaaggg aagaaaagaa      2400
     agatttcaat attttattca ggaagtatta ttcacaagct ctgacttgtt tatctgaagt      2460
     atttcgtatt cttcatggtt tatgatccca caaacacgta actggtgcag ccgtgagttc      2520
     ccatatctgg aatagtcgaa gttcttggaa caacctgtac ggctattgcc taatgcccaa      2580
     agataccata gaaagtggct gtacgccatt gctccctcca ccagttccaa cattttttcc      2640
     aaatgctcgt tactgtccat atattctcct ataaattcca gtctttcttg ggtatttgga      2700
     aagttctctt cctgaaatac atagttttcg tagtcataag ctgcctcgca aaacaggttg      2760
     gctatgtcga ttacaggaga acccattgct acaaattcga agtcgataaa aactacacct      2820
     gtttttacca tcagtatatt tcctggttgg aggtcattat ggcatgtgac tgattcaaag      2880
     tctccagtgg atactctgaa tactctattc tgcacttcaa ttagaagtct tactatatgg      2940
     tccttatctt ttttatagga cttttgattt aaagatttta tcttctctat tacatctcta      3000
     gggtttgcat tattttcttc gccaggtagt atttctttga tgcacttata catcatattg      3060
     tttaccagtt ccttgtaact ccgtattccg ctagctttta tattgtgaaa tcttcggagt      3120
     tctgttgcaa tctcttttaa atccctcttg atgattgaat gttccgaatc taaatatctt      3180
     tctatccgaa acttgttagt tgacactatc accctttcgc ttgctaccat gttattaatc      3240
     atttcgtcct gagcatcgaa gtcttttaat tccttataaa tgtaacggtt ctttcccacg      3300
     ctgaacatgt acacaacatt actatatgcc atactaagac gaggcatggg accgtttgga      3360
     agagacccta tatgctttct tatattttcc acaacatgtt ttggaatctc ggaactacta      3420
     tgttctatag acgcggaaaa gctaggatta gggtttgatg atgttactcc attcatccct      3480
     ccaatggcct tcatcacaat cttactctgt gagcaaaatc caaacaaaat atatattcct      3540
     gaaaataata ataggataat attcattaaa ggccaatgat aattaagtta caaactatcc      3600
     gaccttattg tggctataaa ttaattctgt ccttctcgaa gagattaaag agaatcaaac      3660
     gattttggta taaagttcta gtgctcaatt tatattcggt ctcttagcct ataaaagatt      3720
     caaatatctg ggatagtggt atactttacg gtctgattag gccatatggt aagtgaattg      3780
     tgaagttaaa gaagctggaa aactaaattc tggagagatg gtattatctg cacgatgatg      3840
     atttaaatga agatggagtc aataatttga attttggcat cccaggagaa gaaaaagtat      3900
     ctcgattagg atgtagtgaa ataatgattt aatatcaatt ttatactatt aaaaatttgt      3960
     tatatagttt atcaagaccc tacgatcaca atcattgttc cccgctttga atctattgtg      4020
     aatatccaaa tgttacatta ggaaagataa gccacaaaag cccggcatca ctatgcggga      4080
     aaagaaagag taccacacat ataggtgctc tcttgtctct tttgatcgcc atatttgatg      4140
     tttcaaacgt ctttcaaaag ccaatgttca tgtaaaattt attttttgat ggtttgtctt      4200
     ttagtttctt atttaagcta gatattttca taccaaggct ttatcaatca ccaaatgtta      4260
     ttgcatacct gtactcttca gcatgtatgg attactttcc ttttcttttt agagtcttac      4320
     gcaatttaca cagttgaata gcattcgctc atgtatcacc aatcattgca caccatctgt      4380
     tccaaatatt acctaatcgt atgctgcaaa gatcttaaag aattgactct ccaatgtgta      4440
     caatctgata cgttaggtgt tcctgagacg taatctccct tgtttcacaa gaggtttttg      4500
     tccataacaa attggaagtt ggaatgaaaa gagttattga agagcttact gcaagtttga      4560
     tctatctctt tagttcgata ataacaacgc tttccaataa gtatatacta tcgaaccttg      4620
     ggtttaaaat gcaatatctc ttggtagcaa ttcagtcttt taccatagtt gctgggttac      4680
     ttgttctgag aatcacaggc cttgttaaat ttccactaac caacttcaga aaatggatgg      4740
     ttccgtctct cttgctttct gtgatgatat tttcgggatc aaagtctctg tactatcttc      4800
     cgatatccct atacacttta ttcaagaaca gtagcatagt ggtggttgcc cttcttgagc      4860
     agcgcctatt caagaagaaa ataagcgctt tgtcttatat gtcgtttgtg ttaatgatca      4920
     ttagttccta tacgggaaat tcttcagatg ttgttcttaa cattggttat tactggatac      4980
     tgatcaacat cctgtctaca acggcctatg tattgtcgct aaaggttgct gtcgacatga      5040
     acagtaaggg aaaagcagaa tccgtatact attcgaatct tatttcattg ccaattcttg      5100
     tccttttgtc tgcactcttt gatgaaagaa gcatgggaat ttttgggttt caagagcttg      5160
     tgtggatcct gatttcgtca ttctgtgcct ttcttacatc tttcagtact gcttggactc      5220
     ttaatgtcct ttcctccact gctctaagca tgattggtgc cttgaacaag agcctagggt      5280
     cttttgcagg gatacttgca ttaggagaaa gtattaacca tcagaaaatc ttttctcttc      5340
     ttttaggatc gctggcatct gctatatact cgtatgacat ctcatttaga aagagagatt      5400
     aattcaaata taaacgtttg taattcccaa tggtctcgtt tgtttggtat tttaaatctg      5460
     tcctttaggt tccccaaatg aatagatatg aaacagccga ccatgactat atgcatgcca      5520
     aggactactt caacaactat aaatttgggt acattgaaag aacgacaaag actcttcttc      5580
     ttcaaagtct taggccggaa gatagacaag atgaagatct gcttagcata atgaatcaaa      5640
     gcaaatccca gttgaaagat gttaagtcta ttggtaaaga agcttccaaa tccatttctg      5700
     agctgtcaga gcttatctac gagaccaaaa ataaactctt gaagtatgag gagatgcttg      5760
     gccatgaaat ggaaagagag agagatcttg ccgaggaata ctctagactt gaaagccttg      5820
     acgaaaactt aaaaacatat gatgaactca aggcattgtt tgataaagga tgcgaagaag      5880
     ttgaagaaaa ttctaaaaaa ataagtgctc tcaaggaaga aattgcaata tcaagtacta      5940
     gcgaggcgga agaggaactg aaaaagatga aggaccgaag agataaactc tgtggaaagc      6000
     agaaaagact ttctctaata actatggaaa gctatctgga agattcatac aattggtaca      6060
     agaaatcact tgagctgatc aaaaatgtct ttggtataag tcttgttacc attgagcaag      6120
     agggcaacga gatgtacatg agactcaagg tttttgcatg tgagataggg atatttgtaa      6180
     gagatggtcg aatgattgat ttcaagttat acaacaacaa tgatgagacc cttgcatcgt      6240
     tttttgagga agcaggtagg cttgccgtat ctgttaacga cccccgtata ttgcttttgt      6300
     tggttgcaaa taggtgtaaa gtaacggagg tttgaatcat cttctcttat tcttgagttg      6360
     acgcttaata cgatcctttt gagtaaacaa acaatgatta tcggctgtat ggcaggcctg      6420
     gtggcggctg cacaagcatg ccttaaggat agcgattgct taaccagatc aagaccggat      6480
     gtccattcaa tgttctgtgt tgataacatc tgccagaagg ttctacctcc gggaaagcat      6540
     tgtaccaggc ctacagagtg ctcctcgtat tcattttttg ggcctttggc ttgcacaggg      6600
     aaatgtaagg ttgagaatga gtgcgagtat ggaaaggatg ataatttcga ttctatgtac      6660
     tgttgtagaa gcattcctca aggaaaagaa tgcaatccga accggcctgg atctcttagt      6720
     ggatgcgaca taactcaatc atgcttaatg gggaaaaagg gtttctatga atgtgttcct      6780
     gacaaatcaa actcctggtt acttggcgta tttctatcta taagtggaaa tatcgggata      6840
     aatattggaa taaaccttca gaagaaatca tataaacaat cacatataag actattcaat      6900
     atgaacctac aaacatttta tgcaggatgc tttacgtacg gcctgggaaa gattcttgga      6960
     tattgctcgt atctctttgg aaatcaatca ctaatggctg tgctgagtgc aacaggtctt      7020
     gtctcaaaca gcatacttgc tccaatgatc aacgaggaga tcttcacctg gaaagatttc      7080
     tctgcaatat tctttgtgtt tgcagggaca acacttatag tcatgaatac agctactagc      7140
     cacaaggttt ataccctttg cgagcttttg aagatgtata ctcgcgtgga aacattggta      7200
     tggcttggat ttatcattct tgtaataata gttctcttta tattcgttaa gtacgtagaa      7260
     gttaacagca attgggaact tcctgacgag aatatgatat ttctaaggag agagggtgtt      7320
     tggtttgacg aggaggggac agttattaag tatacaatgg ttctggccta tgtatgcttg      7380
     tcctcgttca tagcatcttt tacaacccta tctataaaaa gcctcggtga gatgattgac      7440
     aagacagttg ctggggacaa ccaatttata ttcctcacaa catattgttt catcataatt      7500
     cttgcaacat gcacattctt tcaaatatac tggctcaaca gggctctaag gcattatgat      7560
     gctctgctag taattcctat gtttcacgtc acatggactc ttttaagtat atttactgct      7620
     gggatctact tccgggaatt tgaacaatac acccgctatc aacttagtgt atttgtctgt      7680
     ggggtgatac ttatcttctt cggatccttt ttcctgggaa gtagaataac aaacaagacc      7740
     tatatcaaaa ccaaagacat tggaatggaa tcggaaaaga tattaaagaa ccaataaaac      7800
     ccggaattgc tttcatgagt ccccgtctga aactctcgtt tcgagtattt atggttcgtt      7860
     gatgaaaaca ggagttctta ggcacgtgga atgagggatg aaaacatata tgttgttgat      7920
     aaaatcgttg gatgtagaaa gaaaggggga aaaaagcaat atcttgtgaa atgggaagga      7980
     tactccgact cggaaaacac ttgggaagat gaaaagaaca ttttttgtaa agacctgata      8040
     aagaaatacg aagaatccca agaaaagttg aaaagaccta gccgaaaggt agccaacaga      8100
     aaaacttctc cgaagaaact taacaaaagc acttctgaaa agactaaagt tatcattaac      8160
     gactgggatg aattggttaa taaagttatt tcggtggaga aaaagggagc atcccttatg      8220
     gtctggttgc agttcaaaga tggaaaaaag ggtagttttc cagcatcaca aatacatata      8280
     aaatgcccat tacatctact tgaatactat gaaaataatc tagttttctg tgaagatggg      8340
     ggagataata ccaagtaaag ttctttattt tatatgtata tttagagata ccagttttca      8400
     agagagtcag taaagcctag atttctttcg tattagtgtt gactcgattg aagtaagact      8460
     gagggatatt cttttctgta tttaaagctt cagacaatgg aataggtcaa caatatagtg      8520
     cacctggttc caaaggagtt gctaatggaa taaacatcac ccttctcgat aatgcaaata      8580
     ctccctcttt tcagaatcac tttgtcatgt cccatctcta tgcatacagt tccttttatc      8640
     ataaatatcg aaaagttgca aaccgccttt tcaggtttta taaaggccag attgtttaga      8700
     aacaaaatag ctgtttcaag cattgtcgat gctacaagag gctcaaaagc gcttcttcct      8760
     ctgtacagcg cggatatgtt tgttaccgcc accttttttc cctcggagtt gtagatagtt      8820
     tctcctttgt actcatatat ttccttgggc tcaattatgc tttttctcgc tgtagatttc      8880
     tctactccct tcccaaggct ttgaagtctt tttctgtatc tgtccttcat ctcctttgca      8940
     ggacttatcc cttggtcctt ccccatttca ttcggcgagc atcgatcgtc gtcatactca      9000
     ttcaattctt ctcctctaga acttatttct gtgtagaatt ctccagaaaa ctcttttcca      9060
     tcctcagggc tctttggctg cccttcaggc ttatcttcaa tcctttcaaa agagctcgaa      9120
     agcctcttat tttcaagaat actgtttgtt tccaatgact ctctagaaga agaaagaaaa      9180
     acgtctcgat tcttagccga taggctttct cttatagtct ttatgtcaaa aagagtgtcg      9240
     ctctgggcat ttggctcttc attttcatct tcccctcccg tatcactttt atacactgat      9300
     gtctcgtcta cttcaattgt agtatcatcc ttaagaactg attccgctgt tctccaatag      9360
     tcgtcaatgt tctcaagatt atcatcatcc ttgactacat ccagttttgt tccaggatcc      9420
     aaaattcttt tcttgtaaga cttcatcttc ttacttagtc tacttgtcga ttcgtaggtc      9480
     tttcgcatca cctggggcta ggcattttct gcgatttgac cctgaagatc gtcctaactg      9540
     ttgtattttc cttatttcaa tggtgtctat ggagtacacc ctgatgttca ttgacattgc      9600
     tgtgaacatc accgacaaac tacttgcaag ggatgaaagt tcggttgaag aggttattag      9660
     gagatgtaaa gatagcaagg tcctaccaat atttattggt ctggaccatc aaacaagcca      9720
     aacctcgata aatctggcaa gaaagtacaa gacgatatcg acagttggta ttcaccctac      9780
     ctcatcctca aagtataaga acattgacga aatcatccca ttgatagaag aggatgctgt      9840
     ggttgcaata ggagagtgtg gcctggatta cgaccgtctt gagtttgcag ataagatatc      9900
     tcagaagagg atttttaggt ctcaactgga tttggaagga gattgctatt ttctccattc      9960
     aagatcctgc cacagggatt ttatggaaat tgtttctgat tacaggctaa gaggcgttgt     10020
     tcatagtttt accggaagta tagaagaagc tgaggagttg ataaaaaagg gattttttat     10080
     agggattaat ggatgctccg caaaaacatc tgaggggata gacgttataa aaaaccttcc     10140
     gcttgattcc ctcctcatag aaactgactc cccatactgt aagatcagaa aaagctacgc     10200
     tgggtttgag tatgttacaa ccgatttcag ttccctaaag gtcctgaaaa agaagaatga     10260
     gccatgttgt gtcgttcaag tagctgaaat aataagtaat gcaacagaaa aagattttaa     10320
     cctagtggtg gaaacggtat ttagtaacac aatcaaactt tatggagatg tggtgaggaa     10380
     gtctgccgaa gaatggggtt ttttaacaca ttaggcaaag ggccaccttt agccatactt     10440
     aaaattattt ttagattaaa aattacccca ccccgaagat gtctttctgt aagaactggg     10500
     cttcaccatt tctgaacagc ttgtggtcag aaacatccga aacctggcaa gagaaccaag     10560
     aagattggag aattgtcggg acaaacccat tcaagaggag atcggaaaat gcatgcaaaa     10620
     tagaacgaat aattacggat cttccttcaa aacaggtggc cgaaggtata gaaaactcat     10680
     ttaaattcat gtcaataaca cccgaaacac actattatat tatacagttt gaaagcaaaa     10740
     gacttgatgt tgcatttgtg gatgctaata ttaatgtcaa aaaaaattct tatgtgatac     10800
     tggaagctga taggggagaa gactgtggag ttgtggttgg agtgaccaca aaggataaac     10860
     ttgaaaaact gtttaaaaga tatgatgaca tctctaatga agtccaacct aaaagaatat     10920
     acagactggc tacgcttctg gatcttgagg cgttggaaag aaaaagaagc atgcaagcaa     10980
     gggccttaga gttctgtaaa gaaagggcta tcctaggcgg gttagacatg gaggttgtcg     11040
     gatgtgaata ccaatgggat ctcaataaga ttactttcta ctttgcaagt gatgagagag     11100
     tagacttccg agaattggtg aaggagcttt atcgagtata taagacgaga atatggatgt     11160
     gtgccatcga aaagtccaaa aataagtatt tgaaggagct tattgaattc tagaattgaa     11220
     ttctctagcc caagattttt gtaattaaaa cccgataaaa tatttctgta taatttctta     11280
     tctcaaggtc tagctctgct tctgcgagat tagaaatgga aaagttatta tcttatttaa     11340
     tttttggact gatccggtgg caaaattatc acttcattaa tcctcaagat acttattgca     11400
     gcctcggttg cagcctttaa cgacttcatt ttgttcatac tgggttcgat aatgccaaac     11460
     tcaaagttgt tttgaatctt cccactcgtt acatcaatcc ccagaaacct tgtttccgaa     11520
     gaactctcta tctccttggc ttgagaggac agtagacctg cgactatctc attcgagtct     11580
     agacccgcat tagtggctaa aatttttgga attgacagaa gtgactcggc atagcggtgg     11640
     atagcaacat gttccttgga attgacggta aatgcaaact tttccagcat taaggacagt     11700
     gcacactcaa ccgatcctcc tcctggaaca acactaccag actcaagggt ccgtctcaaa     11760
     acacaaatgg catcatgaat cgacctttgc atttcatcaa gaagctgact attggctcct     11820
     cttaggatta tcgatgccat cttcttctta agtccattaa taaacacaca ttcttcttca     11880
     ccaatcgata caacttcaaa tttatctgct gatcctggac ttgtgatatt gtcccctccg     11940
     ctcaaatcag aagtagaaga caccaaactc gttcctattg ccttagcaat aactattaaa     12000
     tcttccttct tgcaccttct aatcccaacc acacctgcct caagtaagat cttagtgcac     12060
     atgtcgtcaa tgcctctcgt cgtgagtatt acattggctc cagaatcgat aattgcctta     12120
     acttgctttc gtgtgatttc tagctccttc tttctgattt cctccagttt attgggattg     12180
     tcgacaacta tgtttaccgt caggggattc ttatatttct gaagtccaaa gtctatgcaa     12240
     aggatcttag gcttcttgat ctcccttttc ataaaattag aagctaaaga gcagttcaaa     12300
     gcatatccct ggtgcaaaaa tgattccttc atagaacccc ctgggtgctt cagaatattg     12360
     atgtcttcta tgggatacat gttctttttg tcttcggtgg atgactcgat acacttcaat     12420
     gcatctataa caatctcaca gaatagttca ctttctgagc tgataacctt gctagagatg     12480
     cttgtcttta caacatttct taatgccttt gaccccaaat tcaaggtact cttggatata     12540
     cttttcttaa taaactgcac acattcatta aatgccatct tgtatccaga aacaaccacc     12600
     gagggatgaa ccccagatgc tataagcttg gctccttttt caattagact tgcagctatt     12660
     aaaacaacag atgtggttcc atcccccact tcatgatcct gatgtgttgc cagatccaca     12720
     agaatcttgg ctgccgggtc gtccacaacc atactctgga ggatggttgc cccatcgttt     12780
     gtaatgctga cctccccagc tgaatcaaca cacatcttgt ctaaccctag aggtccaaag     12840
     cttgtcttta ttgcattata taccttcatc attgcatttg catttttttc taccgcagaa     12900
     gctccactat aactctcgcc acctgacagg atatccgctg tggaaatctc cttgttcatg     12960
     tagggtaaat tttttgggaa attatacaac tcgaatacag tctgaggtat gtaccctatg     13020
     cagatatcgt aaccccaatc acagaattcg tttcctatcg tatctttgaa agagtaatat     13080
     ttccaagtaa aaaatttacc ctgatgtggt ccaaaatcga agagaaccag acagtggaga     13140
     tgacagtaaa cctaaggaaa atatgcaccg ccattccatg gtcgaaaaag gcgcccaaag     13200
     ctgttaaagc actgaaaaga gagatacaga agcactttag ggaaaagatt ggggtggtta     13260
     taactagcga tctcaacaac ttcatacatt cacgcggaag caagaagatt ccaaataagg     13320
     ttagagttag agtcactaaa gagacaagct tgaagaatgc ggaggagaat gtgctaaaaa     13380
     cagatttagt cgtggtagga tctttcaaga accttaagga ggttattgtc gattaataaa     13440
     tcgctcctaa tgccttagtc ttcaaaatgt ttagtgcttt tttgaagaaa attgaactta     13500
     tgcacggtcc aagagaatgt tctttccctt taaaatgaaa atccagggga aatcacagtt     13560
     taaatgaatc aaaaatcact tattctaaat tcgaacccct taaaacaaag tgcaatgatt     13620
     agactaaaac cacataatag tctggtccat ggcgtggtcg aaatctttag gaagtatgta     13680
     ctgaacagga cctatctatg cctcatggtc cttccaatag tcttactggc aactactgca     13740
     aacatcttgt acgattatat accatcagtc ataatcccta gaatagcgga acacataaag     13800
     gcaaatgacc ttgggcttca catggactta gcttataagt ttttcttcta tgggttgcta     13860
     gcaacggtct ttgaatattt ccctatattc ctgatggctt tggtaataca agacatatac     13920
     agagattgct acagagatat tttcatggaa tacatatcat tggaatacaa tgcattccat     13980
     gatatttctc caggggatat ggaaggtagg atatatagaa aatgcaaagc tgtaggggaa     14040
     gctgtcgatg tagttattcc taccctcatg aattcaacca tatttgtctt agttgccatg     14100
     atcgatatat atagaagctt tggagttgtt gtatccttga tattcctgtt gataccgata     14160
     gcttatattt ccatcactgt cttcctaaca tcgagaagaa accgtatcag aggaaaatat     14220
     aacgctgcaa aagacaaatc aacaaggaaa cttagcgata ttttgaacaa ctatgaggtt     14280
     gtaaagtcct ttgggcttga ggagagggag tccaagaaat tctgtatttc gttaagagat     14340
     cgggtttcaa tagggactgt ctatagctgt tctgaaaatg ttatcacttt actacaaaaa     14400
     ctttcctcgt taattccaca catcgggatt ctctatcttt ctttaaatac caatatcctg     14460
     acttttgaaa aggccattaa gttgaacagt cttcatttta tcctaaaaga aagattaact     14520
     gagtttgcca aggagtttac agagctttac gagtactatt atgattattc tacctccacc     14580
     tatgaaaaag aagaggattc tttggatcaa gttgatgtca ggggattcga caaagacata     14640
     gtcatcagag atgtaggaat ccaaagagga gagaaggtta ttctgaaagg aataaacttt     14700
     acattgcaca aaggagaaaa actggctatt gcgggcccaa acggtgcggg taagtcaacc     14760
     ttcattaatg cacttctgag gtttctggat tattccgggg atatattcat tgacggggtg     14820
     gaaatgcgga gatatacgag aagatccaca agacatataa tggcgtatgt gccccaggac     14880
     aattgtattc ttgacgacac aattcttaag aaccttcagt atggaaacaa agacatctct     14940
     tttgaaaaaa tcaaggaaat ttgcaaaaaa tacggaactc atggagtatt tagcagtctt     15000
     gagggaggat atctaaagga ggcagggcag caaggaggag aactaagtgt ggggcagaag     15060
     caatatttga gtctaatgag agctataatc aaagactccc ctattttcat tctggatgag     15120
     gccacctcag acgttgatca tcaaacagaa accgagctga ttgattatgt tatgtctgtt     15180
     cttgcagaca gaacaataat aatgatagtt cacaaccatt ccctattgaa aaaatttgac     15240
     aatatcttat tcctaaagaa taagacaatg aaaggatatg gaaatataag ggagttactc     15300
     aagtcatcgg aggattttgt tgacttttat cttggtgaaa agtctgtctt agatacagga     15360
     atccaacctt aagataggtt tcataataga atccagcttt gaataaatcg ttttagtgaa     15420
     gtagtgactt tctgtgaaga tcctagatgt tgatgggatt tattgcttaa acttcaagcc     15480
     gtagagactc gacttcgtaa ttgtatacag acaaccagta tttgtgtacc ataatgaatg     15540
     tgcagaggat aaagaagtgg tagaaaaaaa gattatcgaa gtatctgtct gtcattaggc     15600
     ctatcaccct tgatcccaaa aatgagaatg tatttgcaat tagaaagcat gcagttgata     15660
     tgattagagt cccatatgcc cacacttctc cgtctgtctt tctaagtctt ttaacctgga     15720
     atatcatata caggaagaaa aaaagtggat tcagaacaaa aaatggaacg gatgtcagtt     15780
     ccttgctcga cgtgcttaga cctgtgaata taactgtccc tattcctaca gagtagatgc     15840
     ctgtcgagat cttcagtagt gttgtagccc caagtccaaa aattcttgta aacatgtcta     15900
     cagttatgct tccaacaaaa agagagaaga atgccgaagt gtacaatgat agttgaatgg     15960
     aagtgagaaa aagatgtgtg tgttttgaaa taaattcttt ggagccaaca agcactgcct     16020
     ccaacgctgc tgatcctaaa tatagataaa aaaatacaag catttctttg cgtcccacag     16080
     aagagcatag agcttttacg tgcctaatca ttctagtagc agatagcaag gctataataa     16140
     ggagaattac agttgtcggg gaagacacct tggttttgaa gaaaagaaat cctctgcttg     16200
     tgcttttgca tatctcgctg ctcagatgct cgcacattgg aaaactggct tctgaacata     16260
     ctctatctat cggatgcatt ttctatttga ataaacaaag gaaattttaa gagacgaatg     16320
     ccctgttttt tatgttcttg aattcaagcc ccaaatatgt ctacaacaaa acaagaaatc     16380
     cagagccaga tggagcatgc cgataatctc ttcgtggaga tgaacaagaa aatggaggcc     16440
     cttaagggga aacttctaag cctatcgaaa atggtagatg gtatcaacaa gaagatagaa     16500
     gatatctccg cagagtcaac aggctaaaag taaatcattc cctaataaaa ttaacttgca     16560
     tgtgaatcta ttttatttta gagcggttcc tgtggcttgc ttaactcctt tatttcttct     16620
     ggctccttaa tgctcctttt cgcaaagtcc tgagagtaaa gatgctccgc gttgtccaga     16680
     gacgacttta gttctgcaaa gtccttaatg tttatttttg gctggatgct tctgaatctg     16740
     tcgtgggcaa ttctggattc caatgaaatg atctggctag ttggattctt ccacatggaa     16800
     acacatttaa acagtttgac ttttgactta tttctaaagg gcttttcttt tatgtctttt     16860
     ggtgcttctt tttggtcttt tttaattcct cttttgcatg ttatcttcaa tggatcgggg     16920
     cttactgcta ttactcttcc atattttcca tctcctatct ccttcactcc catcgcccaa     16980
     acaatgggat tatagaaatg atctatattt gagcttccca atctataagc agacaattca     17040
     tatccgggaa tacccgaaga attacagaga agtaagcact cagcaatcct ctatatttga     17100
     tgaccttaaa aaataatccc caaaacatcg gaaatgaaaa caaaactgtt tgcagcacca     17160
     acggagcgtc aactacttga agaaatgaac gagtctctta cgaagtcgcc tgtattaacc     17220
     agaagcgctg tcaaggccct caactcctta ttttatatgc taagcacaaa gaaattgtcg     17280
     gaggaaacca tcagaaatgt gtatataaca cttttgaaag gatttcaatc caaagatctt     17340
     tatctaaagc tctgtatata ctctgcgata gaagaaatgt ctaaactcac taacgaaggt     17400
     ctggttggga taaacatact gatgaacgac ttaaatggaa agattccaga cgatgttaaa     17460
     gcaatggctt taagaacatt gttttccatt gtacctgatg agatggtata cgactttgga     17520
     aagtatgtga atcaggcatt tatctctacc tcgcaggcca gaaaagatat gtctattgtt     17580
     gtagcatata agcttctttg cagtaatttt acacaagtga aaaagtggct ggaaggagtt     17640
     gaactttctg gaaatccctt aatggactat cacatcacag gttttctggc acagtctagg     17700
     aggctccact tgagctcggt ggaacattct agaggccctg caggaatcat tggggttcgg     17760
     atggttgtcg attcaatgaa ggagaacagc gaagctcttc caattcttag aagattcctt     17820
     aactcaaaat actgcgacga gatgatattc atggaagcag ccagggcagt ctccggcctt     17880
     agtgaagagt atgggtctca gtttgttgat caagcagtcc agtccttacg aatattcctc     17940
     aagtccacaa atatagttct acagtttagt gcaataagaa ttgtttctca gcttgcacag     18000
     aagtatcccc agaaggtttc tgttgctaat aaagaaatcg aagatcttgt gtcatctgag     18060
     aacaaatcca tctccatgtt tgcaattact tcactcctca agacaggaac ggaggaaaca     18120
     atagacagac ttgtaagtct aattccaagt atggtccatg atatgggaga tggatttaag     18180
     aaaattgcca ttgatacgtt ggagtcttta agtaatcttt ttgagtcaag gaagtttcta     18240
     tacgtcgatt ttcttggaaa ctcacttctg caaagaggag aacttgaatt caagaagtat     18300
     ataattgagg ttatttcaag agctgtaaag aacgacggca tgagagaaag gattcttgag     18360
     attctttgca catacattga ggattcccag tactaccaaa taaccttaga tgtccttgga     18420
     atacttggac aagaaattcc taagtctagg gcgcctagta aatatgtggt tcatgtattg     18480
     aacagactta tcctggaaaa caaccatgta agagcaggag ccttgcagtg tctatacaac     18540
     atctcttctg ttgtttctcc atcgactgta gaaaatgcaa tgaagagatg tcttggcgat     18600
     caggatgaat cgataagaga aacagcagcc tttttattaa gaaacatgaa gctggaaagg     18660
     tcgtgtaagc cttttagtct ggatgagctt ggagatctca agggtcgtgt gcttcaacat     18720
     attggaaagt cggatgagga tgctaaagca gaaagagata cactgataaa gaattgtaga     18780
     gagttgattc ttactgagcc taatgcagat gtacagatca aggttatcaa gaaggtttat     18840
     gaggacaaaa taattctcga attttcattg gaaaatagtc ttgaaggaat acaaatctgc     18900
     gatggtgtgt taaatcttgc aagctcggat ggtgaagaaa gaaacataag tatcaagata     18960
     gagcagatag agcctttggg gtccctcttg attgcaagag aatggaacgt aaaagagggc     19020
     tgcgtcatca atggagcatt tgacttcact atttgtatgg aaggggacat gtcagacaca     19080
     gaaaccgatt ctatttccct cgagcccttc caaataacca ctttggactt tgtaaaaccg     19140
     gccagagtaa agaaaagccc gaataggaga aatgaaatct cctttaacct acaaggagat     19200
     atctacacag caggaaaaaa aatcttggat cttcttaaca tgaagataat cagccaagaa     19260
     tctgaaagta gcacaatgtc tatggtattg aatggagaat attacgaaac cccggttatc     19320
     atacacgtaa agttggtttt caacgtggct tgtaaatgcg ctattgaagt ctattgtgat     19380
     aatgagcaag tggcccagaa gattgttaga ctgttcgatt gatgaaaaac ttttagtata     19440
     cggctgggta ttaaatatcc caacctaaat ggacaaacac tgaagtcttc tattagttac     19500
     tggtagaagt tgcttatggg taataaaact ttaatggtct atagttctct cctggggaga     19560
     tgaccatgta ggatctcgtc ttctagcact gatccatcgg ggacataaat ttcctttttc     19620
     tcgtccacta atacgatgat tgttccttta agaactacat tctttccaaa tgtgatattc     19680
     ccactaaccg tcaagtgatc cagctcaaga atgtcaggga tccctttaaa gcatttttca     19740
     taactctcta tcttcgaaaa gttctctccc tctagcttaa ccacagggca tgctcttggg     19800
     actctcgatg gatgaagttg tagagtacca ttcttctcga caaacaaatt gctctcaaca     19860
     agaaataggt cggagcaagt cttcacagga agaaatctag accggggaac cactattccg     19920
     caggaatttg gaaagtactt gattgcagat cctatggctg tttctagttg gataaccgtt     19980
     tccttaccta aagtcttttt attctcgatg atatctagat caaaaaatcc ttcttctaac     20040
     ttcttcttca tgtccttcaa gttgatccaa atattgttcg tgttgaatat tgtaaacttc     20100
     ctgaagttgg taaactcaga cttcttgttc gatggaactt gagctatctc aaggagtctc     20160
     agtgctcctt tatactctat aagagttccc cccttgacat cggcacgtgt tttatcagta     20220
     acctccataa gaaatcctaa gttattagtg gcgaagtatt ccagtagctt tagatcgact     20280
     gtggaagcta ggttgtcaat gttagacaca aaaagatatt catatccttc atttagcagt     20340
     tcttcaagca ttccactgtt tttcaatgag tagaataaat ctccatgtcc gggcgggtac     20400
     attcctttat ctccgtatga agacgataca ggaagtagtg tttccgatga aatcctaggg     20460
     aatttacttt gtgagaactt cctgattcca tcatatcgga atacaatctt ttctgtcatg     20520
     cactcagtat tgaacgaatt catcagtatc aacggaactt caatgtcata cttggtgttc     20580
     aaatatctca tctgcttcac aactagatct atgaaattct ttccatcctt aattgttatg     20640
     gcactttttg gcccattgca tcccattgtt gttcccaacc ctccgttaag cttcagcact     20700
     gccagcttct tcaccaactc ctttgatttt tcacttggat cgggtatatc gctatactga     20760
     ataatcttgt cctttggaga tttaatgtct tcccatacta tcttttcgct tctagttctg     20820
     agatatctct caaatagacg atagaattca tttaaatcga taggattgga atgtcttttc     20880
     ttcattttct ccaatatctc tttcatttcc ttcagaagct tgcaagtaca cttgtcgtca     20940
     aactcatcta gagacttatg gaagtcttta gcttcatcac cagaaagcgt tgtttccttc     21000
     ccattttctt cttgcatatg tcttttctcc tccatttcct ttttatatag tcgtttcatt     21060
     tcgatttgtc aatatcaatc tttctgttgg ctagaatatt aggaattaac aagatgtcag     21120
     agttagtgca atggttggat atgtagggaa gtttgacagg aatcttccat tttacaaacc     21180
     aagaataagg ggaattttat ggaaccaatc aaaggctgct cttcagagga actgatgaga     21240
     agtattttat tagtataatt agaaaggttc ctcattcctt cgttttttgt tgccatcttg     21300
     atccttactc ttatttttgt ttgagaagtt gggtgttagt actgagtaag atggactcgt     21360
     tggagaatat gatggactcg tcggagaata ggaagggctt gtaggggagt aagatggact     21420
     cgtcggagaa taggaagggc ttgtagggga gtaagatgga ctcgttggag aataggaagg     21480
     gctagtggga gatagccttc cacttaggtc tctaggatat gccatttcga gatgtgttgg     21540
     gctccagttc ccgctactaa ttgagaagga atctgatgaa ggagtactaa tcaccggagt     21600
     tacaggctca ttaggcttga acactggatt agataatgga atggctttat ccagtttctt     21660
     cacgtccagc ataatctcga catttccagt ccccatgggt gctagctgcc ccatcatgat     21720
     gttctccgtt atccctctac ataggttctt ctccgaaact agtgctgcat ccaaaaggat     21780
     ttccaccgtt tcttcaaacg agcttctttt caacgcacca gccccaacct tattgacacc     21840
     gtgacgagtt attccgcaga gataccccct catagtcatc acatcagcta gaagactcat     21900
     gtgtcgatag ttgacataag acccatttcc atctattact atggccaact ctcttaagat     21960
     agattctctc gctgcctcta ttcctaaggt ttctgcaatc tcgatgagat cattagaggt     22020
     tgtaagctgg ctgttaactg aagggtttcc tagaatttgg gggagacaga tcccgtcagt     22080
     ctgtagatac cattctttcc gattcttgtc ctcactaata taaaccttct taatgttttt     22140
     atatcctccc aactgaaact tcagcagaga gttcaatact accatgtaga agtttaaaga     22200
     ttcgtcttct gattttgcaa tccggattct tatcaccata tcaactgcgt tctcatcact     22260
     gcagatcaca tgggctccat tccccaactc cttgctgata aatgttgcaa catattctag     22320
     gtttattcct cttccaacaa gcttagctcg atctacaaca agccttatca agaagggtgt     22380
     cagggaagag aagtccacgt catcgtctgg aaactcaaag tacgcttcta caaagtcctt     22440
     gtcatctgca atctctgtac ttgttatttc tgggtcataa tatatttcgg aagagaggca     22500
     caggtccttc accgtaaggc actctatctc attctggatt gtctttgcca attcaattgt     22560
     tttacagtgc tccttatcaa gatatatctt catggatggt gttttcaagt tctttgttac     22620
     attaaaaatc tctttgagtc tagggactcc catagtcaca gtggaagaaa ccccggcaag     22680
     gtggaatgta ttcagtgtca tttgtgttgc aggctctcca actgactgtg ctgctaatgt     22740
     ccccaccatt tcgtttggcg ttatcttagc ctttagaatc tttgcgcgta tcatttccac     22800
     tacccaattg aatgcctccg tatttagctt gtgctcaaga aggattcttt ttacactcaa     22860
     attggttctt atgagtacat tcagaatttt gttggaagtc ataaggttct tatgtgcctc     22920
     aagtatgtaa taaggagaaa catctccggc cgaaagatgg aattctctct ttgccgatgc     22980
     tagcagacga gtcaggttgc aagggctcat cacagcattt tggtaaatgt ctttgactcg     23040
     atagtcatgc tctatgtcta tttctcctat agaagatatt ggaggcccct caaatatctc     23100
     ctcgactaac cactcatact cttgatccag gagcttctgt agatcaacgt cagagcaaag     23160
     aattccgtaa acctcctccg aaacttgtcc ttgcttaatt cccaactctc catttccaaa     23220
     catatcaata taataccttt ttgtaaaatt ttttacatcg accttctgtg actccaagaa     23280
     agtggcatca aatccgtctt ctccatattt tacttggtat accagtccat tcccgctcct     23340
     gacactttca tcttgcctta caatggcatc ttcaagcgct ttcacaagtc ttctttggat     23400
     atatcctgtc tcggcagtct tgatggctgt atctatcaaa ccctctcttc ctcccattgc     23460
     atggaaaaaa aactcctcgg gatcaagacc tgtcaaataa ctgttctcaa caaatcctcg     23520
     actttttcct gtatagtcgt ctttgacaaa atgtggaagt gtcctctggg aaaacccaaa     23580
     aggaatccgt tttccttcaa cattctgctg tcctacacag gctgtaactt gtgatatgtt     23640
     tataaaagac cccttcgatc cagcaaggac catggtcttc atattgttat ttccgctgag     23700
     gcttctttgt gcacttgttc cacttacatc tcttgctctg ttcagtacaa ggtttaaatg     23760
     gctttcaaag ctttccttca tcgtcattcc aggaagtctt tcaagccgat tttgacgtgc     23820
     attttcaatg attatagaaa cctcctcctt agcctttcgg atggcttcat caaccatctt     23880
     taccgttttg gcatctgcaa tggtgtctcc tattcctatt gaaaacgtat ggattccggt     23940
     catgaaaata ttgatcatct tctgaactcc attgaagaac tgggctgctc tttttggccc     24000
     aaagtcgttg aatattatgt ggataagtcc tccttgagtt gctcctgctg cctttttatc     24060
     aataactcca gagtgaatat acccattctg tataataact ttggtgtcat tgatgttttc     24120
     attgtcatct tcattgtgtt ccgaagaaaa tccggtatag tttaggtttg gaagtacaaa     24180
     gcttagaatc tgctttcccg tccaaagctt cataggtttg gctattgctg gattcttcag     24240
     caccttcata atatcgtagt cctttgttct attcaccccc atgtaagtgg tttctccagg     24300
     agcagtgtca ctaaactcta tattcactgc atacaatagc agcataactt ctctttcgtt     24360
     cagaaaggta tcccgaagag taaacagtct cagacccgta agtgtgtcct gcacaatgcc     24420
     cataacaggc ttattggatt gaggagaaat aatttgctta gatacaagag ccagctcctc     24480
     tagttctgcc ttggatgtat agctctgagg catatgaaga ttcatttcat ctccgtcaaa     24540
     atctgcatta taaggagatg tgacactgag attcagcctg aaggttttgt cccccatcac     24600
     cctagcataa tgtgccatca tcgacatctt atggagcgaa ggctgtctat tgaagagaac     24660
     aacatcccca gattgcatat gtctttccac aatatacccc tcttctagcc ttatgtcact     24720
     tctattgaag ttcagatcga tcttctgtcc atcagaccta agaacatagt tagctcctgg     24780
     atgctcgttg ggccctgctc gaacaagctt ctccagctta tctatgttga atgatgtaac     24840
     tctttctgga aaagtatgga tctttgccac ttcaagagga actccaacct cctccagaga     24900
     tatgtttgga tcaggtgtta tcaccgtcct tgcactaaag tctactcttt tccccataag     24960
     attccctcga atccttccct ctttgccctt cagtctagct gatagcgact tcagtggcct     25020
     tccactcttc tgtagtgctt gaggctgtcc tccaagctca ttatctatca atgtggcaac     25080
     atggaactga agtagctgtt cataatcccg aacaatgtgg cctggtgctc cctcctgctc     25140
     atatttcttt aaatatccat tggattttat gatgtctgca agcttgtgcg taagatcgtc     25200
     ctcccctctc aatgagccct ccatcacaat cgaaggcctt actgccggtg gaggaactag     25260
     caatacagta agtatcatcc actcgggcct gctatacttt aggtcaaacc ccatataaac     25320
     acagtcctca tcgcttatct tcttgaatat gctatacacc ctttccccat tcagcatcac     25380
     ttttccttcg ttgctttctt ctcccttcat gaaagcaaca agagttaagc cctccttttt     25440
     aataacaggt tgtctgttcc cacagccgct ctttccattg tcaagaatct ctccctcgca     25500
     taccaacttg cttttgctca tgctccatac attgttcaac gtcgacctta ctcctctttt     25560
     tgatactttg atcttggaac agtagaaaca aacacactcc aaaaccttct taatcttgga     25620
     aatataacca acatggaaca tgggcttggt aagttcgata tgtccaaagt gacctggaca     25680
     cgagaagtta tctcctccac agctttggca aagatacatc ctatctgttg ttcccatcct     25740
     cagatctatc aatcctccag tctttggaac tcccccttcc atgacctcgg gatgcacaat     25800
     taaagcaaca cttccattcc ttatttcctc tggggaaaac agcccaaact gtattgactt     25860
     gatctgtttt tttactttct cctcaaacat caatggggtt tagtccgatg gcctttaaga     25920
     cagaaatttt tgttgtattc cacccccaga accattgcag ccagacctac cccttctaca     25980
     ttatcatctt atttgattaa tggtttgcca ccacacattg tacagaacgg cacaatattt     26040
     ttagtccaaa tgccttccaa gaagatagaa agcaggagac acaaacaaca taaacttttt     26100
     gtctccttta atagaccatt tctcccttac acctgagtct actcgtcaga cgatatccat     26160
     tcaaattcct tctctattct catcagctct tcatctgtaa tattatactc cactccaata     26220
     aactctgcaa gctcttttgt gtttttgtat ttcattttat ccgaaataat cttgcagcat     26280
     agctcaagaa gatatggata ctcaaggtag tttgctccat tacacacatc cagcagcttc     26340
     ttattgtcat actccatgaa aaaattcaag tctgacggct tgaatcttat ctccaatgga     26400
     ttatagtctt cggatagttg ggaagtatct atctccatgt acttttggat tatctcgaac     26460
     gtagacgacg agactttaag agaaatggga tatttgcaca ctgttgatgt gcatacgttt     26520
     tttatcagaa cgctcttgta tgcttgtttt gtatctactc taaatatacg tccatcactc     26580
     gtctccactt caatcattct gggcgaggtt ttggggctaa aaacaacaac agagagagat     26640
     gcacaagaca caggaaagga acatctgtac cgtgccaaac ttggtctctt cgtggactct     26700
     taattctgtt tccacctgta agggcttatg gacaaaagaa ccaggatagg cataatagga     26760
     gacgaggaaa cacttacagg gttcttgata gcaggagtgg aaaatgttca tgacaatcca     26820
     aaccttatcc aagtaactcc aagtacaacc gaagacgatt taaagagaac cttctacaca     26880
     ttgacaagca gagaggatct ggctataatt cttgtttgtg actttgcagc cgaaaaaata     26940
     aaagaggaga taaatggata taaggaagta atccctgcag tcttggttat tgcatcgaaa     27000
     aacaagtatg cctagtttct gtatggacgc aatataataa aactttctga aaactaattg     27060
     ttttctttaa agcaaacaca aataaaggag acgatttatt tcaacgataa gacttttggt     27120
     atcttgcacg agctccgggt cctccaaact tctttggctc tctctttcta gaatcggcaa     27180
     caaggctaaa tctgtcgaaa tccaacagtc tcttttggat ttcttgcttc ttccattcat     27240
     cgaagtaggt tccatagaac gcaagtattg ctttggaaaa ggccatcctt acagcataca     27300
     cacgggaaac ttcaccgcca atcttgcatg ttatgtcaaa cgaaagatcc ttgatgttgg     27360
     aatgctcaac aatgcatatg atttccttca gctttgcaat cattaaggtg tttgtgatga     27420
     gtttgaaggg aaccttgtta attcttatgg aaaactcccc agaatacgtg catacacatg     27480
     tagcaactgc ccgcttcttc ttaccctggg tggtgactga ctttacagat ctactcattg     27540
     aaagggctaa agcatttaaa aatttttaac cccaatgaaa ggcaaccgca tactgccaaa     27600
     caaccatttc cgcaagactt ctctcaagat aaaggtccac cacgatcccg agacgaagct     27660
     caggattatg aaggagaaaa agattcgaaa ggccaagtca ttgtttccaa tgcctctgga     27720
     aaagctccga cccatagtta ggtgcccaac tattagatat aatagaaatg aaaggcttgg     27780
     aaggggcttc acagcagccg agtgcaataa ggcagggctt gactacaggc atgcaagacg     27840
     tcttggaata gctgttgacc ttcgaaggag ggataccaat caagagactt tggacaagaa     27900
     tgctgagcgt atcaagacct atttgagcaa gattaccata tacgaaagca ttcaagaggc     27960
     aagagaaaaa ggtgccaagc cgtatgcaaa ggagatcatg cctcttccca agaccaagcc     28020
     tgttgttgag tctatttcaa gggaagaaat tgcttcttat gaataaattc gatttttatt     28080
     tagatgggtc tcttttataa agattctcgt ttctgaggct ttttacggaa aaagaaccat     28140
     caaagtttcc atttttgagg tgttgtggcc gagtggtcta aggcgacgga tttgaaatcc     28200
     gttgaggttt cctctcgctg gttcgaatcc agccagcatc gctttttgag cattccgtgt     28260
     ttgtatgttc gtcaaatata taaattgaaa ctcttttccg tatacacaaa aaagaatatt     28320
     ttcaggtgat aaggaggcca tcatattagg gacatagggg aagatggaag accagaaaat     28380
     aaacttagtg ctggaatctt tgtctcagat agaagaaatg atggcggaaa agctcggcgt     28440
     gggagatgtt gaagaaataa gaaggagagg aggaattgtg atgaaggcat acaactacag     28500
     cgaattcaag gaaatacgag ccttgaatgg agttgaaggc ttgcacaagt tgggaaagca     28560
     gtatatactt aacaaacaaa ttcaagggaa aagcggctcg tctctgtttt ttacaggaaa     28620
     tcttcggttc attataaaga ccataagaag gtgcgaattc ctctgcatcc gaggaatgat     28680
     ggaggagtac aggaagtata ttcttgagaa tcctaaatct ctcttgtgca agatacttgg     28740
     atgctatagt ttatacagcg aaggcaaaga ggagtatttt atagtcatgg aaagtatgct     28800
     aggaggactt gggatacaag aggtgtacga tcttaagggt gcatcggtaa aaagaaaagg     28860
     gtattctatg tctagcctga aggaagtgga ttggattaga aacaaaaagg gaatccatct     28920
     tggaaaccgg aaggaagcta ttatatccca gataaaaagc gacgtaaggt ttctgagaaa     28980
     acatagaatc atggattata gctttcttgt atcttttaac tctcggggta aagaagattt     29040
     tacttcgctt cccagaaaca gttatcacag ccacacttcc gaggataaag acatacgctt     29100
     tggaatagta gatattctca ctcaatggac cttcacaaaa agaatggaga ggttgttcca     29160
     tatattctgc tgtaagccaa acagttcttg tctgaatcca gatgcatata tggataggtt     29220
     tttaatgatg attgagtcga atattttcaa gtgacaagtc tttagaaaga acaaatcaac     29280
     atcttcaaaa catgagtgat tgagtagaac tctcaagtcc ttgacttcga catttgggag     29340
     ataaaatcct atttgtcttt gtttgagtat aaacagcaaa ttgaaaccag aatcaatccc     29400
     aaatgggaaa ctcaaaagat agcctgagga gaaagataga agaaaccgaa accctacctg     29460
     aaaaaatgaa caaagaagat ggccatgaga atgaagaaac agagataatg aggaataaat     29520
     atctcgagga gacttgggac ccaagcgggt tcaagaaaga tttagaaaca tatggagaaa     29580
     aggatattat gaggtttatc aagttcaata ctggagggat gagagggctg atgaggagtg     29640
     gattcaatgg aattaatgag gttacatgta accttatcgg aactgagcta tgcaagagat     29700
     tttctagtat tgtgatagga tgcgatggaa gatataactc attgaattac gccattctac     29760
     taagagagat attcagaatt aatggaaaag aagccagcct gtatccggaa gtggtgaccc     29820
     catttcttgc ctttcttata cccaagcttg gggccagctg tggagtaatg gtcacggcat     29880
     ctcacaatcc aaaggaatac aatggcttca aggtgtatac atctaaggga agccagatag     29940
     gaccaccact agatagggaa atagaagact ctatgaagat gcttgatttg acagaactcg     30000
     ataaagaggg agagctttca aatatattca gtcgaatgaa ggaggagaac aatgccttaa     30060
     aggaaggaaa gacgctcctt tcgggaagag ttgcagatct agtggatact aatacttggg     30120
     agaggagtaa gcttatagat gcctacaaca gatggatgtt tgaaaattgg ggcgatgaaa     30180
     tagtccaacg gatccgaaac accaaacctt tagttcctat agttttcaca ggactttgtg     30240
     gggtttctgg ggagtttgta aaaaaagctc taaagttcta tgggttagac ggcttggtgc     30300
     attttatcga agaggaatgc attccaaacc ccaattttcc aaggcttcct ttcccaaatc     30360
     ccgaggttac agaaactctt gagcagtcta aggcatctga tctagcagat attgtatttt     30420
     catgcgaccc ggacggagac agatttgggc tttccgaaag gatcgatgga gaatgggtcg     30480
     actacaacgg aaacgagata gcagcaatgt tcatgtactt cttcgttgag aattttgaac     30540
     catcgagcct tgcctttgta aatactcatc tgtgcaacga ccttatggaa aaggtctgct     30600
     tggaccacgg gatcaaatac ctgcgtacag agacgggatt caaaaatgtt agccgagctg     30660
     ttgattctgt tgaagaaaag aaggtgtttg cctatgaaga ttctcttgga tttctgtttg     30720
     gaaatggaaa ggaaaaagat gggatcaaat gtgtagttct tatggcgcat atggttcaga     30780
     aagagcttcc aagccagatc ctgaagaaga tggaaaggta tggaagcttc agttcggtaa     30840
     acattcatgt gaggtgtgct gatcctggaa gggtcttaaa acgagttctt aagaagcttc     30900
     caaatgtaaa aacagaagga aagagaagca tggtggaatt tagtgactac aaggtaacat     30960
     tgagaataag cggaactgag tctatgctga aaatttatac aagctctaga caactggata     31020
     agaaaggtct tagcaaagcc gcagaagatt ttactaagaa gtatgtcagg gacgaagtac     31080
     tctaagtcta ccaacttcta ctttggagca agaacaactc gaagagatca tgtatcttct     31140
     gtattaaatt gttttacttg agccgtggct tttttggcaa tgcttgaacc agccaaatct     31200
     tgtagacctt ccacttgctt tatggcctaa cactatccat ttactgcaaa tcgtacagaa     31260
     tccttctgtt ctgtttccaa catgtcttac ctgaggctcg ggatacctcg acccttttga     31320
     gcttattcca tgcttatagt tcatatgata ccaataacta cttgttttta atttgagcca     31380
     caagttgcac atcccacaat atccctccct caattttccg gctcccctaa ctttcttggg     31440
     cttgtatata tcgccatcct ctggttgtct tttgatctcc ctaggccatg gagacagagc     31500
     tccgatggca tcaactgtga tttcccggag caggtcatta ccatttaatt ctgtaggaga     31560
     gtagatgtcg tccaactcat agaactcccg aggatccaga agtacctcgg acacataagg     31620
     ggtgtccagc agtaaaaact catccagata aagtacactc ctactcgaac tcattgtatt     31680
     ttatgcttgt tggaaaataa aagttacatc tttagattta gattcaccta agaaaatgaa     31740
     tggatattga tcctgggttt ctgggaaaaa aaagctctcc caccgggatt cgaacccggg     31800
     tcacccgcgt gacaggcgga tatgatatac cactacacta tggaagatgc taagcaaatc     31860
     caggaagccc aagtctcttc ggaaacccag aaacatttca gacaaaatct agatcacaat     31920
     cccatagaag tagtcagaga ccatatccct ttacctttag atgtatcccc tgactctctt     31980
     gagaatatca agaaacaaaa tagtagagct ggagctgaag aacaacgatc atttgagagg     32040
     gctcctttac aaatgcgata tggcaatgaa tctccatctc aaaagtgtta ccatccagaa     32100
     ggaagacggg agttctatct tcattaatga gtgctatcta aaaggaacat ccattaagct     32160
     tgtgaagctg gaatcgaaga ttctcttgga acaaagagaa gagagtgtgt ctagtaataa     32220
     aatatgacta atttttatct ggtgaagatc tccactgcca aaacattcct atgaacgagg     32280
     ttattatcca tacgcttaac ggggcaggta aagatgaaac ctctagatac ttagtatctt     32340
     ccaggtccag aatcaagtca tagaacccta gggcatagtt ttcagtgata agttcgattg     32400
     ataccaacaa tataagagat ccggtaacgg caaacaagag aataagcagg tactttacca     32460
     ttcttcttgt tacataatat agaattacaa aagatcccag aaatagggta tagaagattt     32520
     ccggatctgt ctccttgtat ttctcaaagc ctatatgaaa aaacatcctg tatataacat     32580
     aaagcccggc aacaaacagt aggccactag ctatttctag aaaccacaca agagcagatg     32640
     ccagaaagag ggagacaacc cataaggaaa cgggatcggt gctactccct ccaagtagat     32700
     ctttagaacc ttgcaatata tctggaggaa tgtggtatgt ctgcactgtc tttggtgaga     32760
     tagaattaat accttccttt atatcgcaga agttgtagta aactattgca gctatgtatg     32820
     gtgccaggga tattcttgga aagcggatgc cgtagaaggt cacgaaaaac gaccctgcaa     32880
     gtatggccca tgcccctatg gagcttggga agaacatgtc ctcataatag cccacaaagt     32940
     cgttgataag ttcaaataag aagtagcacg atacctttct tataaggaga aaggaaaaga     33000
     taatcttcat caattttctg taacctaaca acgaaattat tcccatcagt aaaaactttc     33060
     tgtgtttcag atggtggggt ctaaacaaat agtcttgagt aggaaacaat ttaatatgag     33120
     actttgtcat tcttttttgt ctttaacagg tgcccggaac ttcagtggat ttcggcggta     33180
     aaatctccag gacggaacca caacaataat cgagatgatt agggttgcaa tacttatata     33240
     catcgtgtat gcaaggtcat tgagcacaac tccaactata agccccaaag tgtatccaac     33300
     tccaaatata agatacataa ggtcggatgc cagtttttgg cctacgtagt ccgctggcgg     33360
     gtctatcttc gacagaaagg atttatacat ttcagggttt gcaaaaaatt tctataaagc     33420
     cctatctgct cccagaatcg agtctccggt aatgttcttg tctctcctgt agatatagac     33480
     aaatggaact gccgtacaaa atgcaagatg tccgatagat aacagcgaac atcctcctgc     33540
     tattatcttt ttgattccgt tagggatttg tccaacagat ttttcgatgt ggtagtagat     33600
     aactattgga atcttcttta ttaccggaaa ttcctcatat tcccttgtgg ccttgctctg     33660
     aagtttggta tcctgttcca tcacaagggt cttggaagat ccccatttta gttttgtgat     33720
     agaaggtatc tctatacctc ctcttcatca cttgttacca ccttcatatt attttctgta     33780
     ccgtaatgga gcgccaaagc accactcaca agaaagaaga acgtcattac tatcagcatg     33840
     agtatacagg cctgtatccc agttccatca agccctcgaa gcttaatctg ctcctctcca     33900
     gtagtacgtg cataagagct ctcaaaaaca actccattta gttggttttg gaacgatgct     33960
     ttgactgcat agtacatagg cgaaagccaa accatccatc taagatattc aggtattgta     34020
     tttggattgt tgaaagatcc gctatagatc agaaaaacaa gcagacccat cggtccaaat     34080
     acctgagagt tactttgcga agacgtcatt gcgccaatgg ccaaggagta tgctatgctg     34140
     aacaagatca gagaatttgt aatggccaga aatgttagaa aagtttttag atcggaattg     34200
     agtcccatca tccagtatat tatcactaca taaggctcct ctattataaa gttcatgaga     34260
     atttccgaac agtacttagc cataaatgcc gtgactcctg aatacattcc agacctcctc     34320
     tctctgagta tcacttttct ctcatatgga aatatgctga atataggatt acatattcca     34380
     aaaacagtat tcgttagaat aaatgttatg cctcctagtc tagtatatat gctttctaca     34440
     gaatacccta tgttgaggaa ggcaaatcca aatacaacca tgaaaaatat cttctggaaa     34500
     gccttcactt tcagatagtt gatattcctg atgtagttct tcaagttcct gttcaaaaga     34560
     agcagaaaac caagggacaa cttgttctca ctacttttcc ccctaacctc ctcatgaagc     34620
     ttcgcctcca gattcttctt tttctttctc cactcgttag ttatatggga gatcgttctc     34680
     aggcttttct cttccttatc ttttgttctc gtgtccagac ttattgtctt cagaaaaaag     34740
     tccattggat ttgtaagctc gggaagccga tatccacatt cctcaaaaaa cgcaatacag     34800
     cttttgatat ctccatcata gacaatgtta cccatcgtca tcagaataaa cttgtcgaaa     34860
     aaattcatca tctcatagga tggctggtgg atggttacta aaatagtttt tcccatctta     34920
     gacaagtccc tgagcagact aaggatattc aaggcattaa atgagtccag cccactagtg     34980
     ggttcgtcac aaaacaatat agggggattc cccagtaact caacacctat tgaaaccctc     35040
     tttctctccc ctccagacaa gtttgctata tacttgttct tggaattgct caatccaaga     35100
     agtgctatta tttcttctat tctgttcttt accttttgct cctctccctc actttttatc     35160
     tttatcttcg acgaaaatag aagtgtctca taaaccgtct gatactcgta tgcgtggaat     35220
     tcctgttcaa catatccaat aaaattcccc caactattct tggacctctg gcacgaattc     35280
     aggaaaatct ctccactaag atccatatca gaagagatcc ttccagccag tgagttcatt     35340
     agagatgact ttcctgcccc actagtcccc atcaaagccg tcatcgttga aggctcaatc     35400
     accccactaa cccccttcag aatggtattc cttgctccac ctagtccctt tgaagccagc     35460
     cttaagtttt tccaaagaag ttctgctttc tctgattcta cttgcatggg ctcaaataaa     35520
     ttacagaatt acaatccatg gaacgtaccc cagatgcctg agggtataaa gtccctgttt     35580
     gagggccagg aagtatttgt ggtggtagac gacacaaaag taagagttcg gaaggaagaa     35640
     atatctaccg aaggcaattg caaaagggag ggaatcatta gagacatccc cttgattgaa     35700
     atacgttctc tacatgtgaa aaacgatgag ggattcttct tgaagttaag gttgcttgag     35760
     gagactatca tattcaagtt tgatagccac cattctagag atattatcaa gtcaatgatc     35820
     ctttcgttta tgaagactga tcaggacgtg ataaggaaaa tcttggagtc ggatcctgct     35880
     gtaaagacaa tgtttaacaa tctaaaacaa tgtatttcct cttccaagtt ctggacaatc     35940
     aacaaggaca ggatgagaca gatgatgcct atagttcggc agcagccgtc aagagaaata     36000
     gaggttgacg aaaagacttt tatctcttcg ctagaccctg tgcttctaaa tatatttgga     36060
     caaatgaatt gctccgtaaa ccaattttat aatcttctta ggcaatcata cttttgtaac     36120
     accaagaatg aaaagaacag ccttgaccgg atgattaact cggcagtaag agattatgag     36180
     gtccggcagg attttgcttc aagaatcaac acccattctg ttctggctct aaaacctata     36240
     gaagatgtgg aaattcgtcc aagcacaaaa gagggaagga aggtggagtt tctccccata     36300
     tatccatttg aggaggagaa gccagaaaag ccaaggagag agttccggtt tgatagacac     36360
     ccgctaaagt gtgaattgga tcttgagatt gtacctatga cagagaagaa gatgtttgaa     36420
     aagaaagatc ttgtctggat cagagacttg tcgaaagttg tgtacaaatc aatgaaggag     36480
     gaagatggag catttctgga cgaagtatcc gaaatcacca aaagatttct ggataatatg     36540
     gaaaggaagt atgggaaagg atgtgatgtt tacctcaaaa gaattcttcc aacttatttt     36600
     attgagggga agaacaaatg acatggcatc ttctcaagca ttattaggat tttccccagt     36660
     ccttggtatt tgaaatggac caggaggaca agatagtatt ttcaagtaag gaggtcaagg     36720
     agtttctggg aatcaaattc atcactgaat cgtgtgtgct tctgagactc tcctaccagg     36780
     tgagatacaa agcattggtg ctgttttata acttttgcga ggaaatagat cttgtagacc     36840
     tatgcacggc ttccattctt ttagcctcaa aattagaaga ggaggtttgc actctgaaga     36900
     aggtgatata tgtcttcaat tatctttaca caaaatatga atcaaaggct gctccactaa     36960
     caaacagaca atccataagg ctcaaagaag gatgtgtaat tgccgagaca cggattttga     37020
     agtcattagg gtttgatgtg tcttttgaag atgtgtattg tgactttgtt gaattcctcc     37080
     agacaatgga tcttccgata gatttcatag acaaggccat ccaggttttt aacacaatga     37140
     tacaatggcc tgaggtgaag ctcctagact ccaaatccct ggccaaagct acaatagaat     37200
     cgttatttgg gcaaaacaag gaattcaaag actttgtctc aagatataat atgttccaaa     37260
     agaaaaagtt cgatttacag acatacaaag aaatccctac cataagaaac atagacgaag     37320
     gactggttgc agactttgct aagagacaga agcgaagata aacaccagta agggaataaa     37380
     ataaggtgaa ggcggctgtt taattctttc ttctttttcc aggctcttgg tcatattcct     37440
     cctcgctgtc atcttcctca tcttcatcgt ccgagctgtc gtaatcgctt tcatcttccg     37500
     atggatcctc gctcgatata tcacttacat cttcatcatc ggtagaaaga tcttctgtct     37560
     ccgaagagtt cgactcctcc gaagtctcga gttcctcatc ttcagaactc tcttcactat     37620
     ctccaaccat gaggccagac catgctccat cttcataaaa cgaaattggg tccttcatta     37680
     tgcttccaat aacgttattc caccggatgc ttgctgaggt ctccataaat aagatgttat     37740
     ttgagtcaag gtactctttg agcttgttaa cgctttgcac atctacgctt agtatgctta     37800
     caaggagacg agacttattc ttcataacca catccagagg atatttgttc ttcaagataa     37860
     aaagcacatc tacagtcttc actgtcaaaa caaccctttc gaaattcacc acttccacat     37920
     cctcgagagt cagtacaaaa tatggcgctt cgtcaagact aacaaggcat tcgtgggttt     37980
     gtttgatcat gacattctcc cggaatggaa ccccatggaa tccggtcttt ggaatttgaa     38040
     ccttgaagtc tgtctcagac tcaatgatgt ttacaaagga tctaaactgc tggttgattg     38100
     cttcctgtct atcctcctct tccttctcga taatgtactc catatgttcg tctccccttt     38160
     tcatggtgtc ataaatcatc ccactccctg cctctcgata aaactgtacg ttggtaacct     38220
     ttcctccaag aataatagga ttcaatagat gcaagtggag gatagcattt gtttccacat     38280
     tcccctcgga aaaaaatata tgccggatat tcgaaaataa aatcacaaca ttttcctcct     38340
     tgaacctaaa tccgttggca tgaagctcca gactaccaac cttccggcgt ctagatcccg     38400
     tctttatgtc tgttctcata tagacatctg taaggctaag aggcctctgg ctaatcttca     38460
     gctcttcgaa gctctctgct tcgccagctg tttttcttgt tgaatgaatc ttcttcaggt     38520
     tatttatctc ctcggccagc tcccgcgagt tgtttccacg aaggcttatc gatttgatgg     38580
     tgctctgggt gctttcgccg ccttgctcat gctccgtctc ctctgctcca tctcttccct     38640
     tgggctctgc tttgaagttg attcgaagaa tcttttcatc cgtgactgca atgctcttaa     38700
     tgcttgaaac atggaatggc acagcataac ttccaatcgg taccactatc gattctcgag     38760
     aaaaatccac cactagcctc ccttgtctag gaacaaggct ttctttacca tatggaacta     38820
     tcttatcttc ctttttttcc tcgtcctttc cagaatccga aaggtttcta tagaactcaa     38880
     gcctctcctc aatgagcttg tcaagtagct ccttctgatg ctctttcctc ctcatgctca     38940
     actcatactc ctttgtctta tctcggaacc gtgatctttt atctagaaag tcgggtgccg     39000
     catcctgcaa cgttagatat tccggaacct cttcaaggat aaatgtgttc gacaaagaca     39060
     tcgtctcatt attcaatctt attacaaaaa cacatccctt cctaaggata aacgaattct     39120
     taaaacttct ttccttgctc atcagtccta tcgtgtatat aaagtccgga tcaaatacaa     39180
     gtccgttttc tgcaaagtat ttctctcctt ccgagtatac agtcgaagaa tccgttccct     39240
     cccgtactag tcctagaata tactcctggg ccatataagc ttcttccatg ttcgttacaa     39300
     tggtcctaga tgcttcactg caatacccat tgtatcttac cccaattctg actctgtccc     39360
     gagtatattc cacaggaaat gaaaactcgc acaaactcat gtctacccca tccacattcg     39420
     aattcatcat ttcttcgagc ctcgcctttt caaaagctcc atcccatagc atctccatcc     39480
     cctttttcat cagtgcagac accgccattc ccgaagcctt ggagttctta atctcttcat     39540
     catcttttgt caggaagatt tcccccaact tctcagttgc atcagacaca ctgatcttct     39600
     cgaggatatt cctgcaaaag tctccctgga tctcctcgga atccgcaaca taatatgaat     39660
     tcctgagcat cccgtagatc tcatccatgt ttgagttatc tttgttccgc acaacaatgt     39720
     tcaagcacga gatctgtttg agaatctcag acttcttttg gcttgttatc gccgtgcatg     39780
     tgtcatcaac tattaaaatg gtctcaggaa actcgtatcc aagtaaatag ataaagagag     39840
     ccgagttgat tcgaaactca agaacatctt ggccctttcc cagaagaaca accaaaggcc     39900
     ctccaagatg ctttcttatc tcctttgatc tcctcttaaa tctttcttct tcaagcttga     39960
     tcatcgacat ctcaaggatt aaaattttta ttcatcatct aaaactaaac tccctctagg     40020
     acatcactca attaaaaaag tatactctat tactttttgt tccacacaca agccctcctt     40080
     cacttcccat gtcgaagcag tacacttcat catcacagac taagtcgctt accacttttt     40140
     ttttgcttac tctaaacatc ttaacagtct tatctttgga acatgaaact atcaggtcgt     40200
     tcatcatctt gaccttgtaa accagatcta catgccgaaa gattagaagc tgctggcctg     40260
     aatctacgct ccacagtctc accgacttat caaacgatcc agacgctgca taaagacggt     40320
     tttgagatat ggaaacagag ataacctctg cattatgctt cattcttttg tgaagaacaa     40380
     accccttcca aacaataaca tctcctccat cacatccaga caccatataa tttccattac     40440
     agtcaatggt attaattcct gaagaatgcc ccctgagttc gtctgagaat ctgagatttt     40500
     tgtaaacctt gattcttcca tctttacttc ccgaggctat gtagtcctct ccagaacaga     40560
     tgcatgtaac aggcattgtg tgagcatagg aaagaagaac ttctccgttc aaattccata     40620
     ccacaacaga attgtctctt gaccccgtaa ctagactctc cttgtaaaac ttcaatgcca     40680
     ccactccttt tctatgtcca aggaaacttc taatgtattc accttctctg gaatagaggt     40740
     taacacctcc atcaagccct ccactagcaa catatcttcc atcgggagaa acatcaagag     40800
     acaaaaccca atgggtgtgt cttttgacta ttttactctg cgtctttgtt cttgcgtccc     40860
     aaaacctaac tgtagagtct cctcctccag tgacaatcac tcctccatac ctcacgcaaa     40920
     ggacagggcc ttcatgccca ctgaacgacg aggagcaatg gaaggctgct tgtgttgcag     40980
     gttcttcgtc actcattcta atctttataa cctcttcttc cgacgagatt cccagcaact     41040
     ccaatgtctc ctcaagcgtc tcaaggactg gttggccatt aatgtaaagc gagagggttg     41100
     tatttgcaag caattgcagc tgtgatctaa gtatcttaac gggtatttga agccgatccg     41160
     atactttacg gccctcctgg tcctcaaact caacaagaac caaacccgac atgggggagt     41220
     ggaagttaaa cattttattg gcccgataca tctcgttctt gatcttgtat accttctgcc     41280
     aagaaatgca cagagtagag ccaatgcaag tacatcatca ttagtgaaaa atttatccct     41340
     agagaatgag gttgaaagat gctgcaaaag cccacataga ggcttatgat gcaatattcg     41400
     aggaacacat acttgacaac cttgtggcga acattccgcc cctaattaga gggaaaacaa     41460
     agatagtggt tgaagatatt catatctacc caccattcct gagcgacaaa gaccatatat     41520
     ctgtagatag gaggttgttt ccctgggagt gccgagagag aggactgaca tataaaggga     41580
     agattattat tcggatttca ttgttccatg acaacaagca catcatgacc gaggacaagt     41640
     tagcaggata ctttcccatt atggtccgat catctctatg ccacttaagg aatgctaaga     41700
     atatgaacaa ggttggagag gacgaagacg aggttggagg atattttata atcaacggat     41760
     ttgataaatt cattaggttt accattacac aaaagagaaa ccatatattc gcattcaaga     41820
     cgcggaaaag agaaagtttc tttacaggtt acggagtatc tatgagatgt gtaggaaaag     41880
     acgaaattgg gcacatgaat aatttgtatt actgcacaga tggaaatgtg gttctcaaga     41940
     tgtactatag aagatcggaa ttttttttcc cactagttct cattttaagg gctttagtta     42000
     atacaacaga tgaagagctg tacgaagcct taggacaagg agaaagggcc atccacctcc     42060
     tcaaatgctt tgcagagtac aatgtttttt caagaaaaga gtgtttagat tacattgggt     42120
     ctcgtttttc atctatggcc aacttcggat cgaagattga ggtagctgag gagattttaa     42180
     gtaagtacat tgcttctcat ctttcatcac atcttgacaa gttcaacttc ctaatacttg     42240
     cagctaaaaa gctgttttcc tttgtgaaca acgaaatagc agaagaagac tttgattcct     42300
     ctggaaatca cgagctccat acgacaacac aaatcttatc ttctcttcta cgggacaaga     42360
     tagaagagtt catgcggtct cttcctattg catataagaa agcatattta aaaagcgaag     42420
     gggagaaaag aagattggaa gaagactccg actcggaggt tgtagatgga atctacgaag     42480
     ataaactgga tatattaaag atcaaggaga tattcaagaa agcagtcatg aacattgggc     42540
     agaaagtaga gcttttccta tcttcaggga acatattttt gtcctgttgt tcagacattc     42600
     ttcaaaccac agggctttcg atcacccttg aaagaaccaa tttctacaga tacttcggta     42660
     acttgcgtag catcaacaga gggacacata ttccctcatt ggtgacaaga atccgcaaac     42720
     ttaggcctga gtcttgggga tttatttgcc cagttcatac tcctgacggg gcatgctgtg     42780
     gggttcttct gcacatggcc aagggggcag atatagtctc cagggcaaat gattttgaca     42840
     cagagattct ctttgagctt ggtgttgttc caactatccg aggcgttaga atggaagttc     42900
     ctgttcttgt agatggaaaa gtgattgggt caacttcatc cccacagttt cttgttcgga     42960
     tgctaagaga gtataaggtc aagaacagac taaaaataga gattgtatac agcgaaggga     43020
     ccaaggtatt ttcttctgtc tgtattttca gctcgatggg cagatttatc agaaaagtca     43080
     tgaaccagag gctggggtct gaggaatggg ttggaataat ggagcaggtt tctttaaaca     43140
     tagatttaga aaggggagag ggggattacc atgagataga caagtccaac atattaggaa     43200
     taatagcagg tttgactcca tattccgaac acaatcaaag tcctagaaat atgtaccagt     43260
     gccaaatggc taagcaagca atgggatttt cggcatacaa tatgaagaca aggatagacc     43320
     acaccatgta caatataaat tatctccaat ctcccttggt cagaacaaag ggatatgaca     43380
     tggtcaagga ttatcctctg ggaatcaatt gcatggtggc ggttctctca tatacagcat     43440
     acgacatgga ggatgcactt gtgatcaaca agagcagcat cgaaagaggg ttgtttacag     43500
     gattgattta taaaacagaa agaatagtgt tgaacaaagg ttattccttt ttgtatcttc     43560
     cgtctgtcgg agaaaaaata cagaaggatt cgattctata caaatatgtt gatttggaag     43620
     atagagagta ccagacaaga tacttggaga ccgaagatgg ggtaattgat tctgttcgag     43680
     tatttgaaag tgatgcagga gaaagatgtg ctttactgac cataagaatg gtccgaaacc     43740
     ctactattgg agataagttc agctcaaggc atgggcagaa gggtgtttgc tcggtacatt     43800
     ggccaagcat agacatgccg tttacggagt ctggatatgt cccggacatc ataatcaatc     43860
     cccatgcatt tccaagccga atgactattg gaatgctgat ggaatctatt gcagggaagg     43920
     ttggatgcct aagcgggaat acccaggacg gaacggcatt tgaaaagaat ctctcccaag     43980
     gagaagatga agaaacggtt ggaagaaagg aatatatatg ctctgagctc cagaagtatg     44040
     gtttcaacta ctatggaaat gaaccgatgt atagcggagt atctggaaat gagttccgcg     44100
     ttgatgtatt tgtaggagtt gtttattacc aaaggttgaa gcacatggtg ggagacaagt     44160
     tccaggtacg tacaaagggg gcgattgttt ctacaactcg acaaccagtt ggagggagaa     44220
     agaggcaagg aggaatccgc tttggagaga tggaacggga cactttgatt tcgcatgggg     44280
     cttcgcatct cttacaagat aggctcctca agtgcagcga cggaacaact tttgagtact     44340
     gcggggcttg caagagtata ctctttacaa gcagtgggga ttgtatttgc gggagtagtg     44400
     atattcggat agttgagatg ccatatgtct tcaagtacct gtgttacgag ttacttgcaa     44460
     tgaatataag agtcaagctt gatctatgaa taattaaatg ggattttgag cttaatattc     44520
     tgtagtcttt tccccagttg atgagaagga caaaaaagaa caacgcaaga gatggaaact     44580
     ctcttcagga caggcctaag aagaaagaag gccaagccgg gcttgaggac gatattgaag     44640
     caatattttc ctctgttggc tcttcagaag cacacaagtt gaaggaaaga aaagaagatt     44700
     cggagtccga tgaagagaag tatttttctg ttggaaagaa tggcagaaga taccatgagg     44760
     gtcttccgat ctatacgccc gaggaacttc atcttggaaa tggaggggac acggaggatt     44820
     gcccgatata ttgcgactgc tgtatgtaag gctttgggag attctgaagc tacactcggc     44880
     aagtcctctg gcttctaccc gggagtactt tgacaaaaat attcaatgta gacacccaat     44940
     gtacttcagt agaattgtcc gaaagataaa aaaagaaaga agccaactcc gggtgcttgt     45000
     gcttggcttg gataatgcag gaaagaccac tgtcctacac aaactccttg gaaaagcgat     45060
     agaacatgtg caaccaacct ttgggtatca gatctacgat gttacctata agacgcttag     45120
     cctgataatt cttgatgtag gtgggcagtc aatgtttgtg gagtattggt cgagctacta     45180
     cgaagacgtg gacggagttg tgtttgtgtt tgattcaagc gaccggcgat cttttatcga     45240
     gcatgtaggg catattaagt ctactcttgt agacacgcct atgttgatat tggccaataa     45300
     atcggatctc aatcctacat ttgatcccag gtcatttgga aacgacttct gtgagtttct     45360
     tgaaaaaaac gatgttaaac tttcgaaatg ctgtggatta tctggagatg gactagagga     45420
     ggggtttgac tggatgatag gcagagcaat gaaagggcta atggtggacg aagaagagga     45480
     aaagaaaatg gagcaggaga agatatttgg gtagattgta atgaagaatg tttatccctc     45540
     cgatgaaaag gcggaaggga tcgagcttgg gaagtatgca cactgtgtct gagataagaa     45600
     aacataagag agaaagaaac agaaagcttc ttctggagat atatggactg gagaaagatc     45660
     caaatttaac caaggatgca aggggaaggt atgtctgtgc actttgtaag actaagcatc     45720
     tgacagagat gagttatgta aagcatagag aaggaaagaa gcacagagaa gtactttcga     45780
     gaaaagaaga gaccactcgc attattcctt cttttagtat acggaatcta gtgagggaag     45840
     ggaaaaaagg atacggcatt gctgttgact acaagcttgc tgaggaaatg ccacagcatc     45900
     gctttgtaag cagtctagaa caaggtgtgg aggagtatga cgagtgtttt ggatacctcg     45960
     tatttgtgtg ccagccttac gagaacatcg gattcaaatt cgaaaacagg gagattgaca     46020
     gaacctccat ctatgaagac attgatgagg agacgggagc atacatgttt cacttcttct     46080
     ttcaaaagac tcatgattga tgaaggccta tggattttta cgttctactt tttaatccca     46140
     agagatgtta ttttgccctc tgtgttcaag catgctggtt gttaaaagac agcctgcggg     46200
     gaatgagctg tcttgcatca tgtgtgggta tttgtatggc atatccaagg aaatgtccaa     46260
     gactatcgcc atgacgccaa agaaaagcga tgggtttgtt gacgaggatg agaacttgaa     46320
     gtttgtgtcc aagtgtggga agaaatgcga gtgtggttct gaagaggttt cttttgtaga     46380
     gcttcagacg cgtagcgcag atgagcccat gacgatattc tataagtgca taagatgtaa     46440
     gaaggtttgg aaagaatgaa aaactataga gatagctcac caacagaata aaccgtattt     46500
     atctagtgta ttttctattg gcaggaattt atcagaagtt ggcttgggat tctttggcct     46560
     atactattct tcctcttctc tatgcatttc aatttctgaa aaggcaaaga agatctctcc     46620
     ctcttcattg ttatctccgt cctcttcata cacaatccta tctgaaggcc aattcttggc     46680
     tatggttatc cactggctta gaatgtttga cttttctccg cttgttacaa agaacatgta     46740
     ttctgtggga agtccatatc tataaaccga ttccacgaaa agcttcagga gtttgacatg     46800
     gaccagtatc ttgagaacct cttttagatt gatttgcaaa aacgtagtca gaagtctttc     46860
     aacagccgaa aacctctctt cagcctttct tctctttgta atcatctcct cggaggaaat     46920
     catattgtcg tcgagatctt ttatcagaaa tccctcagag tgcatcatat ttcttacttc     46980
     ttcctcgccc tgatgcagga tgtaaatctt aaagagatta tggtcttcat cactgtttat     47040
     cttctccaca gcatctcccg atatgtgtgg cgaatcctcc acaactctgt tgaactcgga     47100
     gcttttactc ttctgaacaa ccacatataa aactttgagg aattcatact tctctgcctt     47160
     tccaactatt atgttaagat tgatgtcgca taaactccct cttgtaagtt tttgaagctt     47220
     ctcacattcc ttccttgcat ctccaaactc ctcaaccttc tcttcatatg ccttgtaaac     47280
     tcttccatac tctccatcca gtaacaaaat tgctttgtca atcgagttgg ttggaaagtt     47340
     ctgattgtcc catctgagaa aattccccgc attctcaatg ctatcgcatt caacttcctt     47400
     tgcaatccta catgttctgg aatatcccat gaatgttttg aaaagacctt cgcacgactt     47460
     ttctagcaaa tttaatctct ctacctgatt tactatccct tccagggaca ctcctgtgaa     47520
     ggatggaaga gatattctac tgcaattaac tccgtagtcc tcttggatta gatcttctgt     47580
     tggttggggt acatcctcct ccaccgggag tcctacaaga acaaacatcg gggtgttaga     47640
     ttttgtggtt taagtgggac tgcttacatg taagatttgt gatttgaagg atctggtaaa     47700
     tgattgccat tttggattgc atcatggcgt ttcattgacg ccaaataaat aaagctgtga     47760
     aaccctgtgt aaataaatgt atctccacag atcagagttg gaggctggta ttgaaaagct     47820
     catgaagaca atggaggacc acgaggtttt ggagagatgc aggaagtcac tgagagagat     47880
     ggataagatt gaagaagaaa acataaaaga cttcattaga gaaacacgag atattgtcga     47940
     tgcttttgtg aagggattga gaatcaagaa gcaggttccg atttttgtta ttgatttcat     48000
     atacacattt cttgtcaacg atcttctcat ctcaagtgac atcaaggaga ttattagtgt     48060
     tatttctgag gggaattggt gcgaagtatc gaagatgaag atactccaga tgagctacta     48120
     cattataaga tatgaaagct tcaaggagga ccttgcactg tccttgttta aaagcatagt     48180
     gagaatgatt gatgacagaa gcagacaggt acagacaact gctaagccca tagcgatgca     48240
     tttagtggat gttgttttca gcagggcatg tccagtcttc aaggaagagg ttcagagcga     48300
     ggaaggggaa cctgagtcta cggctgtttg ccctgacgtc cttgaaggga acaggcctgg     48360
     gtctgaaaga ctgcttgtga gaggtggttt ccaattctct aattcaatca atgatggaat     48420
     tacattcctt aagcatcttc tggagaatgg gaatacctcg aaggaaatga atcactttat     48480
     ggttgatgca gtacttctaa taacccgtaa aagcgatctt tttgaatatg aggagttcag     48540
     gaagatatat gattctgaag tgatggctat gctgatggag ttgataaaaa ggagatgctc     48600
     ttccaggggg aatgtctata aggtacttgc aagattagtt gagagacata actgtctgtt     48660
     cgaaaagcag atccttgcag tgtttgatga aatggagaaa tcttatagtc tacttgacga     48720
     cttggagact gagatgtttt tggacttctt cgggagtttg gacatcttgt tgtttgaagg     48780
     ctactcctca actataagaa gaatgttttt caacattctt gaaaatgcat cgtttgatga     48840
     tgaatttgga aatgagtatg taatcgatac cattagaaac tcattaaatg gccaactgaa     48900
     ggctcaggag aagacaagtg gtaagtttca ttcctcaaca aaggctttct ttggtaagtt     48960
     ttcggaaatc ttatatgcaa aactgtctga tatcgataac gtacatccca aggtggagtg     49020
     tctgctggag attgtccttt ggttctattc tgtttctggt aacaaggagt ttctggacag     49080
     gtttatggtt ctggggtgca agctagggtt tacagatgtt gtatgtagaa atgccattga     49140
     gaacagaaag catatacagg actcctggtg gattgttctt gagaacggta aggaccatct     49200
     tggaaagatc atagaatcta tctgtatctt tgatgccgag gagatctttt ttctaatcaa     49260
     aggtatagag caacccgagc cttcttgtac atggacctcg aaggagagag tggactttct     49320
     cttgtctgtg tttaatatta tcaagcctgt tgtagtagag ccgctgaaca taaagatatt     49380
     tgagatgatt ctcggaggga tactaaggga gagtggaagc gaagaggggt atccgaccaa     49440
     ggtattctgt tctattctca tggattatgt tgggcattta gaggcactaa cgcctgatgt     49500
     cgaaagcgtt atttttgtcc tcctgcagaa gatgcttgga aaagatctgg aaaggaacgg     49560
     attggaaatt ttggaaacct tgtcttttgt ccttcgaacc atgacgcctg agagctgttg     49620
     ggacacaatt ctccaatgca tcgagtgttc atgtattccc tgcctgtatt cctccttgta     49680
     ccccattatt cgatggatta tagagggatg cgggcatctc ataagtaacg agcattttgg     49740
     agtgcttata gattgtctgt attcgatgtg cctgtcgccg agcagcgaaa taagcttaaa     49800
     ggcaatattt atcttccagg atattgggga gagcctaatg agtaggaggg cttttgatcg     49860
     atctcccaag gggaaggaag agaagaacag agacatgaat ccagcgtggg ccaaatacat     49920
     aaaggtattg ggggagatga caaacgatgg aagacatatg gtgtgtgaaa cggccattaa     49980
     gtatctggtt atgttccttg aggcagagtg tgaggtaatg aactccgaag agcttgactt     50040
     tgcagcaaat aatggcctta ttcctgtttt ggagaaggga agggagtttg ccaaaggccg     50100
     ggattcagaa gcccattgta ctttgatgct gataatggat gaatgtagca gaacgattgg     50160
     aaagatgaat taccatgagg agttgtatgg aaagtttctt gagcttgttg cagatagcct     50220
     gtgcaacaca gactcttcgg agatacaaaa tatgtgtatt gagagtctaa agatgatgac     50280
     aaacaggatt tcagggacaa gggatgaagg aaagagtata tgccaggaag gaagcgagca     50340
     tagcccggaa gatatgggat ttaaggcagg gattggagaa agaaagtctc tccagcccct     50400
     tcaaaggcta agggacctgg ttttgaacac atacaagttg atcttttcca gtattcctgt     50460
     aaacgaagga tattctacta gtgtgtgtct tgacatgata gactcggtca aaggatttgg     50520
     attcaaaagc tctgagcgtc gctctctgat tcctttgctt cgaaagtttg tccacagcga     50580
     ttgccagacg cttcaagaga agattctgaa tatggttggg gaatggccag cggaagatgg     50640
     aggacttgac atgcaacttg aagcttacaa cgactggatc gaattcaagg atatccgcct     50700
     gtctaggatg cttattgaaa gaataggaag gattctatcc aaggatttgg aggatacgcg     50760
     gtactcggaa gcagcaatgg atttggttga atacagcaag gaaaaggcct tctgggaaga     50820
     cgttgttaga gcgtttatga aggggtctga aaacataaaa accagagcct catttatatc     50880
     gtttataaat ggatgtaggg tgattctaaa ggaggcaccg aaagtgaaag ccctccaatg     50940
     ctcaccggaa acagagggat gtagcgggct aggggaagag gcgtcggaga gcatggcaaa     51000
     ggctataaag aaaagagagc gaatcattct tgagttccta gccttttacc atgaggttct     51060
     gagtaagttt gctccaaaca ccaaaaggtt ggatagccat tccatgcagc cttttgacca     51120
     aacaacagaa tcggatgtta gagaaggata taaggtgatt tttgagatga gcgagctcgg     51180
     atctggactt ggaaaagaga gtatttcctt caaatgttat gaaatactat tccatgacat     51240
     tgaacttatt tacagcgatg ttgttgagaa gatcaggaag gtcctaacgg agtataacga     51300
     gatggaaatg atatacaatg gactctattc ccgagtaaag cagagggaag tctatactct     51360
     gctggagaag atatggaaga gcggaaataa gaagcttgta gatgatgtca aggatgttct     51420
     tgttgagtcg ctccgatcca aggactacag ggttatcgat catgttcgaa agtgtttgga     51480
     agtgattctt gtatgaggaa taaacattaa agattaccac agtctttttc tagaaaaaaa     51540
     ctgagaaatc cggaaagaaa aaataataaa aacggaaaat ccctaagaca caatgtcaga     51600
     agaaaagcaa aaatccaata catctagagc aattggaatt gatcttggaa ctacattttc     51660
     ctgtgttgca gggtacatag gaggaaaggt ggagatcatt acaaattcgg atggagaaag     51720
     aaccacaccg tctgtagtga gttttgacga gaacgattgc actgttgttg gaacagcagc     51780
     aaagaacatg gcagggcttg atcccacgtc agttctgttt gactctaagc gaatgattgg     51840
     aagagatttt gacgatccga agatccagaa catgatgagt ggatggccat tcaagattgt     51900
     gagatacaac gggcgtgaga agaaggagat gcctcacaag gatccttctt caaccaattc     51960
     ctatgacaac atggcataca agttcacgaa gaatggaaag accaagtatt acacacctcc     52020
     tgagatcagc tcgaagattc tgtctaatct gaagaaggca gctgaggcaa ggcttggagg     52080
     gcctgtggat gccatggtgg tgacagttcc tgcatacttt gaggatcctc agaaggcagc     52140
     aaccaaggca gcagcaacca ttgctgggtt caatgaggac agagttagac tccttgcaga     52200
     gccaacagca gcagcactgg catatgccca catccagaca cagaagaatg ccaatttctc     52260
     tgcaaaggag gatgtccttg tgtttgatct tggaggaggt acattcgatg tatctgtgct     52320
     tgactttgag ttcaatgcaa ccacaggaac cttcggaatt gtcaaggcca ttgacggaga     52380
     tacattcctc ggaggccaag actttgacaa tctattgatc aactactgca tttccgagtt     52440
     ccttaaaaag aatccttcga tccagaagac tgatctcaag gagagtgctc ttctcagact     52500
     cagggcagag tgtaccagag tcaaggcagt tcttagttcg gcaacaagca gcacaatcta     52560
     tgtgccttgc ttccacatga cagatgactt gaacgtacag attacccgtg ctagattcga     52620
     acttctttgc gaccatctct tcaagaagtg catggaaagg accaagggat gtctcttgcg     52680
     ctctacagga gttccctctg ttgagtactc ttctgatgga aacaagctcc ttttgaatcc     52740
     ttctcttgaa aagacattga acgaagccag aaacaacatt agtaaggttc tacttgtggg     52800
     aggatcatcg agaatcccaa aggtcaaggc tctgcttgca gaatactttg gagcacacaa     52860
     ggtcattgag cctgtgaatg cagacgaggc cgttgcatat ggagcagcat accaagcagc     52920
     atccatatac tccgatgctg tggaagcagg atcaagtctt cttctcattg attgtgttcc     52980
     gctgaacctc tcgattgaga ctgccggagg agttgcaaca cctctaatca actgcggaga     53040
     caatatccca atcaagaaga cagagacctt tacaacctat gaagacaacc aaacagccgt     53100
     aacaatcaat gtgcatgagg gaaacaggcc gatgtgcaag gacaacaaga gaattggaac     53160
     cttcaacctg gatggaatca tcccaggacc ccgtggaaca gctaagattg aagttacttt     53220
     tgacgttgat cacaacggaa ttcttgtggt tactgccgag gacaagcaga ccggaaagtc     53280
     caacaagatc accgtaacaa actctcagaa cagacttagt caggaggaga tcgagaggat     53340
     ggccaaggag gcacgagata acgaacagcg tgacaacgag gtcaaggaga agatgggcaa     53400
     gaggatgtcg ttcgaccaag ccattttcac attcaagggt cttcttgaaa aggccaacat     53460
     ttctcaagag aagaaggacg agtctttgaa tttcatcaag gagcatgaag aatggctctc     53520
     aaaggcacaa gggcctgatg acttcgaggt ggaagagctt gagagaagat ctaatgagct     53580
     ccagagcttc atgaacgata tcatgaagga atctgggatg agtgcaccaa cagcctaaat     53640
     aattaaatgg tttgtctcta taatcaacct actttctttt gtggaggcag gtttaagacg     53700
     cctcccttgg aaccccagga tggctattat ttctctagta gtcatcaacg tacacacaag     53760
     aaagataaaa gcaaaggcat ttagtctcaa gcaattctca ttcttcactc gaggaaaggt     53820
     aaaggagaca ttgacattta tttcacaaga gcttgcagaa aagttggaga catatgagtt     53880
     ccaggagtac acacacgaat tcaatgatga aaaggcctat aagctgttta gtatggtaca     53940
     taacgactat gcttacatag catgtgcaga cgatgactat cccggggttg tggccttgag     54000
     acttttacag gaggcaaggc acggaaacat cgagaagctc atcgaggagt acaaagaccc     54060
     tgcatcaaaa cacaccctct tacaaataca gaacgaggtg gaagagacaa agggggcttt     54120
     gtccaagact ctgatggcag ttcttgaacg gaatgacaag ctggaggatc tggttgccaa     54180
     gtccgagcat ctctgttatg agacgaaact gctgttcaag agtgcaaaaa agaaaaataa     54240
     gtgttgctga gggccttata aaataaaact agacagttcg atatttcttt gttttttgaa     54300
     actagtttca caatcccatc gaatggacca tgagttcagg cagttctacg aaacacttga     54360
     gaaggggaag ttcaagttct ttggaaaggg agaaggatac agcgtgttca actccgatat     54420
     cgagatgatt cctcagtaca acgccagaga cgtgatcgaa agaaaggaaa tgaaggagct     54480
     aaggctttct aaaggagaaa ttgaaggaat agttcgagca ctgttaactg agatcaagat     54540
     tggggtacag gaatacaacg gccaagttct tgtaagagaa ggattcccag gaaactggaa     54600
     ggactttaca gacttgctgc ttgatgctag aagtattcca tcaattgcag ccgtcaaact     54660
     aggagaggtg gttgagatca gcttccttat cacatcggag tcaacgatct acacatctgt     54720
     ctttgaggat gatgaaatat tcagcagcct gtactggatc ctaagtgaag taaatgtggt     54780
     tgaggttgta tacgataaca agaagcttgg aggtttcttc aacagattag gggtttcaag     54840
     cagcttgaga agatgtgaag aaaacactgt aaaactcctg tgtagatatc tcaggatatc     54900
     tgaagagaat tataagtgtg aggaatatac taggccattt atatgcagga tagatagaag     54960
     cgtcctgtct gcattgaatg tgtgcagtga tgacgaacat tgtgtagcta agaccttttg     55020
     ttgttataca aaccagggct ggagactcct gcacagaatg tttttgcaac ctcttcgtaa     55080
     caaggatgag attgagagaa ggttggaaac cgttgactca ttgagaacac ttaacctgaa     55140
     catcttgaag aaatttccag atcttctaag gctatctaag cgaatagaaa cagggagaat     55200
     atccttgagg gaaatcctca gacttattca gaccatcgac atcattccag agctcttgtc     55260
     ttccttttca tcctctttgc ctctcaccag agacttttct aagcctctta agagtatctt     55320
     ttcggctttt ggcccgttca aagaagagat tgtacgagta gtcgatttag aggcagcaga     55380
     agaaaacgtg tataggatta gacctgatgt gtctgcaagg cttcttgagc tttccgaggc     55440
     tctgggagaa atcgagaagg agatgaatgg ggagtatgag agggtgtctg agatttatcc     55500
     gaagatcaag atagacaaaa atactggagt cttcaagact acaaagggtg agtaccaaaa     55560
     agctcaagat cttcttagga aggaaggttt tgttgagcta aactttgtaa agggaggagt     55620
     cacacttaca accagaatcc tttcctcctt aaatgggaga caggtagcgc ttaaaaaaga     55680
     aatcgatgac gaggagaaag aggttatgga ccgaatcaag agaatgctga aaagttacat     55740
     atctcaaatc gagtccttga actacctgac tgcattgata gacgtgttca atgcattttc     55800
     catcaaagcc tctctcaagg gatattcaag acccatgttc aacaaaggga tatttgaaat     55860
     aagaaatggt ttccatccgg ttcttgaaga tcaggactat atttctaact cgataaggat     55920
     ggaggagaag aagatgtgcg tggtgactgg cccgaacatg ggagggaaaa gcaccttcct     55980
     taaaacatgt ggcgtggtcg ctcttcttgc acatatagga tgttatgttc ctgcagacta     56040
     tgccagtatt ccgattcttg acgggatata tgccagagtc ggggctaacg actgttcatt     56100
     cacaggctca tccacattca tgatggagat ggcagacata gcaaggatat gccgtctgag     56160
     ctcgtccgag tcactaatca taatagatga gcttggaaga gggactagcg caatcgatgg     56220
     cttgagcatt gcacaggctg tcaaagaaca tattgttcag aagaaagccc tgtgtctttg     56280
     tgctacacat tttcccgaac tctgcggaga cgacgtgttg aataagaaag ttaagaacga     56340
     aggaacactt cttatgtatg aggttgttga tggggtatgt gacacaagct ttggaataat     56400
     ggttgcagag aaagtagggt ttcctacaaa ggtgattgag acggctaagg agtatatgga     56460
     aaaatagtct aataaacttt ttattaacta tatcagacca gagaggattg ttcattgctc     56520
     cttactccct tcttttcgat cctgatcctt actttgtgaa tctggtatat cttcctcttc     56580
     gctatcctct ccaaatatta tcttatagaa cttcctccca tcatgcacaa gtggttcaag     56640
     gcttccggtc acaaaccgta gtccatcctg gaatttgcta aaaaccagaa gtccagtctt     56700
     gagacaaaat atattgatga catttgcccc aatgcaaata acgtagttcc taatcacttt     56760
     aaactctatt gggacacaat tccacaggaa gataacatct gtacgcttta gctttcctat     56820
     ttcatcaact ataaacccta tggaatcaaa gcacaagagg aattcatgtg gcgagaccgg     56880
     gaatatcgat cttgcagtta tgccttggag cccttggaaa agcacaggga tgaacggatc     56940
     atagatctgt aggagctctt ctgtccgaag tgtctccatg tcaataatct cgaagtcttt     57000
     ggatgctatc acaatcttgt ctgagcagaa gaaaacatta tatacctgaa gcccaacata     57060
     cagccttcga gaaagctcaa tcacaattga acggttggac acaattgcca gaaaaagaaa     57120
     tatcgagaaa gatttaccgt ccccggagtc tgtagacgca atgcatgggc cctgttttgt     57180
     tattccatag aaaaagtctt cgatatcatc cttcagaaca ttttcttcca ggcttgttga     57240
     ctcaacgttg aaatgggacg cataaagaat ggattccgat tgatatagca ttatctcgta     57300
     tgtagaatca taaattatct tcttgacctt cctttccagg atcttatcga tcctattatt     57360
     gaagaacctg cagacaccat cgcttgttgc tataatgtac atattctttt gagcaaagat     57420
     atattctgca tcgtctcttc tattcaaggg aggagggagt tggatgctgc tcacaaagaa     57480
     gtcagctgtt ggaaatagga ttttccacaa ggactggccc ttttttggtt tagtctggct     57540
     tccaatctgg tctgtctctt cgctctgtct tttttcttcc tcagagttct tcttcttgat     57600
     ctccaaaaac ctattcacaa tctctattaa ttcattgtct tctacctcca cctccttttc     57660
     ctcactatct tcagaaaaag atttctcttc ttcggacgga gtcgaaaaac tctcctcctc     57720
     caggctacct gaagaagata ggctttcccc ataccaatcg aagtcggttg ccttgcatac     57780
     atacttcact ggctcatcta tattgaaagg aagttcctca atagttacat cgcttcgaag     57840
     cttcgatctg gcttgaagta tcgccttttg aattatgttg tagtatacat ctctttcccc     57900
     cttgtcttgg aaatatagtc cctgggcttt gtctcctcct atctcaaaca acagtagagg     57960
     agagagctct tcaaaggact cgtcttgagg aaagaagccg gtgtcctttt ttaatacaac     58020
     tagcctagcc atgaatatag gctcttctct aatgaagatc tctgcaaatt tattttttgg     58080
     gtagtcgcat attagtatga ggtgatcaaa aataaacaat ttgcatgttg gtgagtcttc     58140
     ctttgtttct cctcttacca gtactttccc ctccttcaat agtcttcgtt ttttctgaaa     58200
     cagtgctaga cagtgttggt tcctaacttc cttcttataa ctaaagttga tcccgagcct     58260
     gtagatggca aattgagttc caaacctgtt aaattcttta tctgcattct ttgctatttt     58320
     cataaacttc tcaatcaaat tttcatatgc actcttcagt tctccctctg tgttcttggc     58380
     aacagctctc aaaagcatgg gatatcttgc aagtttctga gacggcctat acagaaaatg     58440
     cttcacacct aggaactctg catttttttc tttcagaaag ttttcaactc ctttttcaaa     58500
     ttctggaagg cggaatataa gcttctcaag ctcaaaatcg gctttgggaa gccgccgtac     58560
     atactccttg tatagctcaa actcctcaat atacttctcg tatatggaga catactctag     58620
     cttttgtatc ttcgggttgt tgatgtcaac cttgtcaatc atatattcct ccgtgttttt     58680
     caactcatgg tttcccgtta tctccgagta gatactaagg ttcatcttct tcatatcttt     58740
     atagatgttt tcgtgcagct tctggatgtt ttccagatta ataaatatcc tatcacatat     58800
     ttcatactta atctttgggg tgctaaacaa tgggcagttg agaatccata tcctgaaatc     58860
     tctttcccac ataaggaggt cttgaatata gttttgctca cttttgaata tttctccaat     58920
     agcctcaatg acctttctaa gtttggccat ctaaaataga gttctttgtt tttctgtatt     58980
     tatctcttct caatgtttca gagagaaaca tcaatagcat ttgtctctga tctcttataa     59040
     agccattcat tggtcatcca tctgaagtat ctcgtaatct ttcctcctca gatgatctgc     59100
     cacattgaac atggtttcca ctcccatgtc caacggcttc tgaaaaatct ccatacagac     59160
     atcgaagtcc tcacgaagaa tcatattttt cattaggaga atggcagaag cacagcaata     59220
     cagcacaatt tcaaatctac acacgtcact aagaagccgg tcccaaagcc atacgacgtc     59280
     ttcaatttca aaacacggca tgaacatcag taatatccac ttcatgtgga atcctccttc     59340
     tgttaggcct ttttttctca tcacttcata cagctctccg tccgcatttt tgactatttc     59400
     catgaccgtg gacatcctat gaactatccc tccgctacac tgatcaaagt ctccaatgaa     59460
     gttgtctcct atctcggcca tcaatgaatt gaaacagaag aaggtgtctt cttcgcagta     59520
     ctttctgtcc tcagagtcct cactgcggca caggacatag tatatcgcta tcaagacaag     59580
     attcattccc tggacatatc tcaccgaaga attggtcatt gcgtagcact tcagtattct     59640
     ttcgacaatg tttctatggc tttcttggga attttcagat acactgtcca aaaattcaca     59700
     gtattttctt ttttcttcaa agctcccatg atctgtccta ggcctaatga acgtcctgca     59760
     aacatcattt tcaatcacct tgtagcattc ctcttttcct ttaaactcct ccttcatttt     59820
     ctctgcataa aagccatagg aacttctcat gttcctaaga aacatctcgg ttttgaactt     59880
     attcttactg taatatccaa gaaagatctt ccagtacttt ggcctgagaa atccatcgga     59940
     aaagccgtaa tagcagtatt tcctgacttt gtgaacatcc aacggagtcg agtctgctgg     60000
     attgacttgc ttctctataa gactgtacag cgttgttctc tccattttct tgcaaattca     60060
     tttactctgc ggtcttattt ctcctcaatg aattctgttg ttctgtagag gcttcgccca     60120
     atggatttct gtagtcttgc attagaacgg cttggatgat tggactttcg caataacttt     60180
     caaccaaccg gagactagat gagcagccaa acacacatgg atgcaagaag ctcttgtagt     60240
     gtggtggaaa tgctgtttaa agtctttctc cttggaattc ttaaatccac ggttttaggc     60300
     cagatgctcc tattccctcc cttccagcac ccaatactcg ggcacacaga aaaggagttc     60360
     gctattaaaa cgaaatccaa tggaagcatc catgtactca agggaagctc tagctctcga     60420
     ggatggtgcc agatacagag gagagcagct tactaacgga gggtcgttta aaatagaaat     60480
     gaatgtagat gccatcgaca tcgagcagga attcatctgc ggaacattcg agatacataa     60540
     ccttacagac agatacgagc ttctcacaac gtactttgaa ggagaaatag ttgggaacat     60600
     ttatccattt acaactgagg agtactcgat ggggaatccg gacataatac attggaagct     60660
     ctttcccgaa tggaaaggag agtatgtcta tagggaaggg tcttatgata taaagaagag     60720
     caacttcatg tatatcaaaa tcaaagagct gttcttgctt cccgatcccc ggcttaaaag     60780
     cataccagga gcatcgattg atgggcacta ctactgctgc tactacaaga accttgattg     60840
     ctttgccgga cactattact acaaaaacac gtcgaaccta atatcccagc aagtgctttt     60900
     ggacagagta ttttcaagga agtctagaag taagtcattt agcaaatgac atgaatatat     60960
     cattaaataa taatttcaaa taaaagctct gtgttaagcc tgacgaatgg gagatggata     61020
     tctcaagatt tgacaggact ttaaatgttt ttgtaggaga ccctcgatgg acgagggctg     61080
     gaaagtaaaa aggccttcta gcggaacaaa agtagagtct aggttgtttt ctgcacaggg     61140
     gcataagtgg aagttagttc tatcatacaa gggcggaagg gtgtatttgg cactagagta     61200
     tcaaggggga tcctaccacg acgttttgac ggcattttgt ttctccattg atggagagaa     61260
     atacgagtat cagtatcaat tttctatgtt caatacagat atgggaatgt acattgagga     61320
     gaaggacagt tatgtcatca aggttaacat tagcgtgagg tctggatact acgattcgaa     61380
     gaaagagact ggatatgtag gactcaaaaa ccttggagcg acctgttaca tcaactctct     61440
     gatgcagact ttgttcaaca tagcaaagtt cagaaacgat gtatttggac tggagcctgt     61500
     tggaagggtc ctacttcttc agaggttgtt caaggaaatg caaacgggag agaatcctgt     61560
     ggacacgacg gactttgttg tgaataatat atgggtggat gacgtcaatg cacatcaaga     61620
     catccatgaa ttttcgaagg ttttttttga tgctctggag aaggacagta agagaaagga     61680
     ttttattgaa gacttgatcc aaggggagct gctgacatac ataaatggaa gatgtggctg     61740
     tgtccgtcgg ataaaggaga agttccagga cattcaggtt gagattcgag actttttcaa     61800
     taacaagctg tcgtcaaatc tagaggagtc tctaaagaga tatgtgaaaa gtgaaacgct     61860
     tgagggaaac aacaagtata actgtgagaa ccatgggctc gttgatgcag agaaaggggt     61920
     gatgtttggc tctcttccac cggttatgtt tgttcttctg aaaagattca atgttgattt     61980
     cgagacggga aatggatata agataaacga ttactttgaa tttccttcct ctctcgatat     62040
     gtcgccgttc atggataaag atgaaggaaa ggagtccgaa tctccggaga tatacaatct     62100
     gtactctgtg atagttcacc gaggagatca tgatgagggg cacttctatg cctatgtgaa     62160
     gatcaaaggg aaatggatca agttcaacga tacagttgtg acagaggcag gagaagtgga     62220
     ggcactggag cacaactttg gaggaagaca cccatacaag gacaaagtaa gagaccactc     62280
     gggatactac ctggtttatc ttaaaaaagg aatggaagac gaactattga atgcaaaggt     62340
     tacaattcct ttgcaaacag aggagatgct caagaagaag cagaacaaag tctcgattaa     62400
     gtgtgtaaag atagaaaaca tcagaaatta cagaggggca gggttttata atgttaattc     62460
     gtatgactat cctttgtgca gctataccga gtttgttgtg aaggagggag acagcattaa     62520
     gttattgaga aataacattg agagacttct tagcactcgg aagtttctat atctatttga     62580
     atgtactgca atggatgagg gcgaaaggac tggagcagca gacaggcctg gaaaaaggat     62640
     taaggaagat ggatacggct tgacgggacc tagaacggaa aaggactcgg aggaggattc     62700
     caggattgtc gagaactcaa gaacaagcta tcaaagaaag gtagttcttg tgaaggatgg     62760
     gattatcaat gctgatgcag actacttcat ctatacgtgt tacccggaag tagactttga     62820
     aaaaaacaga cttattttcc tcaaggtctt cagtaataca ccttggtgtg aagacacatt     62880
     gccgacgtcc ctgaggctct gtgcatgtat acacatggat ggaacaattg gggacaacat     62940
     agatgctatt attgagaaga cgagccttga cgacatctct gtgtttaggg aatttgatcc     63000
     gtcatctgcg ttagacctat ctagcaaggt ctcagatctt ccccaaggag acgtcttgat     63060
     tgtagtgagg agagaggatg tcctggagtt tctcgacttt atcaacgagt tctacagaag     63120
     gatgtgtgtg aacgttttgt gcgggcccca taacttcact gtgtttgtaa agagagggct     63180
     cacaggtttg gagctggaga gcaagattcg ccgatttgtg ggatcgaagg aaatctttct     63240
     gaagccaaag agagaagcag tctccgacag ctctgggttc aaaactgcag ccgaggactt     63300
     tggtcaatct gatggggagt ctgatatgta tgaacacctc cagtctaaga actccgtctc     63360
     gtgcacaatc actcctgggc atcaagtggt atatttagca ttttgcaata aggagatcga     63420
     ctacaactct attccccatc tccacatctt tataaccaag tctggaagta cttccttgga     63480
     attgatcaag agtgttcttg tgtctcattt catatgtctt aatcccgtga gaggacactc     63540
     gttgaagacc ctaaggatag tcgattctgt aagggacact ctatatctca aagcatttac     63600
     tgcatctgaa gagtttacag ccaacgggat gtgtgtgatt cagccatttg tcaggagaac     63660
     agtcaagacc gcatactata gtggaatgta taaggtagtg ggattcccgt tcttcctcca     63720
     aacagatgta gaaacggttg cagaattccg aaagaagtac aagctttttg gcaagatggt     63780
     gatatttgac ggaaagagct atggagacct agagcttgac tggccgatga gtaagtttaa     63840
     tgacgaatgt tttctgctga ttgagagaac gtaaccctac attaaaggtg atgtatttcc     63900
     tgtgtgtttg actaacccct ggtctagagt gataaaaaca gatggcccaa agcccttaat     63960
     ggagtttgag gattgcggag agccatattc caatagattt gatctgaaat ctgcctttct     64020
     tggggaacta cctggggatg agccacttct gaaggagctg ggaatagatt tcaacacaat     64080
     aagaaaagaa agccgcttag tctttggggt ctttcaaaaa aaacaagttg acttctcgtt     64140
     tgttaagaat gcagatcttt caggtccggt tgtctttgta ggattatata ctcttgggct     64200
     catcctaaac tataagatcc attttggata catatatttc atttctctgc tgacggcctt     64260
     gtcgatgtac ttcctgctaa atgtcctgga cacaaagcac ataggatttc ttgagtgctg     64320
     cagtatcctt ggatactcgt ttccccctgt ggttttcttc tcgttcctga acatcctgtt     64380
     gggaggaatt ggaatagggt tcaaggtgtt ctacggcctt gcatttgctc tttggtcgag     64440
     ttacacagca tcggtagtgt tctgcagata tctttccctt accaacaagc atgtggttgt     64500
     tggatatcct ctgttgctag gatatacagg gtttgtaatg gttgttctat tctgaaataa     64560
     atcgtatagt attaaggtct ttggggtctg gacactgtga tgcttatgga catatttaat     64620
     atttgtaatt gatctctgag atataaaaga aaaaacaaga aaagctggga tgcgaaaaaa     64680
     tgactttgac gtgagggaga tgaacgcagc attgggtctc cttaggctag ctagagaggg     64740
     aaagggcgaa gcagatgagc ctgatacaag gacaagaaag accactttcc agatgatggt     64800
     tcttaaagag gtattcaaga ttgcaccgca tccgtcgacg cttacgaaga cagaccttgc     64860
     acttatgatc aagcttccgc tgaaagctgt acagatatgg tttcaaaacg agcgaagcag     64920
     gaaagagaga ggagggagga cggggaagag aagcagggga ggaagatcag aaaacataga     64980
     tccggtgaag ttgttcaagg ttataatgaa ggttctggaa aagaacagag agggttttgg     65040
     cttctagttc tggagagaca ttgcattata tattggtgta acatagacag agcatgttgg     65100
     tctttgtgtg agatgtttcc aattgagaac ataaattaaa acatgagttt ttccgagggg     65160
     atattaaata ttagccaagg ctttatggct tttctatagg acggcccaag ggaggagaga     65220
     caaaaaactg gatattaatt tttacccctt ccctatttgg cctttgaact tgagtctgtt     65280
     ttttacaact ggagaatagg gttatcaaaa aatattaagg aacatgctcg ataatattaa     65340
     attataaatt tattcaataa taatattgag ctagaattta ttcaagactg taaaaattct     65400
     aagacaagta aattatcaat accttggtgt attcttaaca atggacataa tctcccacag     65460
     gtcaattgcc ttggagtctg cattctcatc aatgctttga ttctttcctt tgctgatatg     65520
     tcttttgttc tggaaccata tatccactgc tcttggtgat aaggatatta agatcccgat     65580
     atcaatcttg ttctcccatg ttggatatgg tgttgcttga tatatcttct tcaaaacctc     65640
     tttctggaac ttgcttttcc tgaccttttc tcctggcttc tttaggcatc tctccggatg     65700
     gaacaacaaa atcattccta gggctgcctg aacttccatc tctcttcgat caagcacctt     65760
     gatggtgaaa atttttggat ctttttgttt tagaaatcct ttcagatctc agcccctttg     65820
     gggactccaa tcaccttgag gtactaatgt cattgttcgg catcatgata gatagataaa     65880
     taaagaagat tagattccta tcatgcttca tttagatttg acttttaaat taagcggttt     65940
     ccttgatatg tttgacgttt tctgacttta ttggaaggta acctgcaaaa tgcccttaat     66000
     ttactattga tggaaatcga atgttgttcg cgggctttcc ctgctggtta ggacactagt     66060
     aattacttat ttccgacagc cataagtacc gagatatgag ctccaagaga ctcttgcgag     66120
     tgggtcaaca tcgaaaataa agagctctga agtttctgga gacaaggagt atgctgtcaa     66180
     gatgataaga aaagaagaca ttcctttgaa gctctttttg agagaagtca aaatgcatag     66240
     attgatgaaa catccaaata tagttgaatt tgttgactcg tacgaagact aggatggatg     66300
     ttttgttgta ataaggttag gatgccagga gatggggagc ataatccagg cgggtgtagg     66360
     attgagctct gccctggccc atttctactt caaacaattg atttctgcag cgaggtatct     66420
     gcatggaaag gaaatatgtc atcgagatgt caaaccagag aacatgctta ttgacgcaag     66480
     tggaaacctc tcgctatcgg atttcgtctt ttcaacctta tttatacaga aggagaaaga     66540
     agaagacttc ggtcgtttgt aaaaggttta gagtatatgg cccgaagttt ttgagagagc     66600
     ttgcagatat gtggtcctgc ggaataagtc ttattgtgtt tctaaccggc tcatatccat     66660
     ggggcaaagc atctggtcgg acaagaaatt ctctggattt atattgatga aggactacgt     66720
     ctaggtacac aaaggcatag aaaactcgga aaagagattt ataatgaaaa tggtgactaa     66780
     agaaggcagc cgctggactg ggccgatagc tctgaaagat ccatgactta tgcagccaaa     66840
     cacactcctc gatgaatcgg atctctataa aggcccagac agtctgtttg acttgattcc     66900
     acatggatat attggcgctt catctcaccc agcccggaga agtgcataag acctcaaaag     66960
     tacgctttgt ctcttcacag cccagaaaaa ttaaaggaag agacgcccat atattgtaca     67020
     gaaaaaagga aattctcttt caattgtaca agagatgtgc aagtcacccg atgcaatagt     67080
     ggtttcttgg aaggttgtgg tctcgtctgt gattttttcc acggttggca ccaaaagata     67140
     gattctttcc ggagaaattg gagtcaagaa gttgagagag aaccactgtg caaccatctg     67200
     caggacaaga ggagatgctt gagtttgaaa agttcataaa agcctttggg aattgtttgg     67260
     gttgactgca agagatattt ggacggaatt ataaatggga tttgataaat aaacaaaact     67320
     aattattttc tcctgaaaac ctatatgaag aacacaaaaa agaatgaatg gaaaggactg     67380
     agttttggag cttggccaat tatgcaggga tatcagagaa gattgtcccg aaagattcaa     67440
     aacattttgt ttatgtccct ggtacttctt tcctttattt tcctctataa aaaatatttt     67500
     tttgtttgca gagccaagga ggaccagaga atggagaaga tgtgcttaga tttcataaac     67560
     aagaaggttg ataagtgctt acagcacaag tcgaggtacg accagaacaa agagtttgcg     67620
     gctatcaaga cacacttgcc gctgattcca ctaaagatga cacgatcgaa tgcggttttt     67680
     ctgtatacac acaagaagcc ttatgttgtg atcaaaagat gcattgcgcc agatgcaccg     67740
     gggcttgccg aggatgagat gctgaaatct ctggaccaca aaaatgttgt aaagttcttc     67800
     aagtcgttta gagaaaaata cgtgaatctg aaggaagagg aagagacgat tatttggata     67860
     tttatggagc acatggacat caaggtgtct caggatgttg tgaaggggaa tgaaaataaa     67920
     ataagagaga ttaccaaggg gattctgcat gggctccaat atcttcacag catgggaata     67980
     gcacatctcg acctgaagat ttcaaatgtt atgggaaagg aaacaaagga tgggattgta     68040
     tataagatta ttgactttgg atttgcccgg aggcttgcga atgtaggaga caatgccgag     68100
     atccaaattc cctcgaagag ctttggaacc tatccataca agccgcccga gacgtcgcaa     68160
     ctgaatatgc atgggataaa gggagacata tggtgcctag gagccatagt atggtttcta     68220
     tcgtggagac agacaccgtt ctactttgat gatgggagga agaacttaga ggagtggagg     68280
     atgtttatcc gaggaagaat tcctatttcc ttcaagccta acacatctcc tgcactgagg     68340
     aactttgtaa ggaaatgtat ggatttcgat agatttgcaa ggccaagtgc ctctgagctt     68400
     ctggagcatc cttttataac aggagtgcca atgaaggtaa ccgaggagga gataaacgag     68460
     atgagtgaag agttttcatc tagctctgaa tacagtgaca caagatctga agattaaaat     68520
     attttgtttt ggttggaatt tagctttagg gctcgtcctg tacatagttt ttgatgagaa     68580
     tccctttgat ggaggagtct gaaggattga gatatctgat gaagcttctt cccgagtaca     68640
     tgaggatagg aggggagagg tatattctgc accggattgg caggatcatt ggagaagaca     68700
     gttgggccac ggctatgttc tgccggaaat gcctttggct ctacattcct gttgtgaaca     68760
     gcaggatgaa atgtgatgat ggaattctga gggttgagtg ctatggatgc caagagaagc     68820
     atgaatttga caaagagaag cttggaattg taaaaaacgg tcttgaagtc aaggaagaca     68880
     gacttgaaga ttattttgga tagaaagttc ccaggggaat caaagctttg tttgagaaaa     68940
     aatttgccct tcgagatgac cgagcagata gaagtcgagt ctatggagtt ggcggcagtc     69000
     gcacacatca aggcaactaa gaacgacaca tttgttcata taacagacat gactgggtcg     69060
     gaaacgattg caaagatcac gggaggaatg agagttaagg cacagcgaga cgaaggatct     69120
     ccttatgcag ccatgcttgc agcacaagac gttgccgaga agatacttgg gcgtggggtg     69180
     aaggtgcttc actttaagct tcgaggggct ggaggagtca agcctatggc tcttgggcct     69240
     ggagcacaga cggccataag gactttgatc cgagcagggc ttaaggtcgg gcggattgag     69300
     gatgttacgc ctgttgcaag ggatcgtgtc aggaagcgtg gagggcaccg aggaagaaga     69360
     gtttgaataa agctgccttt atttatggat tttatttgac agcagcagac atgtcaagga     69420
     agttgaaaat ggctatttgt gtttctctta tcggcaaccc ttagatggag ttaccagacc     69480
     tctctaaatt cagagaaaag tgctgctact gctacgaaga catcaagact gggatatctg     69540
     tgtgtagctg tggtctttcg ttctgcaaag aacacaagga tcttcacctt gggaaggcca     69600
     aatgccaaat tgtatttgag attaaggaga ttggaaatga tctaggtatt gaaattaaaa     69660
     acacaatgct cggggaagcg gagattgaag aactaaggag gaggatggag acattggtga     69720
     ggtcggagga tgaggatgag agagtcatct tcagggacga ggaagtggta tgtatgcatg     69780
     aatgtcctga aggtccatgc tctatagatc taggagatgc tgggaatctt agctgcaagg     69840
     tgtgcgatgt gaaaacaaga ctgtgggtgt gttttatttg cgggtatgtt ggatgcggga     69900
     ggatgcagta tggtgcagaa gggaatggac atgcaagggc acattatgag gaaacacaac     69960
     acaatgtttt tgttctagtt cctagcctta taaaagagag ttgcgaggta ttctgctatc     70020
     tttgtgactc aaacataaga tttcactacg agattcccgg gaatattaca attgactttg     70080
     gagatgaggg aaaggcaggg aggaaaagag tgaagaagag gataatctgc aatgggattg     70140
     ttgagcagga agaaaagaaa ttgaaggcga tggaaaaggg aaagaatgag tcgattccta     70200
     gtccatatgt cgggattgtt aactccggaa acacctgtta tatttcttct gttctccaaa     70260
     tgataggata tgtagtttcg aaagaggaca ttgatatgga gcaacacttc gagatatgct     70320
     gtgataagaa tcctctggag tgctttttct gccagctgat gagggtttta aacagaatga     70380
     aaaaggctag gaaagaaaag aatatagata gtatatcgat actagatctg ataatactta     70440
     tatggagaga tatgcctatg ttttcgaagt ttatgcagca agattcccac gagtttttac     70500
     ttttcctcct tgagaagata cgggaaggag aaggtttata tctgattcca tcgataacat     70560
     ctttctttga gtttgaggtt ggaagaaaga tcagctgttc aggatgcatg gataagtcta     70620
     ccagctatga atctgcaatg atgatatgta catgtctgaa gggcgacata agaaggtctg     70680
     tggagatgtt tttttctcct gatgagtgga actgcaagtg tgggggaaag aagaatgtaa     70740
     gtcggtttgt cacaattcct cccaggtatc taataatcca agttggaaga tactcttata     70800
     ataataacaa agtggagaag atcaaaagca agatcgggat aaaaagtgtc aagctaaaag     70860
     actttatgag caaggacgaa gccgacgaat ccctcgccaa aaagctttca gatgatggat     70920
     attccttgga ggatgcaaaa agggctttag gcatcttctg caacgacgaa ggtaaggccc     70980
     gcagcttcct ggaaaggcaa agttctgtag tctcgccaga agacttaaag tacagagttg     71040
     tcggatgcat caatcattct ggagataata tcaaggcagg acattacacg tggtgggtgt     71100
     atgaagatga aaagtgttac aaaatagatg atacaaacgt tcttggtagc aatgttgaag     71160
     tattggaaga tggctatata ttcttgttta aatgagaact atcccaagtc ccagtagaaa     71220
     ataaacttct gtgtattcct gtttcatctc aagtgttgtt gagatagaag ccctccaaat     71280
     cacccttgag tggttttgac cttctttctc caagaattct cttaaccgta gcccatgaat     71340
     acctaacccc gggtggaaat ccaaagactg cattggcgtt ccttttcagc cacttgattg     71400
     tatctggatc gctgggatat cccgacccaa ggttgcttcc aaattgggaa attagaatgt     71460
     ctctctggac cttggcaact atactagctc cagaaacaat ctggaacttt gaatccgctt     71520
     tttcttcaat cacaaactta tacggatagg cctcttcaag tctagccttg tatttttcgc     71580
     agtccccaag tgcgtccaca tagactgtat ccactttctt gcatttggct tttatttcct     71640
     ccagtatctt gaggactgat atcaaagata tttcattgag gctggtggac ttgacctgca     71700
     tcatttctgt gatgtagtct ggatgagtgc aatggtaaac atatccaaat cccctctctt     71760
     ttatcatctt aaagaagtca tgtctttgcc cagatgtcag gacctttgaa tcccggaatc     71820
     ctgtgttttc caaggtagtc cttgaagaaa taagagctcc gtacaccatg tatccaatta     71880
     ccggccctct ccctgcttcg tcaattccaa ccacaacctc ttccgaaatt tcctcaaggc     71940
     tcgaaaaaaa gatgttctta ccttccattt agaaaaagga tttctaaaat ataagatata     72000
     ttgccaagtc atttattcaa ccgatctgca aatgttggag tacttgagcc aataaggatt     72060
     cttcactcgg tcgaggtcat ggtcaaagtc tttcaaaact tctgagatct ctgtgaattc     72120
     aatcttatcc tttgagaatc caacaacccc aactccgcat ttgcgaagac ataggtcaac     72180
     agcttcaatc cccagaattg tggcatttat tctgtctatt ggtgatggat ttagtccttg     72240
     ctggacatct ccgagaattg agtagtttgt ttcaaataga tctccactgt cggtctttaa     72300
     gatctcacat aagctgctcg taggaattga ccggaaggtt ctttcatttc ggaatatcac     72360
     aattcctctt cttatctttt ccctgaactt cacacggagt ctctgtgcca cttcggagag     72420
     atgtcctatg agatactttc gctctgggat aaaagcttca aatgcacctg cagctattcc     72480
     tcccattagc gatagatatc cgcagttctc ccctccaatt tccaccacaa agacattgtt     72540
     cttatatgca aacgagttta gctttgacac gtccgacacc tttataattg tgttgagggc     72600
     tgtgtctgct ccaatgctta tgtctatttt aggaatgttg ttgtaagatg atgcaggcac     72660
     gaggacaatg ttcacccctt tgagctcctt gattgtattc aaggctttgc tccctcctat     72720
     aataatcagt gagtccagtc cagactcaac taccttcctt tggatcagct ttatgtccac     72780
     ctccaagtct ccaccaactc ctattgcaga tcccccgttg ttgacatctc caaagaattc     72840
     atagggctta gcccttataa gttgattgtt cacaagacct tcaaacccat ttggtatgta     72900
     atatggctct gctccagcca ccagagaata ttgaactaca gcattcaaca ccgtgttcat     72960
     cccacttgct cgccgtccaa actgaagcac tcctatccga ggctttctat cttcatattt     73020
     ccctctgcag tctggcccac aactgcattc ggtttcgatc ttctccctgg agctacagtc     73080
     acagccctta tctcttatgt tccgaattcc tgtcatcaaa gactttctaa agtatgaata     73140
     agccagcctg aagaagttac acctactttt cagaacatct tcaaacaatt tcttttcctg     73200
     gaaatctctg accagattgt ttctttctat aacctctttt aattcaatct caaagatctc     73260
     gtccctaaag atgctgatca tcaccgggtc ctttgtaggc cccaacgata tctccacagc     73320
     cttgaccccg aggagagtac catatatcct atcctgtgca gaagtcggcc cacccctctg     73380
     aatatgccct agcttgagga gccggacatc cattccaaac ttggcaattt cttccacagc     73440
     ttgggatgca tgtatgggcg tcccatcctt ctcaacagct ccctccgaaa ctataacaaa     73500
     agtccctgcc ttcccgcacc ttcttgctgt tgtaagtgcc tcaatcattt cctttttcca     73560
     ctcggtaggt gcctcaggaa gcaaaacata gtctgcagaa ctcgccaatg cagacataag     73620
     agctatccat ccacacttcc tccccataac ctcaatgaca aacgtccggg tatgcgattt     73680
     cattgtagac attagatgat cgattccttc aataactctg tggatggcag tatcttcccc     73740
     taacgaaatg ggaaccccac agatgtcgtt gtctatggtt gccggtattc ccacaacctt     73800
     caggtcatag acatactttt ctatttcgtc caggtccatt tcttcacaag agcatttgtc     73860
     catttgcaag tcctctagca tatcatcgga cgaattaaga tcatggtaaa ccataggtgt     73920
     ctccttataa cattcaggag ctccatagaa atccgaatat ccaaccccgc ttgtttcggt     73980
     ggtgactttc tctttttctt cgtccttcga ttctgccttg ctgttcagta tcctcttcag     74040
     atcgcgggga gaaatctttc cttcccttat gagatctctt agatgatcct taaactcgtc     74100
     tcgaagaacc atggctccct tcatagaccc atctcctcct agcactataa cacagttaat     74160
     cttcttccgt accatgttca gtactgcctc tttccttccc tcttttccca taaacttctg     74220
     ggaccttgca gataggagaa cagtccctcc ctgactactg caatgtgtct ctgtatccca     74280
     gcttagcctg cggatgttat tgttgataag tccatcatat ccgttataca ctccatatac     74340
     agatgctccc cacttgatcc ctgtccttgt tatgctcttg atcgccgaat tcattcctgg     74400
     cgcatctccc ccgcttgtca caattgcaat cctattcgtc tttccttgcc cagaaaacgt     74460
     aaccacaatc ttgtttccca tcatgtccat catctcaagt ggcattccac ggccgttctc     74520
     gttgacaagc cctcgcgtgg tcaagcgccg tagtgctttg tatgaggtgt gaatgtggat     74580
     tccagggctt gtagatgtta tcttggcttt cctggtgctg tatatcttca atgttcctcg     74640
     atcatatatc acatcaagac caagtagttc atacacctct ccatgcctct gcagtatccc     74700
     gtctccagat agttgtaact cctcaatgac agcttccata tctccccttt agagatcgca     74760
     tttatctctg caataaccaa tcaaatcgct acccagcctt caaactaatt atcgagacca     74820
     tcttcaattt gtttaaaaat agaaaccttt aatatccaag gcaatttaag cgtaattgtc     74880
     taaatttagc aacctagatg aaataagaaa agcgaaggag gggattcatt atgctctctg     74940
     cagatgggaa agagaacgag atcggcaaga gcttgataga agatgcatct ttgtttctgt     75000
     ggtttgtaaa tgcagtgaat tctggtggat gctgtaggga aattaagagt gaggaggatc     75060
     tgtcccttgc ttccaagaag aagattcacc aaaaaataaa gtttaaggca tatagcatgg     75120
     gtgccgaaag tattatgtat gaaaagagaa atgagatggc cttcgaggag gatagaaatg     75180
     gattcatatg tgcacactgc gatgcaaggt atgtgtataa aagatgccta gcaaatcacc     75240
     tcataaaatc tcaccacata aattcaaata cactctagta ggcagctata tcgaactgtt     75300
     caacgaaatt ttaaagtcct tacctaacga gtatagatgc cgaaaacata tacaatagaa     75360
     gaatgcttca ttggagtgtt tgggtctgtt tattcataac tggctgtcga ggttggaaat     75420
     ttcaaatgtg aatcttcttc gaaggaagaa tctctcgtca tctctcaaaa tcttgacttg     75480
     gaccttctgg aacatctgga agtggccttc tgaaacaaca acttcttcaa ggttgtattc     75540
     aggaacatac accacaaccc cattcgcctt gatgtttgta ataaatccct ctacaagaga     75600
     ttccctatct ttgagcattg tgtaaataat caccttgcca cactcccaag atgctttttt     75660
     tgccgatcga tatctcgagt tcatgttccg gcacatgtcc tcatcggcaa acttctgact     75720
     ttgagtctct ttctccgtgt tctttcttgg cagaaatgtt actatcccta gcttacttgt     75780
     atgtatctct tcaggatgtg ctgtctggag aatatgaccc aagatcctgt ggactatgat     75840
     gtctgcatat ctcctgattg gagaggtaaa atgggtatac atcggtgttg caagcccata     75900
     atgatggaag ttggatgtct ctccagacac aacatacaca gcctgattca tggatcttat     75960
     aagcatcctt ttcattaggt ctttcttgag gccttcaacc ttgttcagaa gattcccgac     76020
     actttcggag gaggcatcga ttccaaggtt gtcatccagt acagatggag ggggatgctt     76080
     tctaagcaac gaagagtctg gatggtggtg atatataaac gaggctaccg aaatatttgc     76140
     tagaatcata aactcttcaa caaggaagtt tgttggaagg cattccttaa cttcaagctt     76200
     tcctcctcga aatgtaagct gtcttgtgct tagatccaac gagcccttct caagccttcc     76260
     attccgtagg atcttactca tccgaaggag tgttgccagc gaggagagta tctcctcttc     76320
     agcagctgaa aatcccctga taacatcata ggcttcctga tagctgaacg acctccgaga     76380
     tcttattagg gatcgggaga aatgtgttct tacaatcttt gcgtcgttag acatctccca     76440
     taccacagaa aaggccgctc tgtccttccc agcaactaag ctacacaagt ctgtacttag     76500
     agaaggaggt agcatatcga tacgccgttc aggaagatac accgttgtac tcctatccct     76560
     tgcaaccttg tccatcttcg agtcctttct gacataatac gccacatctg ctatgtgaac     76620
     accgatctcc cagtttccat tgggaagaag ccggcagtga agagcatcat caatgtcctc     76680
     acatcctggt ggatcaatac tcactgtagc tagatctcgg aagtcttctc tacttccctc     76740
     ctcaatctcc cggtatattc tttctattcc aaacctctct tccgattccc aagaatcccc     76800
     aagtatatcc ttccaactgc tattgtagta tgttattcca tttgcaacaa gtatagcttc     76860
     cacttctgca tccttgtctc caatggtccc cagccttctg tagtagtggc cgctaggata     76920
     gttacttgtt ttctcccatc catcaatctc aacacaaagt ctcttgttca ttaattcctc     76980
     agcttgtcct gttcttattc taaccgccgg tattctcttg tcaattggga tcaccagcac     77040
     attttgggtt cctattccat gcaccgttct tggggatata gtcccaacaa tcgccctaca     77100
     cttcctcctg taaatcccaa caacctttcc aaacatttcc ttgtcttcct ttctttttct     77160
     tgtttccttc agaccttctt catcgtccac caatatccca tcttcatcac actcgtctat     77220
     ctcctctaca tatacctcat ctccatttat cgctctgttc atattcttct tcccaatcac     77280
     aagaatcttg acgtctccat ccactacaaa tccactatag cagttgtaca tgctaacctc     77340
     aagcattcct ctgtatagtc ccttctttcc atactggaca tctagatttt ccctgtagtc     77400
     ttcgtactcg gttgcttcct tctcatccac aatagacaaa agatcttgga tatcatcaga     77460
     gacatatttc ccatactccc aaatattatc catcgttagg atgatgaatt tgtattgtgg     77520
     cagatggtct ttgtagaact ccagaactcc ctcaagcccc cttccactgg tcgacttaca     77580
     aaagttgttg cagaatacag catatccctt ttctcttgca acatctctta aacctttctc     77640
     gtcattcctt gagagctctt caagagccga ctggcatatt attgctgcaa cataatcact     77700
     cttaagcaat gctcggtatt tggacataac tgctgcatca ggaatcacaa acacagaagt     77760
     tcttttattc tccttgcaca tacctccgca acactcaaac ccacagggca catcgtccct     77820
     aacatagtgc tctcggaccc tcttgatcag ctttaatctc ttagatatct ttctttcggc     77880
     cacaattcca taccacatta aagggattcc caatagaagt taaaaactta tcgaagataa     77940
     aataaggaac cgtttattat ccactagacg ccagtccggt cttctccttg actatccttt     78000
     cctcgtcagc aagaaatgcg ccggtgatct tttccttgac acatctgcca cagatcgtgg     78060
     ctccataagc cctgttaaca cgccttgcag aaaccttttg ccgagaaaac tctgcaggcc     78120
     tcattcgggc tatgcttccc aggacagtgt tgcattcatg gcatctgtgc ttcttggaat     78180
     gtttcttcat tcttcggttg acaagtttcc cagacggtgt ccttatcttt attctcctgt     78240
     tgctacgggt cttatatgtt gctcccttat gaataagaac tttcttcatt ttctttgcaa     78300
     gggggaaatt tttgtcttct tctgtttcgc atactgtgcg catggttgta agcttatata     78360
     tttagcagct tgagtctggc gtatgcctca tcgtccttga aaaggctcac aatgttaaca     78420
     tacttcattc caaatatcga cgaaagttct ctttctgccc cggctggaag agcatacagg     78480
     tctattccaa aatggctgca gaacagtgga aggtgcaaaa acaaaacatc atctgcaggt     78540
     gttatgagaa cagcacctat gtctttttgt ccttcttcgt aatgtttcat cagctggttg     78600
     taggtgacca aggccttttt tgttcctcta aggatcttgt agacgcttga agggtcgtct     78660
     attgtcttta caatgtggat gtctgtgtga aagatcttct tcatggcaaa ggaccgggtt     78720
     tctggtgtgc agatatatct ggattctaac gaccccaaaa attttatgaa aaaaacgatg     78780
     gagaaggtga gcaaaagcga ctctgagtct ggaagcgaat ccagctctga ggcgtctgta     78840
     gagtcttcag ggagttccag ggagtcgatg ggctctggag aggaatgcac agagaccgag     78900
     tctgagatcg aggaggagac atcgagcgga agcgcagagg aaagcaagag agagaatcca     78960
     tctcttacag tgttcataaa gggcataagc tatgacttga cggagtacga cttgaagagt     79020
     gagatggaga agataggaaa agtagcccgg gttgggattc cgatgaccaa tgactacaag     79080
     cgtaataagg gctttggata tgtggagttc tgtaaggaag aagatgtgaa gaaggcgctg     79140
     aagctggacg gtactgtttt tcttggtaga gaggtgattg tgaacatggc acatcctcga     79200
     accaacaaag agaaacacac aatatacatt tcaaacctcc cgttcgaatg tgacaagaag     79260
     aagttgaaga agtactttga agagatggga gaagtggttg ggatgtcttt cccatatgat     79320
     aaagaaaatg accgattgaa gggatacgga tttgtcgact ttggaaacaa ggaggactat     79380
     gaaaaggttt tgaagaagaa actggttttt gaagacagtt ctatatacca gagaccggct     79440
     tataagaacg gtagggagga tagaaaggat tttgacagaa gaggacctaa aagaaacgac     79500
     tccagatgga atggaaaaag acatggaatg gacggtcaga acagaaacaa caataagaaa     79560
     gttaagttta actctgatag cgaggaataa agaaattctt tattattttt ccggttttcc     79620
     attagaacaa acagtcgttc cgatcccctt tgaatggccg aagcttgttc cagaagaaca     79680
     ttgtacataa gaaacttgaa caggcggctt cccataaggg aggtgaagag aaggctgggc     79740
     ttgtttgttt cgagactttc ccgggtgtca aagataaaga tgagcaacaa gcctgggctc     79800
     ttaggacagg catttgttca tctggatgga gaaataacca atgagattct ggatagtcta     79860
     aatggaagat ttttccttgg cgatgtgatt ctggcatgtc ctgcgcgtga ggatatgtgc     79920
     attgggaaga ggagaaccat tgtatccaca aggtccttgc tagtcactgg aattccctcc     79980
     ggcatgacca gagaagagct tgtagacatc ttcaaaggct ttgaaggcct agaagccgtg     80040
     agactcatca aggtaaagag tcttgccttt gtagacttct cctctcctca agaagcatct     80100
     actgcttact catactttga ggacggacaa gtgaaacata tcctcgggga catgaagata     80160
     atgccatctg catgatggaa agcccaaaag cacatagaaa cttccattaa aattaccgca     80220
     ggaatctacc ttgtcttctt ctcttaacac catccctttg atgtttatct tcaagataca     80280
     tcttgtctgc tttgacccgt cctccaaaca ctcctcttcc atactgtctt ccctccacaa     80340
     acccatagtc cttgtcgatt gtcaatggga cctggtcgat ccggaacccg tttatgtatc     80400
     ggacagccat atctgcagaa cagacctcat agaactcgac aaagcagaat ccacagaatc     80460
     taagtgtgtt tctattcaac cccattataa ccctttttac agccccacac agcaaaaata     80520
     gctcccatat tcgttcctcc cgtacgttcg tggggacatt ggatacaaaa atagtagacg     80580
     agtttttctt tgcctccaga tattcttcat ctgtccctac aaatgtcttc tctctgtaga     80640
     agtatcctcc tggctctcct ccaaagtact tttccagagt ctccatgggc ttcggaactt     80700
     ccaaggattt gtcctaaaag aaagcaagaa atatcaagaa ataggtttat aattgtgtaa     80760
     gcttaacttt acaagggatt ctgatccaga gactaaaatt tggcatgatc tatgagaaaa     80820
     agactaacga agaacatgta gaacgatctg caaagatggt ccatgctctt gaagtggttg     80880
     cggtgtgtca gagaaagctt cctgctgagg atctcaagaa caaacacaca tccaagtaca     80940
     aagacaatcc ctccattccc tgtgtacagg agtaggaaga aaaccataaa cttggcaaag     81000
     tcctctttgg aaatccggat gtctccaaaa agatctacaa tgctctttag ggtcaatatc     81060
     tttttcctat ccttgacaag atagacgttt ccgttgaaca ccacaaggtc ttccggatca     81120
     accatcatct tggctcccgt ctctttaaca gacacggcaa ctttaacaga tatgtcattg     81180
     gtttccacct cttcaaagaa gagcctttcg gcatcagggc tgtgcatctt gcccatcttc     81240
     agaatagaga cgtcatatac aagttgaagt ctctccttgc ccagtgtgcg gagctgaact     81300
     gcatcgctca caattttccc attgagaatt atctttattc cattctcgat agactctatg     81360
     cagtagccct ccatctgact tttcaagtac tgtttgacgt ggagtattgt attatcagac     81420
     tcaaactcct ttgtgtatgt gtattctcca tctttcgatc taagggtaac tatggtcatt     81480
     tccctccctt ctagcggggt tgtttatatt tcttttgtga tcaatcagat ggtctgggag     81540
     aaaaggggga gagacaatga ataggaatgc agtatcacga gtttgggctg agccatagga     81600
     agtagaggca aggagatgta gaatagcctg aactacgggg agttttgagg ctcttgattt     81660
     ttgagaaaaa tggatcccta cgaatggggg ttgacttgaa acgcctaagc gagctgttca     81720
     cggtgagatt tgagaaggaa taccggacat atggggaata ctttggagat attatacacc     81780
     tttccaagga ttcggggctt gaagagatgt tttgcaagta tgagaagaac attttgaatg     81840
     aggaagatat tctgggatat atcacaagca gtagtcccag taatctgaag cattttagca     81900
     ggatttatga atatgaaaag ggcttttgca agaggacggc ggtgttgctg ctgaagaaga     81960
     gatatgagga ggaggaatat gacaagaacg caatcttcca atgcattaga aagctgtccc     82020
     actaccttga gtttaagttt gtgaaagata tttgtgacga tgaatgtctg gcgtttatta     82080
     tcggggagta cgctcggaag catgagtttg acgagtcatt tctagacgag attgcaaatt     82140
     tcttgccatc agtgttcctg ggatacacac agttgaacgg tcttttgctt gattccttcg     82200
     agagatcatt tgagaaagta ataagaaaaa gcttggagat tctttgggtt gtcgattgtt     82260
     cgaataagag agtggcccgg gccatttcaa ggagcatgga gaagaaaagg atctttgaat     82320
     atcttgcaag taacaacttg gttggggagg accggctagg agagatgatg agtgttgttg     82380
     ggagtgttaa tgcccagatg tttcttagcg atggggtttt tgggaggctt gaagaggaga     82440
     gagcagtgaa gtatctcgat ggtgtttctg ttgaggatgt tattgagatt ggaatacttg     82500
     gatgtgaatg ccgaagattg tataagattc ttccacgggt atttgagaag aggaaggaga     82560
     gttttatgaa agatggaagg attgtcaatg ttctgctcct tatggtttac tacaattcca     82620
     aaataagatt tggagacaca ctcggacttc tagggccttc tctagagaga gagttcctag     82680
     aatacaggga gaaagaaata cggaagattg ttgtggatgt tgacaaagac agtggagaga     82740
     taaatgagaa ggaggaatgc tcttcagatt ctctgggatt cttttctgaa ggaaatgagt     82800
     tccgatttgt cagggaagga aaggctggga aaagagatat cttggaatac ttgaaggaaa     82860
     tatggaagga ggaaggagac tttattaaga atgttaggag gaagctagga tttggatgtt     82920
     ttcttggcaa cccttcaaaa cctacctttg accaactgtt ggaacttcca aactactact     82980
     ttgtggaatc cctcaaaaga tataggaatg agtttctgga cttgctattg gagttccatg     83040
     agatagtggt tccaaccagc cgaagaagga gtttgattgg aaagaaaatt atatccagtg     83100
     gatacaaggg gctctttatc agatatctca taagaaggaa taagtacttt aaggttgagg     83160
     ttgagcttag catgtggttg aaagagatgt cacccgagta caaaatcaag tatttttgtg     83220
     attatccgat ggctctgatt ggaagggaga gccaggtgct cgagggtcta ggaagcaaca     83280
     tctatatgtt atatcctgtt gtcttagagt tggaaagaag aagcgtagca caggaagtga     83340
     ttgatcagat caaaaagcac atgattgggg cgggcagctt tggcaaaaag aaatgcgaag     83400
     aagccagtag gttagaggaa gtcaagaaga taaaggaaga agagtctacc aaaggtagag     83460
     aaagcagaaa agaaagcgtt ctggaaaaga aagcaaatga atgggaagaa cagacaaaga     83520
     gaacaagaat ggagggcaaa gagaaagaag agaacattta tgacgacaag tatcccattg     83580
     agaagatcga ccatgttctt ttcaagaaga gaataggatt tatatgcaac gagataaaca     83640
     agaggatttt gaatgggaac gggcttcaga gagcaggaag ggttacctcg atactggttc     83700
     gggacagaga aatgcttgaa aggatccagt cgatcctgaa tggggtgaat agatttggaa     83760
     aggatcttac aaactttgta aggttccttg catttttcct ctcttattgc agaatggaag     83820
     tagatatgtt ggacacaact cttaagactt tgaagaggta catctctgaa gaagaggatg     83880
     attctgtttt gtattttgtg tttatgaaga tacgattgga gcaagtggaa aagttggtgg     83940
     tggaattcaa ggaaaacagc tttggagtta ttcacaaggc gatgtgcgat cgaatccagg     84000
     gggtcaaaga aggagaggct agaaacatgg tggaaggctg tgtgacagtt agtactaatg     84060
     ttgttcctgg agcaaccaag aaaaaaagag gaggaggaat agggcccgac acagttgaaa     84120
     tctgggacta caaaggacag acggagagga tccagaagat tgttatggca tttctatctt     84180
     cgggagacga aagcatgcag tacttgggcc tggagggctt gaaggcattg ggacaaagag     84240
     tggatgtgga aaagtttctt gattcgaaaa gcgatcgggt tgttgaaact gcattgagta     84300
     tggcaataga aagaggaatc acatgcgacg ttaatgaaaa acttatgaaa atactctaca     84360
     gaagggggag actagacagt cttgggaaga tgtgtctcag agctgtgaat atagacgcct     84420
     tggagaaaga ggatgttgac aggatctacg agatgttctt catcgatcca aaaagttacc     84480
     tagagatctt gccaagaatt ttagagagag gctacgaact atccgaagat atagcagtgg     84540
     agctgacaag gttattgggg agtagccaat gcgatgaagt tcttgggaat tcgatgaagg     84600
     ccctgaagaa tgttgagtac acagcagaga tggcttttga aggaatcctt gcgcttgaaa     84660
     atgccaagtt tactccaaaa atgtttctgg tggagaagat atggaggtct ccgtccaatc     84720
     ttagtacacg ggggtttctc aggctatgtg tttgtgtgtg caatgaggaa aactatgctg     84780
     tactaaaagg actcctacag atactaaaga aaggaggtgt tcatgcagac attgttgaaa     84840
     agtggaagaa aaacaagtcg ttagatagat taatggcgag aatatatcct ctatgcttga     84900
     aagacaagat atattatcga gatatcctag acagtatgaa gaaagatgca gaggagtgga     84960
     aatttatcaa tgaattctat agagatgagc ttgaggctgc aaggcttgtg gataagcatc     85020
     tgtcagaaag ctagaaagtg catctttttc tgtgcttgtc taaggatgca ttgtaggcat     85080
     attccttgcc gcatgagcac ttaaagggct ttatcaaaag atgggaagat cttatatggg     85140
     ctagaaggtt ccccttctta ctaaactcaa acttacaata ttcacatata tgtttcttcc     85200
     tcctaccatt aaacacttta acatgatgac tctctgtatg gacatcgaac caagatttct     85260
     ttttgtactc ttttccgcag atggtgcatc tatacttcag acatgtcttc tggtgcctct     85320
     gcaacctgtc tttcgtgtgg cacatgtacc cgcatctttc gcatttgagc tctggaggga     85380
     agtgcttttt cttgtgcaca gagaggtggc cgttcttcat gtaggatttc tcacacatgt     85440
     cgcatttgta gggtctgttc tttgtgtgtg agttgaagtg gtcgttgagc ttggattttc     85500
     ttgaaaacga ctttccacag ccttcaaaac agcagtggaa gatcatggct gtcaagggtc     85560
     atacgaacca aaaaatttaa tgactactag cctccgtgga tggtagagat aagaacgatg     85620
     tgatctccat acttgaccgg gcttttctct cttcctgtta tctcccagtc catcttgttt     85680
     atgatgcaga ttgttccatt cacaagctct ccacaattgt cgaagtagct gtctctggtt     85740
     tctccatatc ggctaaacaa atacttcaga gcatctccaa ctgtcgatat cgatgaattc     85800
     tctatttctt ccttactcag ctctatctcc ttgttgttca gttctacaac acttgcccca     85860
     ttgaatccaa ttctcatttc ttgggtctca gggatcgggt gttttcattt ggtgagaggc     85920
     tagaagcagg ctttgtggat ctcatcaaat ttgtcgtcca gagattggct tttgaagact     85980
     ccctcctcca gtgaggatga tataagggct gcagcaaaca cacagtggat tctttccaga     86040
     aatggacgag gatttctttt ggaatggata aacagtgatt tgtatccaga aggcatcata     86100
     tacacactta tcctcaggtt gccgtgtctt tccaggcagt cgaagtaatt ggagtttgtg     86160
     gatagtgttt tccagcccag tgtgtctatt gatccgtaga tcagaatgat gagtctgtag     86220
     tattcctcat tgcttgttct accatacatt ctttggtaaa caatgtcatt cttctctgag     86280
     attatgacca aaagctctcc catgggtttc caggttctgt ttagtttctc acaggagcat     86340
     ccttggtttg ttggaagaag aaggtaacag gaaaaagaag ccacagacat gtggaaagct     86400
     agaagtattg ctgtgtgtgg agaagactgg ccaggtttta tttgaaggaa aaatttgccc     86460
     ttcaaatgag agaaatcata cacttgcaga caggacagtg tggaaaccag gtaggatgca     86520
     agttttggga gacaatcagc ggggagcatg ggattgacca gagcgggagg tatgttggga     86580
     catctgacaa ccagcttgag agggtgaatg tctactataa tgaggcatcc tcgaagaaat     86640
     acgttccacg agcagttctg attgatcttg aacctggaac catggatgca gttaggcagg     86700
     ggccatttgg agaattattc aggccagaca actttgtgtt tgggcagagc ggagcaggaa     86760
     acaactgggc aaagggacac tatacggagg gagccgagct tattgattct gtgatggatg     86820
     tggttcgaaa ggaagcagag tcgagtgact gcttgcaggg gttccaaatc acacactctc     86880
     tcggaggagg aacgggagca gggatgggaa ctctccttct gtcgaagata agagaggact     86940
     ttccagacag gatgatatgt acattttctg ttgttccttc tccaaaggta agtgacacgg     87000
     ttgtagagcc gtataatgca acactttcaa tccatcagct ggttgaaaat gcagatgaga     87060
     ccttttgcat tgacaacgag gcactgtacg acatatgctt ccgaacccta aagttgaaca     87120
     accctgggta tggggatctg aaccatcttg tgtccttggt gatgagcgga gtgacaacgt     87180
     gcctgaggtt tcctgggcag ttgaatgcag atcttaggaa gcttgcagtc aacatgattc     87240
     cattccctcg gctgcacttc tttgttgttg gatttgctcc tctgactgct gtaggcacac     87300
     agaaattcaa gacctactct gtctccgaac tcacacaaca gatgtttgac tcgaagaata     87360
     tgatgacggc atgcgaccca aagaagggaa gatatctcac tgttgcagca atgttccgag     87420
     gaaagatctc gatgaaggat gtggatgagc agatgtcgat ggtacagtca aagaacagtt     87480
     ctctatttgt ggaatggatt ccaagtaatg tgaagacggc agtctgtgac attgcaccga     87540
     caggcctcga aatgtctgca acatttgttg ggaacacaac atccatccag gaactcttca     87600
     agaggatttc ggatcagttt acagtgatgt tccgaagaaa ggccttcctg cattggtaca     87660
     caggagaagg aatggatgag atggagttct cggaggccga gtcgaacatg aacgacttgc     87720
     tttctgaata tcaacaatac caggatgcaa cagtcgagga tgccgaggag tttctagtta     87780
     attaaaaggt tagtcgtatg tctctctagt tacagatgtg tgggagttct tgattttttg     87840
     tcttattatc ggtatcatga ctgataggtg tggcaaatga aacaagtttt ggactgttgg     87900
     atttattgtc caggccagac gaaacacagt gatggcatat ctgctggaga aggcaaatgg     87960
     atctcgctgt gtgctcgaag ccatcaaggt cgagccattt acgcagaagc agtttgcaga     88020
     catgataaaa gaagctcatg taagatctca ggactattac cttgcaagag tgcagtgtaa     88080
     gaacatctcc gaggacggga agaatgtata ctattgctac gatgccaaac aactctgtaa     88140
     atacatattc gaaatggtaa tttccacaga aggaagaaag ataaggataa agaacttcaa     88200
     ggatccgata aatcaagagc agatccatga gatcagcttc ttcaagctga gatacgactc     88260
     agacactcct ctgaaggcag aatatgttgg aaaccaagcg aactttcttg aaaacaactg     88320
     cttccgcagc aagatatttt accaggaaaa tgctctggat gccctgtctg tgaacttcca     88380
     gtttggccca cagaagaaga aaataccaat catcaacaag aaaaagatat ttacagtgct     88440
     catgatggtt gtcgtgatcc tggcaatagg aacgttggtt tccatggtgg cagagaaggg     88500
     gtctcaaaag gcctcccgcc ctctcaagct ctcgataaac aaaggaaaaa gtatttaata     88560
     aacgcctctt ccacacttaa gtctttcttc caaagaacgg agcaaacttc agtgcaggcg     88620
     gcaagacaaa gaatcgaatg cttgatccac gaatcacaac ctctttcctc ggtatgcaag     88680
     agctgttgga agtgacaaca gcatcagtca ggataatgtt catatagtcg tcgacttctt     88740
     tcatctgtcc cctatacata tctccgctgt tggtttctac agtaacaaca aatccctgtg     88800
     cctcatgaag tagcttcaaa ggaatcgtta cccccataga ctggggcaaa caattcattg     88860
     gaggatgatc ctagactttt aattgttttt tttttcttgt tccttctcct tgttgtcgac     88920
     gtaccaggag ctgttacgca gattcctatt cctcctgaat ggatttgaat cgctcttccc     88980
     cccaggattt tccgatggaa tatgtctaaa cgcatccaat ggaggaacat atgccttttg     89040
     ggttcccgaa gagtggggat ttggaggcct atacaccttg gcttcctctc cttcgcttct     89100
     ccaatgtgca gatctggtag gcttgggcat ggggacttca atctttctac caagctcttc     89160
     aatcctctga gacaggccct ttcttgcctc ttcaacaagg tccaaatatg ctctgagctc     89220
     ctctctctta gttttaagtt tgttttcttt cttctcaaaa gcctcctttg cttccttgtt     89280
     cctcttctcg taccaagcat cttctattcc ctttgcattt ttcatgtagt atcgagagta     89340
     catcttcacc ttcttatagg ccgaagaaaa cctatcgcgg aacttgactg tcttttttgg     89400
     acggcttggc tcttctttct tcacaatctt cttttcctcg gaaatcctct tcctttctat     89460
     cacaggcttg gaagctgtcc ttgttctttc tttgtattcc tctatgattt caaacacttt     89520
     cctctcaacc gtcttgtact catattgctc tattaaaatg tatgtcccat caatactaaa     89580
     cctaaaatca ttcttcttca taaatgcaat cagatccatg ttctcctcta ccagaaccct     89640
     ttttccaaca cattccgagt attttcccca catctcgaaa tcaaacttcc ttcgtataag     89700
     agtgtttcca gacacatcta ttccagaaca tcttttctct acattactaa gaatctcagg     89760
     cagattcaaa agcctggatt tgcagaacaa tttcttctgc ttgtcccctt cgttcttgag     89820
     aagtgcgtac gaacataatg tgcgaaagtc ttcaatgctg cattgcttct gtatacacct     89880
     gggctccaat gatgtaagaa tattgatcac attgacatat gaaaatagca tacccgactc     89940
     aaggaaaaag ctgccaagaa gctccatata caatattgct gtattgcttg atgaaaactt     90000
     tcccatcgac gttacgatct cacatacctt ctcacataca gcataggatt catacaatgc     90060
     ccctcctttg cttagagtcc atccaagacc caggagaacc tcaagaaatg tcccatacat     90120
     cccttccttt gtagacgcag gcatctcatc atacatcttg ttgaaatact caaaaacccc     90180
     cttgcactct tcaacactgt atcttttctt gaccgactcg acccatggca taagcacccc     90240
     agccatacct ccatacagtc tgttccgaag aaagtggtta ccaaacacct cataaacatc     90300
     cgactcccag tcgtttcctc tgctggaaaa tgcattgtaa aacttttcca catatccagg     90360
     attatattta tgctcaatca gaagcttttc cagactgtct gtagatcccg attctttaat     90420
     cttctgagaa acacgcatca catcatcgct tactactcca tcctcagaat ccatcctggg     90480
     gctaaaagat tcatgcatat tcaactccag gatatccctt ccaagggaac atctaactcc     90540
     acttcatctt attaacaact tcctgcataa gagaacttgc caccccgttt aagccacttc     90600
     tgaccccaaa gccccgtccg ttccttatgc cacaagtgaa agacgcaata aatggtgggg     90660
     ccagatgtct aatccatcca gtggccctaa ttgcccttag tccatagtac agagacgaat     90720
     atatcatggc gtgctttgcc aactcccctc ctctccttag ggagagtcta gaatggggct     90780
     gctcctccct ctgcttaaac atgctactgg caaatgccat cgagcatcca attgcaaaag     90840
     agttcccagt tgtctcgaag ataactagag catagtctcc aatgctcata tgtggggttc     90900
     tgccaaagcc cttatctctc aaaccacacc catgaacaga acaacagaat acctgaagca     90960
     catagacaag aagacacaag ctcctccaac ttcaaagagc gagagcttct acgacaccat     91020
     caatataaaa ataaagagga tagaaaagaa gctggagaaa tccctttcct acagagagat     91080
     actcaaggtg gaagaggagt tcaatactct ttctcttgag gttcagcaaa cattggatac     91140
     aatttctgta gaaggctcaa gtgaccttat ccttcacttt gaaggagtca agaagattat     91200
     tttgatgagg ttgcaaaggg tcgagaaaaa actcagaaac ctcaaggact cgaagatagg     91260
     aatgagcatt gatctcgagc cagaaaggcc gcatacattt aagaatgtag aagaggtcca     91320
     gatgatggag gaggaaaaca agaggctggt tgaaggatac aacattgagg gatacaggct     91380
     aacaagaaaa agacttcttg aggtcgaggc actccaggac acaattttcc agcatctgac     91440
     tcttcaagac gagagaattg acagcatagt agaccttacc tcaagggcag ggaagtttgt     91500
     ttcttcaagc aacgaggcac tggggaaaac aaagaattct ggaaagtttg ctcggagatt     91560
     tctgtttatt ctattgcttt gtttatcctt cgttctgttg ttcctccact actattacaa     91620
     gtaaattcag cctatcaaag ttcctttgga atatctactc ctcctttcca agaaggatat     91680
     ccacaacact tggatcttcc agaatttcat ggatccttgc catgttactg aatctatcct     91740
     cgactatttt gcgaaagtcg aagttaggca ttttgttttt tgcaaagttt attacaggga     91800
     ccgttattgt ttcgttgtct tctcccacat ctgtgcactg cgtgggagaa aaccttctgt     91860
     gctcttctgt gttgctcatt cttatcgaat tggcctctct cctttcctgt tccaggcgtc     91920
     ctggtgactt aatctcactg tatccatgat caagcttctc aggaatgatc cacttgaagg     91980
     tatttctttc caagccactt cctccatttc tggaactcga agtcgggtaa ctcccatctg     92040
     tctccatcac cgtcttttct atttccttga tctgaaccag atttgctccc cacgagactt     92100
     tctttcttct ctttggcttc aagtcctctc ccagctccga ttgattctta tcatccttca     92160
     gactctcggc acaggccacg ctaaacaacc tcttgaggcc tgttttttca agttggtctt     92220
     gagtaaatcc cgatcttctt agtagctcag aaggctcttg agccccagga tagagaacat     92280
     caaagctaag gtttatgaag tctacataga agggatgctc cacaggaaac actcctccct     92340
     ccaggatttc tttgattaca ctcttcactc gctctggaag aatggctgga tcctcaattc     92400
     caaaaacccc ctcgatcttc ccaatcacct cagactcttt catggaaggg ccattccgga     92460
     ctcgctttag agattgcctg gaaaataaac agccctgcag ccatatgaag aagtttggga     92520
     ggaaaagaag gtcgatctgt aacaccacct acgaagacgt ccgaaaaaca tttgacgatc     92580
     taaaaagaaa gattgctgat tcgggccgcc tttcttccag tggattttcc ccggctacat     92640
     caccaaggag tgtgagctgg agaaaggact atccatgtga ccttatctca agctccggcg     92700
     atgatctgga ggactggagc agctttatta gctcgcacaa ctctgaactt ggagatagaa     92760
     gtggacccag aactccaagc cctggaagcg aggcacaaga aagtattgca gtaaaccatg     92820
     gaatccttag ctctagcgaa acatacgacg aaagtctggg attcagtagc tttcttgagg     92880
     aggaatctaa gaaagcatct cgaatacaga acataacatt tagaagaaag aagggggaga     92940
     acgggaatct tttggaactg gagaagtgca acatcgatgc tcttcaggaa gaaaatctcg     93000
     aggtggcagc actgaaaaaa atctcatttg acagaatgcc aaagaatgtc aggaagattg     93060
     gggaggcaac attcagcgag gtgtttagcg acggccttaa ggtctacaag attgttccat     93120
     taggggacac agatgatgaa acgtctctcg agtcgtttct gaaggaatcg gccatattca     93180
     aaaccatttc ctcggaagac ggggtgtgca ggcttaaaga tgtgtttttg gttgaaggaa     93240
     aatatccaga ggaatatttg aaggcatggg acgattacgg agaggaagaa aacgaaagac     93300
     cctcgaaata ctcggactct cagaagtacg gtgtgatagt gatggaggac gggggagaaa     93360
     gcctggaaag cactaagttt caaggggcag aggagatgga ccgatttatt aggagggtta     93420
     tagagatact ggccaacctg gaggagaagt acgagttcga acatagagac cttcattggg     93480
     gaaatatctt gataaaggag gaccgaataa gcttgattga tttttctctc agtaggctga     93540
     aggatggaga ttctgtgata tttagcaacc tcaacgacaa gcaatggttg ttcgagggag     93600
     acgaggcttt tgatatccaa ttcaaggttt ataaggacat gctcaagctg tgttctggat     93660
     gctggtctcg ctttactccc caaagcaatg ccctgtggat ccgatacctt gttgaaaaga     93720
     catttggaaa aggaaggttc aaggggaaga aagacctagt ctcacagtac ttgtcgatta     93780
     tagatagcag cacatcagca agggatatag atgcaaaact caagaggaag gaagtacaat     93840
     aaaaaagacc ttttattggt ctaggctcat tctgctcttt acttgcctaa gaaactcacc     93900
     tgcattcaag atttctgtcg atccatacat gattggaact cctatcctct cctcaagaag     93960
     tttcagggtt ttcaactctg tgtatgttcc ccctcctatg ctaaatacaa caatccttga     94020
     gatctcgctt gcatatatat ttttggaccc ggtggaatca atcaacttga agcccgagta     94080
     tatctgagac ttgatatccg aataaataga ctccacaaga gatgatatgg gggtctgctc     94140
     cttcaccggg agaagctttt tgacatttcc cataagacta gtgaccatct gcgagtaaaa     94200
     ggcccctgtc ttttccggcc gggcgctttt atgcttcctg aagaattcaa tcaccttcga     94260
     ctttaccttc ctcttctgaa gcaagggatc tattagatcg aagtccttgg tgttaagaag     94320
     aagaatggcc agcctcagta tgtcctcgtc gtcgcccttc tcggataatt ccatcaactc     94380
     ctgatctgtg tatcttccct tctcgacctt gtagaagtcg tcgatcgctc tcttttttat     94440
     tatctcaacc atctcagagc atatggatat gtgagcattt acagattcat ttctctttgc     94500
     cagctccggt gctttatcca gggcctcttg gatcaccttc ttgtcggtct tctcgtcaat     94560
     actccgaagg gccatttcct ttctgtactc tagaagctct ttctcaaccc tttcaacaac     94620
     aacagggaag tattcgttac tattccccct ccagagttcg tcctctggat ccagatcaaa     94680
     taccttccca cttttcaatg ttatcttatt cgactcaaac ttgaagaggt cattcattag     94740
     tgcactatag ctccatacat gttgcacagg agtgcttaca tcgtagtttc gattcataag     94800
     aatcagaaga ggccttttcc ctgtcttctt gatgacacca gtgtttttta tctttgcctc     94860
     aagcatcttt gctatttgga tgcatgtttc gtcatccaga gttgccataa acggaacttc     94920
     tccaagagtc acaaagacac tcataagaga catcaccatt cctctccaca tgtctgtgtt     94980
     ctcaattcct gcaaagctgt ccttcatctc aagagtaaac agatcgtctt gcaaagcagt     95040
     gaagtccaga aactggtcga agacagatct tactcgaagc ccaagacctc tctccgacaa     95100
     cctgagtcct aggtcttcga gctctccccg gccaacagat gtggtgaagt taaggtagta     95160
     ttcagagtaa agctccttaa ggatatcctc agcgattcca tctgccttct caacaaaata     95220
     cacagcaggg gtgttggaga tgggatgtct cccctgagac accaggaaat gggttgttac     95280
     accgcactcc ctgagctcgt tgaccttcat caaaggccca ataatatgct gtgctcgagc     95340
     gtcaagaacc aagaccttcc agggactgtt tggcattccc agaaatgcct ttatcttctg     95400
     tttctggagc tcccttaaca ttcggggtat tgtggcagcc tattttctag aaaggttgca     95460
     agatttcttt ttgaaggctg tggtccttgc tgttgaagaa gtcctaggta tgtgaatggt     95520
     ttgatcctgt ctgcccgaga aataaatctt tttgttatcc ctagaactac tccaatagga     95580
     caatgacaac agagattaga aatataaagc tggttcagaa gatagcgtct ggggcttttg     95640
     gagagatatt tattggccaa aacacagtga caaaccagac agtggcagtg aagctggaga     95700
     agaaggctca ctatggccag ctgaagcatg aatatggagt atacaaggcg cttgggagca     95760
     tccgtacccc aaagatttac gagtatggaa agatcttgta tgaaaatgta tacgtcaatg     95820
     gaatggtaat ggaactgatg ggcaagtctt tggagcagct gtttgttgca tgcaacaggc     95880
     atttttccct taagacggta ctgatgatag gagagaagat gattgacgat gtagaatatc     95940
     tgcatcacaa gaactatgta cacagagaca ttaaacccga taactttgtg tttgacgtcc     96000
     gaggagataa attgtatcta atagactacg ggctagcgaa agagttccgg aatccaatga     96060
     cattcaagca cagagagatg agaacagata agtcgttgac ggggacagcg agatacgctt     96120
     cactgaggac acatcaggga tatgagcaaa gtagaagaga tgacttggaa agcattggat     96180
     tctgtcttgt gtattttctt aaaggaaggc ttccttggca agggttgaag gccaagacaa     96240
     agcaggagaa gtatgacaag atacgggaaa gcaaagaggg gatatcgttg tatgagctgt     96300
     gtatggggct cccgaaggaa attcattctt tttgcttcta tgtgcggaac cttgggtatg     96360
     aggatatgcc gaattatgca tatttaagga cactgctcag cgatgcgctt cggcaaagag     96420
     gcctaaggaa cgacggggtg tttgattggg tggccagaac gccctctgac tccttggcgg     96480
     atctggagat cctgtgaata ggtgaataaa aggatactgc tgtttggttg gggaaaatgt     96540
     ttttagacgg tggatgggtt tggccatgga gacccatcgg gaaaagagag agactttgaa     96600
     aaggatgttt caagaagaag ggtttgttgt tggagacgga ctgaagtatg gggttgatct     96660
     cctgctatac acagacagcc cgtcgaaggt gcattcgaag tatggggttc ttatagacag     96720
     aaaacacagt cttttggaca ttgttggggt tcaaagaaca tgcacgtctg tcaacaagat     96780
     tttaattgtg gtgttctttg atggggctga agttcgaatg gtaagtgttg agaggatgga     96840
     acttgggggt ggaggacatg aattttcagc agacgagctc gatgtttgag agcggagcaa     96900
     gtcttgtaaa aaataaggtt tctagacccc aaatgaaaaa caatgaagag gttgagatag     96960
     acgagtcctt gtattctagg cagctttatg ttgttgggaa ggatgcaatg aagaagatga     97020
     tgaatagcag ggtgcttgtg atgggactag atgggcttgg gcaggaggtt gcaaagaaca     97080
     tatgcttggc aggagtaagc aaggtgactc tgtttgacga caggatagtt gaggaggaag     97140
     atctgtgcac gggattctat cttcgtaggg aagacatagg aaaggcaaga gatgccagcg     97200
     tcgtagagaa gttcagatca atgaacgagt atgtggatgt gagtgtagcc agcgaggtga     97260
     acaactttga aggatatgat gttgttgtag tgtgcaatga gggctatgga gagcagataa     97320
     agctgaatga gatggctagg aaggacaagt gtatgtttgt tggatgccag gtaagagggc     97380
     tgttttcaca agtattttgc gactttggag cagaatttat ctgtgttgac aggactgggg     97440
     aaataccgat gagtggaatg atcaacgaca taagtgaaga tggagtgatg acggttgttg     97500
     atgggcaaag gcataatctg gaggactacg acataatcaa gataacccag tgcgaggagt     97560
     atgagggcaa atactttcga gttaaggtga tttctcccac tcaagtgatg ctgcagggtg     97620
     ttgatggagt gcggatgttt gaggaggaag ccgagttcaa ggcggagaga ttcaagagtg     97680
     tgtatggagg agattttgag cagcagaaga aaccgagcat gatatcgttc aagcctcttg     97740
     ggcggacaat tgatgagcca aggatcctgg gtttcaacta tgaagttgag gaaaggaacc     97800
     ttgttattca caagtgcttt gttgctcttg gagagtatat gaaacagagt aaacagaccc     97860
     cgagtggaga agaatttctg tcgttctttg ttaggaagta caagagccat tttgagtttg     97920
     aagcgctaat aagatctttt ggaaggcaat gtggggggac tcttatgcca atgtgttctg     97980
     tggttggagg atttgtggct caggaaatct tgaaagctgt gggaagcagg tttacaccct     98040
     tacaccaatt cttctatttt gacgcaatgg atgttgttcc tggagatccc aaggatgatg     98100
     ggaaggacta cggaagatat gggccgatgg taagatgcct tgggaaggaa tgtgttgaga     98160
     agctcttcaa tctccacgtc ttcatggttg gagcaggagc cattggatgt gaacacctga     98220
     agaacatggt tatgtgtgga attggaagca ggggaagagt aagtgtgaca gacatggacg     98280
     cgatcgagca gtcgaatctg aacaggcaat tcctatttag atctggagat gtttcaagta     98340
     tgaaggctga gattgctgtt ggaaaagcca tcgagctgaa cgaagatttc ctgaagattc     98400
     ccttggaaag aggcgaggag aagcttgaag gaaaagatgt ttctgaaatg acaaatggaa     98460
     tgtcagggtc ggggcttccg tattctaacc ttgtttacta caatctgaaa gtgggaaagg     98520
     aaacggaatc agtatttagt gacaggtttt ttcagtctgt agatgttgta gcaactgcac     98580
     ttgacaacgt ggatgcaagg atatatgttg atggaagatg tgttgtgaat agaaagttca     98640
     tggtggatgc aggaacatct ggaacaaagg ggaatgtgca agttgttgtt ccgtttcaca     98700
     cagagagcta tggatccagt caagatccac ccgaaaaatc gattcctctg tgtaccatca     98760
     aaaactttcc atatgccatt gagcacacca ttgaatgggc aagaagtgag tttgagttca     98820
     agttccatga cgagatactc ctgataaaag aatacctagg aagagagaag aagaatggag     98880
     gagaaggaaa ggaagaagca agcaatgaga cgatggaaga cattgttgag aagacaccca     98940
     gaagcgccaa ggaatgtatt cggaacggaa tccttctttt tgtcaagctc ttccatacat     99000
     ctattaagaa ccttataaca gcatttcctc cggactcaaa gacaaaggaa gggcagccat     99060
     tctggatgcc tccaaagagg tctccggtga caattagctt tgacgttaat aacagccttc     99120
     atgtcctgtt tgtccagagc actgcaaata tattcagctt caactttgga attggagaac     99180
     acatatcaag agagatggtt gtggattttg taaagaacga aatcctagtg gaagagtttt     99240
     cgagtgcggt agacaatatt tgtgtagaag agtcgccacg gccgcccgtt gacccgtctg     99300
     ccataacacc ttgcacattt gaaaaagacg acgactcgaa cttccatgtg gatttcctgt     99360
     atgctgcagc caatctaagg gcaatgaact acaagataaa gcaagcagac agacttactg     99420
     tgaaggggat tgccggaaga atcatcccag ccatagcaac cacaaccgcc gttgtctctg     99480
     gacttgccat cctggagatg atcaaatatg ctctaggcgt ggagcataca aagcataaga     99540
     actcattcct caatctagcc cttcccttct ttgcaagcac ggatcctgtg gaacctatga     99600
     agcagctgta taagatcgaa aacaagaaat atacatttac actatggaac aggctggagt     99660
     ataaggattc caagctgggg acaatcctca aagcttttga aattcaattc aagaagaaga     99720
     tatcgatggt cactgccgag aatgccttga tctactggga cttcgattcg aagtatgcag     99780
     acaatctgga aaagactgtt ggagaactgg tcggcagaaa gccggatgag ctgtttgtca     99840
     tgctggatgt gataacagac gacgaagaag gagaattccc cagaatagta gttgtctttg     99900
     aataaagcct tttcttttcc ctggcacaga gctcatctat gaagaaggct tacgagatat     99960
     gttctttaat aatcacccgg aacaagaaag agcttctcat tcctcgggat tcaggccgct    100020
     tggtcatcat ggtagtgctt tatatggtat ttgaggccat tattgttctt gtatttcttg    100080
     tcgcatccgc caaatggaca aacatagggc ttgaatatgt tcatcttctc ttcggagtgg    100140
     ccttctttca tgtgatactt gaggccgaag gaagacgtgt atttcttgtt gcacccctct    100200
     atctcgcatg catacaccct cgtttttgcc ttctgtgccc tggaagacga acttccagcc    100260
     ctttcctctc tgcaagggga cttgggccca gaaatcccac ggacgtctat taatccattt    100320
     cctgagactc cctttctcca ctccctgtct ctaacactct tgtggatgaa ttcatagtcg    100380
     aatcccagag tatcctcctc ccaaagctct tctgtgcttt gagtcgatag ggcgtatttg    100440
     taaaggatct cctctctctt cagtaagaca tcctccaagt aaaactgatg catgtccatc    100500
     atatatccta tgtctttata tctctttacc ctctcctcaa atcttttttc ctctatctgg    100560
     tacaactttt tcagtctact tgaatcgttc attctcatca tatggttcct tggacggtta    100620
     attattttcc taaatgttat tgatcccgca atattcattt ggatgtctcc agaaggctgc    100680
     catataagta tatgctacaa tcgtgctctc ctctgtcctc ctagcccaga catccagctc    100740
     tagcattttg caagttgtct atattggcga agtaagaaaa gtctttccgt attagctaaa    100800
     taagcccaat cgtttattaa atcatcctct tgaggagatt ccccagcagg tcctggtgat    100860
     tcccaacaga ccctccatcg ttgaagttcc tggatttctt acctttgaat cctccgcgcg    100920
     gcgggctaag gtggaacggg tacaggaaat tgttgacgtc tctgaacatc tcggtcccat    100980
     tgtagatgtg gtaaacaagc tcctcgatgc acttgatctt tccatcaaac atatcctcaa    101040
     taaactcgtt tgtgagcttg acacgagcat ttccgttcct ccccgttccc cttgtgtaca    101100
     tcagcttcct cagtagctcc atatcaattg ttccaaatgc aacataatcc ttgattatat    101160
     gaagcatcct ctttgtcgac ttgttgtttt tgacgaacat gcaggtattg gtcttcttca    101220
     gtcggaaaag ctgtagaacc ttcttgacct ttggaggaca tcggagcttt gatcttatca    101280
     ggatcaccac aaagaactct gcctcctttg ggacataaaa tccttcttga atgcttgcct    101340
     tcttctcaag gatttctctt tcctgctggt agtatttatc taggagcttc tcggtagtgg    101400
     cctcggcata ctttgcattc tccttcttcc tctccataaa ctctttctct tgtctcgtct    101460
     ttatccctgc catcttggcc tggtattcct tcttcctgat agacgactgc ggagcctccc    101520
     tcattgctac ttccattttc agggcaaatt tttacttgaa attctaatac tccatccacg    101580
     ctcattcccc ttcaaagcca taaatctgct tattcttatt tatttatggt tttccagtac    101640
     tcctccatct ctctaaaaaa gataataaag tcctcctcaa cattccacag cccgttgttt    101700
     ttcacgtctt ccaggctgca gccttcggaa acatagaagt ccgttaaaaa catgcatttt    101760
     cccttaggaa tcttctcgac agtcatcttc tcaaacagat aactgcatcg tgttcccaaa    101820
     agagaatgaa aactgttgct tgcatttgtt ccaattattt tcctctcctt aagttctagg    101880
     agtatcaccg attctttgag agacctagcc aaatcaatag catcgacaac atgtgccaga    101940
     tttccaacac ttatgaaata cttaatgctt ttgtttagat catttacaca ttcttggata    102000
     ttgtcaattg cttctttcct cttccaatta tcttctattc ccttagcaaa aagtatatcc    102060
     gaccatataa acgacaggtt tgggacttga gcatttcgga cattcatcaa gtccaaacac    102120
     ttgaggacat gtggatagaa gcaaaagtat ctgcacaaaa acacaaatat tagaaatatc    102180
     tcataattct cggggaagtc tttcctgtgc ttgaaggata aatacagggc cagtccaaga    102240
     tatgaagcct ttctagacga tatcaaaaca gcaatgatca tctttgtgtt gagtactgac    102300
     ttgttcttgg tgtatatttc atatgccctc cttagaactt cctcgtcaaa tcccttcctt    102360
     gccaactgta ttaagcaatc gatggttccg tcgggatggt tttctagccc aaccattccg    102420
     ctaatgaact ctatttcctt aaagcatatc ctcgacctta gtagctcaat agccttgtct    102480
     ttttctttga accgatggag aaggtagtac tcgtagttca ggctttctct tcgaggaagc    102540
     tctatattat tgttcaatgc atgctgatat aaatcccaat catctaaatg gtctaggaga    102600
     aacgccatac attccagatc ggtctccttt ccaagaagct taggatggcc atgtatgtac    102660
     gcctctttga gagtgagata ataaagaaag tccttaaaaa caattctctg gacataatgg    102720
     tccatttcct ttatcagcaa tcctctcttg tacagcatcc aaatgagatt gctcttgatg    102780
     gtggaattct tcagagattg aaggagaaga ttcttcttgg cctcatcttc cggactcccc    102840
     aggaagtcga ggagcaagga agtcataagg aacatggggt ttcttggaaa gagcattctc    102900
     ccgagttcga tactatcttg tatatctcca gcaagaagct tctccacaaa ggtcttttcc    102960
     aaatctctct ggccggatac taatcttttc aggaagccta gctgtttcat gtgcctaggg    103020
     tttcaaattt tgcagcctat ttctacacaa agacaagctt cttccgaaga catcactgct    103080
     ggatatccag ccatgtcctc tttccaaagc tccaaacctt tctgctcaat aatcactatt    103140
     gcaaaatttt taaataaaaa caaacagaag agaaggaaag accagacatg ggagaagcag    103200
     ggaatggagg ccttctttcc tcggccgagg ccaggaagaa aaggaggaga ctaatagagc    103260
     atattgcatc ggaaatgagg ctaattcgga gggagattga gaggccaaga gcaatgaggg    103320
     atgcaccagg atttctttat gactttgaaa agcaaatacc tttcaggcac caagaaatta    103380
     gatgtgcaag tattcccgcc aaaaaggccg atagcaagtc tggggatgag ttagggaaga    103440
     taaggatggc agcagagtat gctgcagaat ctggggttct gatgctaata gacgtcctga    103500
     agcagtctaa gaagattgta tttagtaagg attgggagat tggatatagg gaaaataacg    103560
     ttattaacat tcttcgccag atcgaaaaga aaagaagaaa aggagatctg ttgcagaatc    103620
     caagagaaca caggattgag agagcagatg tagaaaagac gtggaagatg atggttgagg    103680
     aagaggcccg gagaaaggca caactggatt ctatagtgca tgagatttct cttgcaaaaa    103740
     gagacagagt gatccatgtg aatacctttc tgtcctcctt tattggaact ctaaatgaaa    103800
     ggactacgga tctagaaggg agaggtatat ccgatgggga aggggaggga gacggagtga    103860
     tttacagtag aagacgactg tctaagatgt ttatcggggg agaggtgagt tacgaaagtg    103920
     ttgtgctccc tacggtggga gacgacaatc ccccgcctat atttggccga aggttatata    103980
     ttccttccga aaagatcgaa agtgtgactc caaggactca gataagcgag aggtataaga    104040
     aatatcttgc caacttttca aagcttaact ctgctcaatc ggggagaagc aactttagta    104100
     tgccgcaagg atctgtggca agtcatccga gtagccagca catctttaag aaggtgtcta    104160
     tggagtatct acgatgtaaa agtgctagag atattgttag ccataaatat aggaatgtgg    104220
     ttattgatag aacagtagac ttgcccaaaa gaccagaggg aagatatccg aagattcatc    104280
     tacaggatgg tttgggtgga gatctgtgct cgagtgggag cgatgatgca aatgtcggat    104340
     atacctttct tattgaggca gcactaggaa aggtcccgag ttctgggcaa aagggagagt    104400
     tagagccaac catgggatcc gagaatcttc ctagtggcag caatgggacg actggggatg    104460
     aaattgaaaa tggaagagat aaagaaacat gagggaagag aatagaaaat tcgttatgga    104520
     gctgatttgt tacctgatat ttaaattaaa tccaaagaaa gtgtatatat gtattcgctg    104580
     gcttctttaa ggactggaca tttagagtac ctgggctcgg attggtttca gaagcaccta    104640
     ttagctttgg tagcactctg gagagtccag taggaaacca attggaggaa agattggacg    104700
     gggtgtggtt gagaaaggat tggagaataa atactaagaa gtggaagaga agagcaatga    104760
     agtataagga ggagactccg agctacatgt actcagagat agaagggact gaagaagaaa    104820
     taattagtct tatggatgag tctgaggaaa tcaacccttc tcaggaaaga gagatgagag    104880
     gaatgatagg agacttcgag tacatagaaa acaaatggat aggaaattac cgatttataa    104940
     ggcagctggg aactggaagt agtagcaagg ttgtgcttgg atgcgatcca caaagcgggg    105000
     aaaaggttgc aatcaaaata attcccaaaa ggatgaatgg cacggagact agcgaggttg    105060
     agatgagatg cgaccagagg atattcagag aagttattat atcatctgtg gtaaatcatc    105120
     cgcatattgt tcggttgaag aactttctgt atagccctac acactacttt ctaatattcg    105180
     agtatgtgaa aggaaggcag ttgtacgata ttatcattag taacgggcct ctgaaggaga    105240
     aggaggggca gaggtacttc aggcagttac tttctgcagt tgactacatc cataagaatt    105300
     cgattgtcca cagagacctg aagatagaaa acatcctgat tgacgacaac gacaatgtca    105360
     agctgatcga ctttggacta tcgaattttt acgacaacaa aaccctgctg aacacattct    105420
     gtggaagtct gtactttgca gcgccagagc ttcttcaggg gcagagatac tgtggaccag    105480
     agatagacat ctggagtctg ggggttgttc tatatgcgac tctgtgcgga tgtgttccat    105540
     ttgatgacga aaatgttcag ggactccagg aaaagataaa ggatggagac ttcaagttct    105600
     gcaagacgat ttcaagagag gctcaggagc taatccgagg gatgattgtt gcacagccat    105660
     cctctagaat ggggcttgac caagtgattg gaagcgaatg ggtaaacgga gatcaaaaag    105720
     gcagaatcaa cagctataca gcaaagagat atccaataat gaagatcaac gagaggtaca    105780
     tagagttgtt gtcgagagca atccggttcc agttccccaa cattgaaaga gagattagaa    105840
     gattccacag aatatgcaag gaagacatgg ggactttaga gcagatctat tggtcgagaa    105900
     ggcctgtggt gtctctctat tatcttgttt ctgagaacct tggagaagac aacgaaaaca    105960
     gaatctacga agaagaagat gagacagaac tgccacaggg gcaaccagaa gccatccatg    106020
     actttgtaag gtttatattt tctggagaga gaacctgtac tcgaaaacac gttaaaaagg    106080
     aggtgcttct ggaatctgca agccaagaca ccctggtgtc cctgaaggga aaggacaacg    106140
     ggcttccacg aatcagacag acatacttga aggggttctt cagggggata agggtaaagc    106200
     acatcggaag ccacaatgca ctcaaaaaga tactccttga catattcaat gcaaatagta    106260
     ttatctacga agttaccgat aagagctact tttgctctgc atactacgag gatctggaat    106320
     gtcttttcaa ggtatcgatg tattttaatg tgcttcttaa cgaatattat cttactgtga    106380
     cacctctgaa cagcgagaag aagcttttta agaatgtata tgaatggatt tcctctggat    106440
     tgaggaatag aacgtgaaat aaattgttaa cttttggttg ggtgcaagag cagcatatgt    106500
     cattgctccg tgatttccaa gacattgtgg ctgaaactaa taattgcggt agatattttc    106560
     ttgtttggaa ttaccctgga tccgtggcta ataccatgga ttccaaaaga gccagaattg    106620
     ctcccttgag cctgatggtt ccaaggttcg tagatggcta cattttgatg ggatgtcttc    106680
     tttctatgat gttttctgtt tcaaggctgt tttaagctgt tttggaatct ctataaacag    106740
     aaacggcttt cggtccatac caaggccaga tgactcctat ttggttattt ctaggatgtg    106800
     ctctctgttc tcttgaaagt gacatgctga gatacacaaa caaattcagg aaggagcaca    106860
     acatggagga actatacaac ctaccttcct tgcagaaggc tgcggatctg caagtgctgc    106920
     acatgtgtaa gaaatccaag cttacacatg acggaccaag cggagaagga tttaaccttg    106980
     caggaaggtt gaaaaagttt gattttgtcg gactcaacat aggagagaat atagctaagc    107040
     aagagaatga tgactataag gaggtggtta aactttggat gaagtctgaa gagcatagaa    107100
     acaacattct cggagactat gtatactctg gggtttccac atgtattggg aaggatggga    107160
     acagatattg ggcccaggtc ttcgggaaag acatcagtaa cacaaaaatt gccaagatga    107220
     ggaatgaggg gaagccactg atttgcctgg agtgcaatat gaaagatgaa gacaaatcgg    107280
     atagagaaag aaaaacacat gaagaaggag aagacctcgg agtcggagac tacataatgg    107340
     tggttcctcc ggagtatgga aaagaaccag aaaaaagaga aggatctttt ggaggagttt    107400
     atgaagatgc tcggaatgaa aatgttggtt ctatcgaaac tcagccggat gtagagagtc    107460
     ctagcagagg aggaaaacgg atacctgaaa taagcttagg tagaaagagg tatccgggac    107520
     agaacattgt tcgaagacct aagtattcgt cctcccacga gcgcaatact aggaaggagg    107580
     aaagagaatt gttaagtcta ggagattatc ttattccacc acagagcgaa agcaccgagc    107640
     atccaaaaac tagcacttcg acttcagaga gtttgtattc aacaacgact caaaaaacag    107700
     tctccaccgt cactccaagc accagcatcc gaacctcaac aataccaatc ttcacacttg    107760
     tattcaagga ctcgggaaat tccactgtgg ttcctgcact tcaatctttg attgatgcaa    107820
     tcaaaggaac atcttctcag gagaagagta gcagtagcaa gactgtcttc tctgtggggt    107880
     cgacacttta ttctacttcg gggataagca ctttcagttc aagcattcag tctcctttgt    107940
     ctagtactac acaaacatcc tcatcttcac taagcagcaa agaagcaata tccacagtta    108000
     cagtcacttc aaccgctcgt gagtccgtca cagtgtatct ccccaaatac cagataacga    108060
     caacgacaac gaccgtgcca tcggaaagaa aggattccaa ggccccacag aacagagatg    108120
     ggtctttcaa ccagggaggt ctaaggattg agtccccaaa gcatctggag ttcattgggg    108180
     gagctggaag cggaggaagc ataagccctg ttgtaaagtt ggatgacaga cataatgcag    108240
     gacaaaacga aaaggaaaat gactctggca acgagggagg atgcaaggaa ggatacaaca    108300
     acgacggaag ctgtatactt tccaagtcgc tggatgattt gaagctcaag gataccctcg    108360
     agaatctggt tcgaaaggga aagatccatc ttcatattct gtcggacgaa gactgcggag    108420
     acaaggagga atgttatgaa agcaaaaata gagttgacat aggaattccg ttttcttata    108480
     aactttaagg ttatttttta aaggaagttg ttttaatctt ggaaaaccta aattatttat    108540
     tctgtctgag ctctattcca acaccagccc caagtcgcgg atgaagccat acagaactat    108600
     caagaatgcg tcttcctgtg ctttcagggt ctttatgtcc tgattttgga tccagaacac    108660
     aacgtcaata tttatcccta ttgaggagtt gttcttcaag tcatacccgt acacactaaa    108720
     ctttcctgtg tatacattag gatccgaggc cacctccttt tcgattgcag agttcagctc    108780
     cgccatcttg tctttaaatt ccagagagtt taaaaatgta aacttaaact gtttcagtga    108840
     cgtccttgcc tttctgaggt tgactatggt cttgtccatg atcttggcat tgggaatcac    108900
     tgtgactttc ttgtcaacta caaacgaggt gtagagaagg cccatgtcgt acaccttgtg    108960
     aaggtggccg tctataagga ttttgtctcc aacatcaaat gtcttgacga gaaatatgaa    109020
     caccagagac ctgaacatct ctgtgagaat cgaagcaaag atcgcattga gggaaaggag    109080
     tgtaccaaac tggatgggga tgaagttgac aaaattaacc tcactctcca ctattggaat    109140
     ggtggccgaa atcccaaacg gaatgagtat gcaggagaga acaatgtcca acttctcgac    109200
     aatcgtgacc ttctgagcca ttcccatagt gattctctta tcctcgttta gaatgtcctg    109260
     atacacaagg acaaagctac ttcttgtcac cctgccatcc ccgtatatat cgaagcgctc    109320
     aaatatcttt cgtgcactat cggttccaaa gaagtattcg agggtctgaa tgtcaacagt    109380
     atccttttcc ggagaaactg tcttgaatac aagacttccc cagctctcga catctggatc    109440
     cgactccatc ttcttgccag ttattctgtt cagctcctcg agcatcttca tgtcctcata    109500
     gttcttctgg attctatcct catagttttc aaagagcatc ttgtagttta tcctctccat    109560
     aagaatggtc tttgccagaa ttatcccaag aaacatagag cttgcaagaa gaagcctgct    109620
     tagtttgtct ataaatggag tctttgtctc aactagcctg gcagaagagc ttcctgactc    109680
     cccaggatgg gtctcttcct ttggtagctc tgcgttcccc tcttcgccag tcctggcact    109740
     ctctccgtct atgatctctg ttccatggtt gtagcttccc atgacaaaag agagaatcaa    109800
     cagtgtgaga acaagactta taagccatcc attccttatt aaagtgctct gaaggaatct    109860
     ttgcttctcg tcaatcttct tgagagtgat cgagaagtat gtcagtataa gctcaagcat    109920
     aaaccaaatc ataataccaa tgagaaggca cagaagaagt ttttcggttg ccaatggggg    109980
     ctgggccttt ccattaggtt ctatctttga tagaataaac gaatagtggc atatgtatgc    110040
     taggatcccg gaaataatgg atcccccaag gtagataagg atccataccg atgagggagg    110100
     acttggatcg tccacgtgtc tcttccccga cggcttcttc tccacaaaga agtcggactc    110160
     ctcaacctgc tgtatgcttt caattttctc ggttcgcata gcgtcccaag ctcacttaga    110220
     attatgcttg aaaaggagaa caaaccataa cggctgaagg gtttttagta attcacattg    110280
     gaggaagggc cttgtgtcca atagaggctt taatgtttaa ttttcgtcgg gatgatcccc    110340
     ttttccttcg tcccccatta cattcccctc ctccctggaa gcccagaggg taaggttgtc    110400
     cctaagaagt tgcatgatta gagttgagtc tctgtagctt tcctcagaaa gagtgtccag    110460
     ctccttgatg gcttcatcaa aggcattctt ggctatagaa caggcttttt cagagtcatt    110520
     gaggatctcg tagtgaaaca cagaataatt caatgcaagg cccagcttta tgggatttgt    110580
     gggtgtaagg gtccttgcct tctctgtggc ctccttgtag gactctgccg catgcttcga    110640
     cacctccttg tgctctgccc ctgtgatgac ttcggccttg tatctgtagt agtctccctt    110700
     catcttcaga aagaaaataa aatactcaac attctttctt gcctcctcca ggctcagtat    110760
     gtatgttgtg atgatgtcca ggacctcatc gcagaacttc agaagctcct cttcaacaac    110820
     ctttatcttt tcatcgatga catagaccac attctggtcc ttcccttcaa gtttctgtct    110880
     ttcagagcat agcattctcc agctcgatct tcttgaactc acaaggttct tgtatgcaac    110940
     ggaaaagagg tttcttgcca tcacattgag aacatgcttg tcctcatgtg cgagcaccac    111000
     agcttgcttc atctcctttg ccatgtcgtc atatctttct gccatgtcac taagatttgc    111060
     cttctgtaac gcctcttcat actgcttgga taccatttct taagccccca tctattttta    111120
     tttttatttt tattcaatag gagacgtcag cagatttaga gaggataaaa attaacccag    111180
     tagggctgat ggactggtat ctaaagaagt atccagacgc caagatcctt gccgacaggc    111240
     tctccatgct ggcacaaacc gatggggagg acatgtcgaa gtaccttgat tccgaaaacc    111300
     tatctctagc agattgcata tacacagaaa gattgtacag atctagggat gtcaaaagga    111360
     cattgagaag ggttgcagca aaagaaggtt caaggataga aaagattgtt tatgaaatgc    111420
     tctgcaagag aaagattgtt ttcgacgact atctgctgaa gctgtctttt ataaagagat    111480
     ttggaaggtt taagaggttt tttattgatg ggaaggaacc tgaataccgg atggagatga    111540
     tggtccacaa actcctctat ctcggggaaa atgttgttga ggaagttgag aaagagattg    111600
     taagagttcc gggtgacaag gcatgggttt acatgggttt tcttggatct tctgtggggc    111660
     gggatgtgat tatggaggtt atgagccgtg tgagtattga gttcaagccc tttgtcggct    111720
     ctttcctcca aaaggaagat tactacaaca agatgtgcag tgtgattctg aagtcccctt    111780
     ccgaagaaag aggggccgta atcttgtcaa tgggagtcct tgacaaggcc caattctaca    111840
     ggtcacttct tcatgtatgg ttttccgaga gtggagggaa gagaagattc aacgacctta    111900
     ttgagataat gagggaagtg aaggtagaca ggagaatgaa gacggagatt attgatgggt    111960
     atctaaacgg gcttatctac cagaggaggg taggggagtt tatgaagcta tttaagcttg    112020
     caaaaagaat gaagatctgc agagatgaac acaagctgtt tgaaaagctt tataatgctg    112080
     tccgtaagta caaaagagaa gggaagctgg acctaagaag gtttctagat ggatgcaagg    112140
     aaagaaagaa gaaggatttg gtgtctccgt acagctggga aagtatacat gaaatgtaca    112200
     gagaatgatt ggaaggcctg gggtttcctt tctgcatgga ggataaattt tgtgggctct    112260
     catccttggg atggtagtgg taggaagaga agaggagtac ttgaagctgg aacgctatct    112320
     agacatgttt tttagcacag agacaggagg gattgtctac ataagtgggg ttccgggatc    112380
     tgggaagaca cacacggtgt tgagactgat ggaaaaaaga caggtcaagc atctgttctt    112440
     gaatgcagct gggttgaggt taaaaaggga tgtttataag tggatcctca caaatctatc    112500
     ctgctgcacc gatccaaagc gtatgtattt aaaaagtctc cagaaacact ttatggaatg    112560
     tatttctcac catgtggttg tgattgatga agtggatatt cttataggaa ggagccaaga    112620
     agtgttatac aatttgtttg atatgccata cctggaaaac agcaagcttc tgctgtttgt    112680
     aatttccaat acaatgaatc ttcccgagag actgtttgag cctaaggttt gtagccggat    112740
     aggagggaga agagttaact tcacgccata cacatctgca caactgtgtg agatggctgg    112800
     aagttgcgga gtgaacaagg gttgtgttga gcttgtttca aagagaattg ggggagtcag    112860
     tggagatgct cgaaaggtaa gggatgtgat tgagagggtt aaagaaagtg agagggggag    112920
     tgaggcaggg atattagatg tggacgatat tatgagaaaa atgtatgttc ctgtatacac    112980
     ctactacctt caaaacctgt cttcttatca aaaaaccatt atatttctgg ttagcggaag    113040
     cgagcaggac agaatgaaaa ccaatgaact ttacgatgag tttgtctctt tctgcagaag    113100
     atctggaatg aaagaagtgg ggttttttga gtacttggat ctcctcgagg tgttagtgga    113160
     ctacgggctc cttggagtta ggagcttggg gaaagagatt caatgtatgg ttctgcggga    113220
     ggaggttgaa aagagccttg ggtcggacaa ggagtatctg gaaataaccg ggagggcggg    113280
     gagtagaaga tgttttttga agaactctgg ttaaaatccg aagagagaag acccatcaaa    113340
     tggatcaaaa actcaagcac tttcttgaca actcgaactt ccgaagagac aggagaaaca    113400
     agaaaaagaa agttgagacg tctgggggaa agagagaagc aggacaggag gagatcttga    113460
     tgattaagaa cgggcagatt gttgtcaatg atgcaaacat gtatgtggac acacatcggg    113520
     atgtggagat ggaggtgatg gaagacgacc ggattgtgac atcctcgacc tttagcaaga    113580
     agaaaggagc actaaggtgg agcaaaaaag agatagagct gttttataag gcgttagaaa    113640
     tctgtgggat tgaattttca ttaataagct ccctttttcc gaacaaggag agaaagcaca    113700
     tcaaagcgaa gtacataaag gaagcgaagg tcaaccccga gaggatcaac gaggtactga    113760
     acgagtataa aacatttgat caggtggcat acaacaagct ccgaagctat cttcttgagt    113820
     gaaaaagttt aataaatctg ttctatcctc ctatagggtt tagagtaact tatccttggc    113880
     agttgatgag tggatctttg cattgatgat cctggagatc tgaaggaaca gcttgtaata    113940
     agcaaagaca agtaaggttg cagcagcaac caaggccatt ctcatcgata tcgacatata    114000
     tcctagaaaa gggtacaccc aggagttgtt gagtctttgg aagtaatgga ttaccataaa    114060
     gtagacaaac ccaaagatgg caaaggtcca gtaatgtctt cttgctccat agatattgac    114120
     gcctacttga tctatcagaa ggagaataaa tgggaacaga tggatggaca tctccgatat    114180
     tagcggagtc ctaacacctg ccatataaag atccttattc ttgagaagtg tcggatctat    114240
     ggcattaagt gtccagaata ctgttgtcac tagtccctcc agaggaagag taatggaaag    114300
     aaagtctctg tacacctctt taattcttga ggctccaaaa tgttttacgc agtaacttag    114360
     agacaacgtc attattgtca tgtaaagact tatctgggtg atataaatgt ggcttcttcc    114420
     agcaagcttg tcgatgaact tcacccactc ctttggctgg gagtagtctg ttgccccgta    114480
     gatacaaagt acgaagagga ttatcttgaa gatttccttt gaagccaaaa gacggctaga    114540
     actttccata agattatgtg gctttgaagg ataaaaagaa tctaggagta acaaactttt    114600
     aatgtatcaa tgaaatgagg agatgtgata atcaatgggt ccccgaccaa ttcaaaagga    114660
     tctattatcc tctttcactg gctcatactt cccatgaacc aaatcgttaa ctccaagaag    114720
     gcctaagtaa catccagtac cgataagaca tgccataaaa atgaagagta tcctcccaat    114780
     agtgttcatt ttcttgaaaa ttggataggg ccacttgcca tctaccgtgt agaagtacca    114840
     ggtttctagg aagtatagaa tgccgaatcc aaatacaaag gaaatgcatc tcttccgttt    114900
     ttttagcctc acatctattt ggcatatcag taggaggaga agaggaaaca aatgctggga    114960
     gagctctgtt aataagcttt cctggattcc ctcactataa agtttcctac ttttcaggag    115020
     agttgggtta atgaagtaca aaatccaaaa cagtaaggtc actatgccct ctaaggagaa    115080
     ggaaagagcc agcaagtctt tgtaagtggt ttccaaactc tttccgactt tggttcttgt    115140
     gagatacccg ataactgttg taatgatggt taaatacagc gatagtacag taaggtatac    115200
     aaattttccc ccagaagttc gatttataga ctgaactact tgttccggta aggcatagtc    115260
     caacgtcccg tacacacaaa agcccagaag tgttactttc aatatctctt ttagcatcct    115320
     ttttatcttt tccttttcca taaggggacg ttgtaaaact cgaaaaataa ttaaagcaaa    115380
     gagggtgtgg ggatcttttt gttttgaatt ttggaagagg gcgagtaggg attcctttgg    115440
     agagatgttg atggggcccg gataaaacaa taaaaaagaa gcccttccaa acctctggaa    115500
     atgttaaaga tctatgagga tataatcaat gaggttatat ccaggcttga gcatgccgag    115560
     gacgaggcca gcattagtaa gtctgctatc catgaactcc gaaacgagtg gagggaaagg    115620
     cttattgagt acacacaagg ggaatgggac gaggacagga ttgttcagag aggcggagaa    115680
     cagggatatc ggcacgtaag gccttcagaa gggtctggaa gtgtttttgg ggggaatccc    115740
     acgatggaga aggagcctgg gatgtttgag gactacgaga gcttgagcgg atcgagtgga    115800
     gactcggaga taataggaaa gaaggttacc gctgggaact gtatggtctg tctgtatgtg    115860
     aaggtcaaca tgtcaaaggg gaagtggaag tgtacattta agcagggttt tatcagcata    115920
     gggaagatag actttgtgtt taactccgcc cagggggagc ttgagtggtg aagagatttt    115980
     atttaataaa ggatccctgt atatttggta aacgtttgag aagttggcag gataagccct    116040
     ggaaatgggg atcaagcagt tatccaagct cctgaaagag aattgtgcga aaggaattaa    116100
     agaaaggcct ttggcatact actcgtcgaa gagaatagca attgacgctt cgatgtcgat    116160
     gtaccagttt ctgatagctg ttagatctga tggatcatca ctgggaaacg aagactcccc    116220
     aacatcgcat cttgtaggat ttttctacag gactatccgg atggtggagc taggaataat    116280
     acctgtgtat gtatttgatg gagtacctcc cgaggttaag atgaaggagc tagagaaaag    116340
     aagcgaaaga agagcagcag ctgataaaga gtacaaagag gcgtctgaaa tgggggacaa    116400
     gaagcttatg gagatgtacg acaagagaaa gacaaaggtg actgggatgc atgttgagga    116460
     gtgcaagaga cttcttgggc tgatggggat accgtttgaa acagcaccca gcgaggcaga    116520
     ggcatactgt gctttcctat gcaagaagaa ggctgtgtac ggtgttgcaa cagaggacat    116580
     ggatgctctg acatttgggt cacctgtggt gttgagaaac ttcagtggct cccagagcag    116640
     aaagcttcct attgtagaat acaacctccc ggagctattg gaaagccttt ccttggagca    116700
     cgaagagttt attgacttgt gcattctcct cggatgtgat tactgtggca cattgaaagg    116760
     aatagggcct aagagagcac tggggttgat taaaaagcat gggggcattg agaagattct    116820
     ccagagcgag aatttggagg ttcccgacgg ctggagatat agggatgccc agaggatatt    116880
     tggaagtctt ccggaaattg gagatgcaag agagtttaat atttcatggg ggtcgataga    116940
     cagaaatggg attgtgagct tccttgttga agagaaggga tttgacttgg aaagagtcaa    117000
     cagagggatt gaaaagcttg tgaactctcg aaagaaaggg gtccaagggc gtctagatgg    117060
     gttcatagca aggagcaggt gagtcttcta tggcagttac aggtttttat acatcaagtt    117120
     cctcagatac aatggcctac aaccagacac gtgctttttg aagctggaca tatccacaag    117180
     tagaacaccc tccctgtcta tgagaccgaa gtcaagaatg tcaaggaagt aaaataggat    117240
     ttccatgtta gttactcccc tgagctcgtt ggcatctgat gtaaaggccc gaaactctgg    117300
     cacacagctg atatacttta ttcttctttt gaatgccatc attgtaaggg ccacatggac    117360
     agggttcagt aaggagtata gagtttctat ggagtattct ggaatggagt actttttcaa    117420
     gactattttc ttcaacagaa ctgaaatgct tggatcgata ttgtattgtc tctggatttc    117480
     ttcttcattg tctgtggcgg caagttgcat atgcagagtt ctgtatagct caaaaggaag    117540
     aaaacctgtg aaaaatatcc ggtgattgaa tcttgacttg atacgccttt ccagtctgtc    117600
     cagagaagtg cacgagttcg atacaagaag caggcagcag ggatgggtcc tggtcttttc    117660
     aagataatgg tatacgtgca gctgacggga aatgggcatt tctccctcta tatcaataaa    117720
     aaaaaccttt ccgtcgggac tttcgtcttt tggagtggtt gggaggactt taaccactgt    117780
     tctgcttatc ttttctgcat ggctcttcac caccccaacg attgcttgaa gtatttcttg    117840
     gtctggccca cacaggagaa gatgctcccc atttttgtca atcagacgtg ttatctcgca    117900
     gatggtttcc ttgaagcact ctccgacaat ctttgctgtg ccatacatcg gggacgcaaa    117960
     aagagttggt cttgaacaga aaaaatgcta gatcccgggt tcgaaccggg gacacctaga    118020
     tcttcagtct agtgctcttc cactgagcta atccagctat aaagtccatc ccaccaatac    118080
     ttccagactc tgcccccaca taatcatcgt tctgtttacc ttgagcccag gaatggatca    118140
     cgatcccaac aacgcctctt taagagatct cctctcttcc ccacacacag atcttcttca    118200
     gataatgcag tacatgcatg aacatccatc tgtaggcgtc tggcaataca tatgcagtag    118260
     aattagacat tccagtcccc agattcgata ccttcctcag cttgtccatg tgtttctcta    118320
     caacaaagat agaatgtcta gcaagccaat gcacgctctc cttagtcact gggctggaaa    118380
     agatagggag ttttgctgtg cactatactt ccatctgaga agcgctcttg aaagcaacag    118440
     cgacataaga tctatatctt gctactttct gatctgcgac atattcgaga ccgaaagaaa    118500
     gaggatgtgc cggaacacaa ggatcctgga gctgcagtat agatacaaga caaaaaccgg    118560
     tagaaccctt ggaacacttg ttgcaagaaa gggatatcct ccccttcgag gaatcctcct    118620
     gttctttgtg aaagccgtgt catggatggt tcatccaaga ctctttaaga gaatccatga    118680
     ttatgaagaa atgttcctgg aaacaagaga ggtatgtaac atcaatgtga aaagggattt    118740
     aagatttggg aatgcattcg atggccccgg agtaagctca agcatctcgt ttctcgagtc    118800
     cctagttgag atcccaagta ggttgaagaa gctccctcgg cacttaaggc aaagaggact    118860
     agacatggag atcaagcttc taaaccataa cctgcctgca aaggtatctc ttccattcca    118920
     ttcgggaagg tttgtgctga ctgctagagt cgaggaatcg tttctactag attcggcaga    118980
     aaactctcct tttctcgttg tatttgagac tgcactagaa gtgccaagaa gaagttgtgc    119040
     aaaagaggag atcaaagatg cattgttttt gaagcaacag ctggacgcag tcaatgggct    119100
     ttcctctcta agcgagataa atgttgttaa ggagaatgtg atgacctcta tagaaaagat    119160
     tctgatgacc gaaagatacg aaaatacttc tcttgagaac tctccaaact tggaggcttg    119220
     gagaagtgat gaagaaaaaa tagacaaaca tctagatgac attcatgttc agcagaagat    119280
     ttctaagaat tctgttgatg caggaatgct ttttatgaac catagatcgt actctgcagg    119340
     acagttagca gaaggaaata gctcctttgg aaagagcgag gaggaaaaga agcttggagg    119400
     ctcggcaagc tataggcgcc atagcggatg gatacttaag aaagctgaac ttagaagaac    119460
     ctctttgttc aatgatgttg ctggatggac ggcagagtcc gtgattgtaa agacaggaaa    119520
     ctctctaaga caggagctaa tggcccacca ggttcttcaa gaaatgaaga aaatctggag    119580
     aaaagagaat agtcctattt gggtccaagc ttatcagatc taccttgtaa gtgacactag    119640
     tggaataata gagacggtgg tggatgcttt gtcaatacac aagatcaaga aaaagatgat    119700
     gtcggaaaat aagaattact ctctgaagaa ctacttcaca gagtccttcg agccaaacag    119760
     cgaaaagtac aggagctgct tgcgaaactt cctctactct cttgtgggat actccctagc    119820
     cacatacatt ctacaggtca aggacagaca taacggaaac ataatgattg atgggcaagg    119880
     gcatatcatc catgttgact ttggatttat aatgggaaat catccgggtt tctactgtgt    119940
     cgaagcagcg ccattcaaat tctcaaaaga gtatcttgag ctcctcgagg gtctgatgga    120000
     tgagttcaag gacctgtttc ttcaggggta catggcactg agaaagcaca gcagcagtct    120060
     tttcaggatc atggagacga tgccaggaag ctctagtgta gagtgcttca acaggagaga    120120
     gcttcaaaac ttcaaggata ggtttcggat ggatctcaac gaggagaggg ttgaggaaca    120180
     cgtgacatac ttgataaata agagccttaa cagtatggga acggggctgt acgattccta    120240
     ccaatacttt tcatatggat atctttagac aaggattaaa caactttttg gacgaagggg    120300
     atctttatta tgttgcttag aagagttcgg ctaccaaaca agccgctggt gatattgtct    120360
     tggaagaact ctgtatacat tggagatgcc cacggagttg tgtatgagat gaagcatccg    120420
     tatattgctc cagtggccat attccaatct ccaggaccgg tatctgcgtt ggatggagca    120480
     gaatgcctgt actatgggaa ttgggatgga gacataggaa tagttggcgg aggaaagatt    120540
     aatctgggaa accatatggt gaagtgcatg gttgttcacg gagacacagt gtatgcctcg    120600
     gtgggtttga tggtatatgg tctaagtctt gaattgaaga taaagtgttc ttacgaggtt    120660
     aagcacaagg ttttgtgtat gacttccttc caagggtcgg tctattgtgg catgggagtg    120720
     tcatttctat cacgcattca taatgggctt gagattgttg gaaggagttt gcatgatacc    120780
     tcgatctttt gcatttcagg agagtatacc ggatctgcag acggaaaagt cctaaagcag    120840
     gattacgatg aattagagaa tgctaaagag atctacagag ggaaaaactg gatcagatca    120900
     atgtacaacc agcatttatt ttctgatgga agagatgtaa tgggtgacat tgatggtctg    120960
     aagggaagct tggggagcgg agtaaagctc atgtattctc atgaagaaga tgtggtggga    121020
     gtggttagag taggaggcat gattatctcg attggactgg actactgctg caccatcctt    121080
     gaagtggagc caagcctcag catggaggaa gaaaaggaac tagcggagct tatgaacgga    121140
     tagggtgttc tgtttaacag aatgtggaag cctatttgtt atgacaatgc ttaaggccta    121200
     ggaagtcgta aacaaagcca aaatgtttct gcctcctgaa gcaaacacaa gggagagaag    121260
     aagatttgat ctggacgacc tccgggttta ctatctaata tgtgaggagc ttgggatagc    121320
     tgaggaggag cacatccaaa aatctttcta ttaccttatg aaatgggcag ggcaagataa    121380
     gtttgatgga gaggtggggc ttcttaggaa ttacataatg aagattagaa aagaaaagca    121440
     aaataagcct ggtgagtgga gcatgctaag gatgtaagag aagatgctcc ttatacccta    121500
     aataaaaaaa tccagatggc ttcagtcctc ctttcgccaa tttgattccc caatactatt    121560
     ttatttatca ctatccacga gtctggtaga ccatcaacaa ggcacatgag agaacaacaa    121620
     ttataacaaa ctctatcatg ccgaacagaa tgatcaggat cggcagaaaa gaaggctttt    121680
     ccgatagaat tctgaatcct cgttttccaa gggccgagca gaccttcccg gatatggctg    121740
     ccgtcatccc taccatcata catgccgaga agtatgaaat gctctttccc atgtctagct    121800
     tttcatcgat gttggtcgcg atgattaagg caacaaggaa gctgctgaaa aatattgttg    121860
     atatcattat catgataaag tatgtgggcc cgagtatgga tctattctga ctgcatagaa    121920
     tcgatgctgc tcccgaggaa accatgcctt cgcatgcacc ataaactgca agggctatct    121980
     caatggcaag gcccaaggag acaatcgaga gagctgtatc actgtcactg cctgcctcca    122040
     tcggaatgat gggtcccacc aacaaaaaca tcaaattcat tcactttgaa aacaagatcc    122100
     ccgacgcttt caatggggtt gcttaagtac catggggtga ccgagctgtc gggaaagcct    122160
     ggatctggaa agactgccat tgccatcgag gagtcgaagg agtttccaac catatatctg    122220
     acaacaacag cgttctgcat agagagatac aaggggtcgt ctaaagaggt gatggatcgt    122280
     gtggttataa agtacatccc gactatcggg catctggcat cttttgctat gaactcgata    122340
     gagaggattg ttgtggaaag taacaccagg ttgattatca tagatagctt ggatcatctt    122400
     cttgccacag aaggcatggg gatgtcgcgg ggtgttcttt ttggaatcat caataagctc    122460
     aaaagagtga gccaaaagca tttggtgaat attttggtcg ttacatgtca ctacgggacc    122520
     tggactgttg ggtccttttg catacccaat cctgtccttg ggcttcaatg gatgtatatg    122580
     gtgaacacga aatacatttg cagcagaaac ggagagaaaa gaacgcttaa gcttgttcgt    122640
     tctcctttgg caagctctgg gacgtgggag tttgagattg ggccgtctag ggtatatatt    122700
     gtgtcggaag cctttgagta aggcctatct cactgtctct agtaaatatt ttatgcttct    122760
     taaaccgttt atattccatg acagacagaa caggacctcc tctcaggatc ctctcggatt    122820
     cgctcaggaa gtttagatat atctctggtg ccatgtttta cggcagaagg gaggtgtctc    122880
     tcatagaggt tgctggagtg tgtgtccata gagatgggaa gcttgctcgg atgctagatt    122940
     tctgtggaga ggtcctgatt gaaacaggag gccaagagat cttcttggac ttggcgtatc    123000
     tgttggtgtg tagagtgtac atgaaagatg gaagaatgaa cttgtgttgc aaatccgcaa    123060
     ggaggctggg aatttttgaa gagatgttct tttgggcaga ggcttctaac ctaagaagat    123120
     cattaaaata caaccgaaac agacattgaa atttaatatt aaagattgct tgtcttcagg    123180
     tcctttgaga cgttggaaac aatcttgttt tcaggttttt caagtagctc cgggtccgaa    123240
     taccccattt ggagatggac agcatatttg ctcctgtcaa gaacctcttt actgaattca    123300
     atcttggatt tggtggcaag agcaggccca ataaatggcc ctttaaatat cttttccttt    123360
     tgcaactgcc tgcttagtgc ataaagacat atgacaacct gtttcagatc ctttgcttca    123420
     aataggtcgt tggtctgaaa tagctcgtat tcattcatct tgagtttttt aagtccgtta    123480
     ataaacgagc atatgttttc cctttgcaca aatatttgct tggactcctt atacttgaca    123540
     tcgagttttg aaaccttatt aaggaatctg cagagcctta ctccatcctt gaataggtca    123600
     tggaatgtcc cagcttcaaa cttctctcca aggacagtct ggatccatag tgtcacttcc    123660
     tcttgttgct tatccattcc agggcatctg ttttatgatt tacttatcaa accagcatca    123720
     acaaaaatta aggttcaata atatagccat ccaaaagggg aataattgag acatggagat    123780
     tttattgggt tgctcccttg ggcttctgga taaggaagtc taagaataca atcatggtta    123840
     ccactgttac aatggaggtg accaatgtac taaagagaag cgacagaaca aaaatccctg    123900
     tcactgccca tgaggctgtg caagtggtta gaaggaggaa taagaagatt gtcttaatgg    123960
     ctcccattcg gtctctatgg agattgactt tctttccttc aagatctgtg gtaaggattt    124020
     catatgtaac ttgtaagctc ccatggcaaa gtctgtttat gaagtatctc tgtaaaccta    124080
     ttgctgaatc tcttaatgtg tcaatgggcc tttgctttct tctggaaagg aaatggctct    124140
     tcagggcaaa cgatcctgag tattgcatcg agagagagtt cccatttttg taccacaggt    124200
     acttcatctg gtcgtagata ttctccttat ttccaatgtc gaagtgggaa agttgtttgg    124260
     aaagaacatg ctctccaatg atgaactgag atatgtttgt tctgtccaag caatcaatac    124320
     aatttgtacg aataacacca ttttgagaac tttctggccc tttgtatcca aatagggaaa    124380
     gagtttcgtc tactagaccc agaaatctct cctgagtatc accttcgaaa atccctcctt    124440
     cctcaaagaa attgaagtgt actcccttct tgttgtttcc aagcaattca ctttcatatg    124500
     catcgtgtaa ttctccttcg tatccagagc ttcttatgag gttcagatat aaaacatcgc    124560
     catacttgct cctcattatg tcgtcggcta ggtgaagtat tttcctattg ctgataacta    124620
     tctttggatt gtattctctc ccaagaacat gcttccacat caaaggaatc gaccctcgaa    124680
     cctgtaggtg cgatgtggtc ttctccccct cataaacaat ctgctccgtc tcaacatagt    124740
     tcgagacata tcccgatgaa tccgatcctc tggaaaagta tcttgctcct gctcttctcc    124800
     aagaccttct tgaaatcagt ctcaaacata ctgctccaac atctatggac ccaaaaaacc    124860
     cctgtatgca gctcagagaa aacagagatc cttgatctcc aacatgtttt aggaacctct    124920
     caagtggcag ggagttgaag aggaaatcca agtcgtcgtc cttctttata cttatcgact    124980
     tgtgaagggg atatgtgctg aaataaatcc ctgtatttcg gagaaacttt cttacctctt    125040
     tcatctcact tgagaagttc tctgtcttcg acctctttag ccgaatgatt tctacatctt    125100
     ggatctcgta gacagcatgt tcatacatca ttcctcttaa aacagcatct acaaccagaa    125160
     tgagataaga ggacttggaa atcgtaacta ttccataaac tccgtatgag tgataaacag    125220
     actttcccga gtccatcttt tgtctcttca agatcagagt tgtgttctta tcgatattct    125280
     cgagcatgat ttcctctgga gaggtagaga ctttcaaact tgttcccata ttcattccag    125340
     gggtcttcag ggttgggaaa atattgatta tatgaaataa tgatttatct catcatagac    125400
     caagaatttt gaaagtagag gagatatgaa gcgaaagggt agtataaaga acaagaaaaa    125460
     aagaaaggcg aaaattatat cttctacaag caatggcatg cagtgtccat tggtcgatcc    125520
     cattatacaa gagagataag taagtctcct tgcagcagac ctagcagttt cctctcccta    125580
     attaacttgt taaagaaata taatttatct ttcggtctct taaataattc gaaaattgtt    125640
     gggggtatgg acaactttgg aggcaacttc tttaattctt ataacaataa ctctaccaga    125700
     gagacagaag gaagccaata ctttgatcct tactttgtca agcatcgaaa aagaacaacg    125760
     aaagcacagc tcaaggttct ggaggaaacc ttcgagacca acatccggcc ggatgcaaac    125820
     atgaggaaga agcttgggga agagctagga atgacgccta gaagtgtcca agtatggttc    125880
     cagaacagaa gggcaaaaat caaaaagctc acacagaaga agatgatgca gcaagaaaac    125940
     acagacaaca ccaagggcca ggagacagcc catacaccaa gcccatcaaa agaaagcaaa    126000
     tacaacggct atcacccata catgcccatc cagggacctt tagaagagtt caatgtatat    126060
     ccaagagata acagcatcta taaacatgca ataccgcaag gaatgggatc tccggtgatg    126120
     tatgagggct ttggatacag agggcatgaa gaatacggat atccctatgt acagagatat    126180
     ggaaacggag agtactatca aatgcaatat ccgtatggga tgatgcaggc tcaatggcac    126240
     caacctccag gattccgtga cgaagattac tatcgctcta ctagaaaaca gcaatataga    126300
     ggaggcgcac ccaatcctga aaagatgtag tcttcgctgg ggtatgtcca taaattcacg    126360
     gcctgcaaga attagacttg ccacagaatt ttatatcttt aataatatta aaactttagg    126420
     taaatgcctt ggtcttggta agaccatttt tgcaatttat ctacttacat ttgtattaat    126480
     aaaaaggaga aattcaggaa gaaaacgaaa taaagcgtag aaggcccatt taataccagg    126540
     cattacttgt atcggcatag acatccatgg gatccgcttt ttgagcactt ggaatcttct    126600
     tttctgtccg aatccgagca cctacacttt tccatctctc ccgatgagca ggggggacat    126660
     ttgcatgagt tatcaacgca ttcactgttc ttacaagtct tatttccctt catagagctt    126720
     tgtttttttg tctataaaag ctttcagatg accattgaaa caactccaac tcatttcgat    126780
     agctgtcatt atgaatggtg ccatctgaca aatgattgtg gtcttccact acacccaagc    126840
     tcaggttaaa acctatccat tggaggatca aagagaatgc tatcttcgtg agcctcccct    126900
     ctccttctga aataacgtat tccaataaag atgagatatg acaagatgaa gatggcaagg    126960
     aaaatgaata caattgtgat aacatcgcta ggaaatcccc aaaagtggaa aatagatcgt    127020
     tgagaacggc ttccacattc caaacgaggt atctttagca cattgtatga tcctctgcta    127080
     ttccagaatg agttctgatt cagatatccc cagatttgag agaatgtagc tcttggagat    127140
     gtttctagga aaagagcaat cgagcttgca actattgctg ccgataggct agtccctgca    127200
     gcactgtttt ctcgaagaac ctcctctccc agtgcaaata tcctcacaca atctccatga    127260
     tttgagaatt tggatactcc agcatacttg tttacagacc cgacgttgat gactgacttc    127320
     gagcttccag gagagtaatt gcaggactgg tcgtggagat ttccagcggg tgtgacaact    127380
     accattcctc gactagatat atggtcgaca acagcgttta aagcctcgga ataaggcccg    127440
     gaaaccccaa aaacaagaat ccctggccct cctttgcttt caaggctttc taatccgtaa    127500
     atcatgtcag aaagcataac ctttccatcg cacccgacta catcaaggac attcagatga    127560
     ctgtccttgg caaatccagt atctcttccc accagaagag aggccatcgt gtctccgtgc    127620
     gtgttgcatg attcgagacg tccacttaga ttgcagacgt tgtttacagg tttgactgtt    127680
     gtatccagga gaaatatgct tactcccttt ccagtatgat aatattcgta gaacccaaaa    127740
     aaacttgcca tcattctttt gatctgaagt actcggaaga tccagttgtc ataaaagtag    127800
     ttgttgaaga tgatattttc ataatacttc atcagataca tgtagtttgg aatgctattc    127860
     tgaaatgcag acacaccgta tatcttgtct tcctctatat gcatgccaat cccactacct    127920
     tttttcatca cattctcatt gtttgagcaa aaggacacac ctgtaacatt cttagtatat    127980
     tgtctcttga tcttcccgtt ctgtccctct acaaaggcag agatgtttga caggtctcca    128040
     tcatgtacgt ccttcgtcaa gatataacac ctctcccttc caaaagtgta attgtcgttg    128100
     cctttacatt gagtatcgtc caggttacta cctgtcttta tctgtccctc atatcgggct    128160
     acagagggaa tctgagcatc tttcctgggc tcttcaactt ctaccacaac ctccttgacc    128220
     acagttcgaa cttcagtctg tacctctata gagggtatgt ctgtaggatt tcccgcttcg    128280
     tatgagtctt tgtttccttg aaaaagaatt ccaggtgggt tttcctcctg accttcttgg    128340
     atagacttct ccagtcctat aatctcacct gtactcacat cttcactacc ccacaccctt    128400
     tgtgatacta ttagaaccat aattcccatt agaaacatct acttctcctt cacatcgggc    128460
     agaaagtaaa tccttgttcc caaagatatg atacccatgt ttcactttcc atctgcagta    128520
     gaactcaaca aatgaaatca gccgacaatc gtctttgtta cataaacaac ccataaaata    128580
     gactttaatg gttattcatc ttttttttcc attcaacagg acatatctcc ccattttcgt    128640
     cgttgaaggt gatagcatca attaaacgga ggatctcgct aaccgacctt ccaactgcat    128700
     ggtaattgat gcttaggtgt ttaacatcca gatccttgga gagtattacc gtgcctcgca    128760
     tggggtgtcc gttctcctca tcaaacatct caaactgatt gcagagttcc ctcttcatat    128820
     cccatatcat tggccatgaa acacctagga tcccgccatt ttcccttgat attgaggccc    128880
     atgcacgatg tgagtagacc gagtcgcagg aaacaaacag aactaaggca ttccttttga    128940
     gaaactcctc tttgagatcg caaaatctgt tgacctctgt aggacataca aaggtgaaat    129000
     ctaaagggta aaaaacaatc acaacatatt tccctctgta gtcttcaaga gaaatctcct    129060
     tgatttctcc atcaaccagt gccttgtatt tgttactagt aagaacttta ggaaatttca    129120
     ttagggttga gttaatcttt ctacaaatat aggggaagac attccatatc tggatcatta    129180
     agagacctaa tccattaggc ctttggatac cattcattgt ttaatagctc ttccagctca    129240
     tacaattcgt tgcagaagaa gcctttctct cttgcaagat taagaagctt cctagccttt    129300
     acaaagtttt ctttttccat gatgtttctt cttgccatga tgaacaccga ctccttgtac    129360
     tccagcagct tgtatctttc catgttcaac tcaatctcct cgagagtctt tttaatagca    129420
     tagttggata tcagatatcc cgatgccctt ttgtacaacc caagattcac atcatgcttc    129480
     actctatact ttagaaatga acctatgtct agcgtcttaa gggctttggt gtattccaag    129540
     agaatcatac ctttctcatg gtcctcggac ttcctaatga ctttgttatc tatcgagttt    129600
     attgcctcga acatttcaag aaagagtggg gtgcgagggc ctttggtgtg tgagtttagt    129660
     ctttgtaacg tcaatttgat atatacaccc acgacttaat tctcaaggag actgcttaat    129720
     ggaaaaattt gtgcccttgc caaatgagct gcaggaagtt caacgcaccg agacatggat    129780
     ctttgcagtt ctgcccaagg aaaagatcga agacaatcag gccgtctgta ggggcgtttc    129840
     cggctgacga tatctcccag cctgtgcatc tgactggatt tatggggtac aaggcaggga    129900
     tgacacatgt gataaggact aagacccagg ttgcaaagaa caagcaactt tctagggagg    129960
     tgatggatgc agtgactgtg gttgaagcac cgccgatggt tgtgtatggg attgtgggat    130020
     atgagaggac tgtgactgga ctgcacagac tcccgattgt cacggcatcc tatgtgaacg    130080
     atggagttct ccgcaggatg tttggtaaca agtacatgga gaaggaggcg gcggcccagt    130140
     tctgccgagg agaagtgacg gagtcccggg ttgaagagat caagaagagg gcagagtgtg    130200
     tgcgagtgct tgttcagaca cagccggaga tggtgaagac acttgggctg aagaaagcac    130260
     acatcgcgga gatacagttg aatggaggaa gcatctgcga gaaggttgag tgggctctgg    130320
     agaggcttga gaaggagatc cagattgcag aggtgtttgg agagaatgag aacatcgatg    130380
     tgattggggt gacgaaggga aagggattcc aaggaacagt gaagaggttt ggagtacgaa    130440
     agcagccgcg caagtctcga aaggggatcc gaaaggttgc atgcattgga gcatggcatc    130500
     cgagccgtgt gatgtactct gttgcacgag cagggcagat ggggttccat agaagaacag    130560
     agaagaacaa gagggtgtac atgattggaa atggaagcac caagatcaag actgagtttg    130620
     acctaaccga gaaggcgatt tcgccgatgg gaggattccc tcactatgga gaagtgaaga    130680
     acgacttcat catggtgaag ggggcggttg tcgggccacg gaagagggtt gtgacgcttc    130740
     gaaagagtct tacacagcag aggccgagcg aggagcttgt gatcaagttt gtcgacacat    130800
     cgtcgaagat aggacatggg cggttccaga caagtgcaga gaagaaggca ttctacggag    130860
     caaagaaggc agaaacagtc gccgaagtcc attaaactct tcaatattat atatgtcctt    130920
     actttagatg actctgattt gtatttccat tctaattggc ttgggaaata ttcgcctttt    130980
     cttttgatta tttattcata tttttaaccg ctgaatatga taagctcaat cggctttctt    131040
     cctggtggag tttcaataga gagactcaag gagtttgtgt atgacgagga catccatcga    131100
     gcattggact atcttggaat tccggttgtc gacaagtcga aaatggcttg cgacgatgac    131160
     atcgacgagt cggaggagat agtagaaaac gacattatag tcttctgcac tccaaacgag    131220
     gatgatgtga gtttcttgca gttttatgta cagaacagag aatgcacaaa cattttcctc    131280
     caccacgaca catatgtgtt cagcactatt tgcgattcta cccaagccgt cattggagga    131340
     gagacgtatg ttgcactggc cacatttgag aaggacatta tggtgtttga tccatttgtg    131400
     agaaacccgg tgcttcctca agttcttctt aaaggacatg aggaagcagt tctgtcaata    131460
     gagtgttcca atggagtgct ctttagtgga ggtcttgatt caacgattat tgaatgggat    131520
     actgaaaagg ctcttcccaa aaatagaata caggccatgg gacctgtgaa taagcttgga    131580
     accttgaatt catcggtgat ttattctgtg gaaaactctc tgtattggac agatagagag    131640
     attaggtttg atggagaagt tgaaagaata aggattatgg ataataaaat gcttgtatcg    131700
     gactccacag ggatcttgag acattatgac ctaagaaatg tatctgatcc ggttatggag    131760
     aagagaatcc acgaagactc tattacagga atcgatgtgc ttggaagtaa tgtgtataca    131820
     ggatctctgg acggaagcat aaagattgta agccttgaaa cgtttgatgt tatgaacagt    131880
     gaagacgtcg aagagaagat attttctcta aaggtgcatg aagacgggtt ttatgtgtat    131940
     ggaggagaga agaacgagcc cgagcttaga tacatcgact gctctaaaga cgagtgattt    132000
     ccaataaatc atcttaacag atgtttagta gagattttga aagttattag cttggatccc    132060
     tggaaatggc atgcacaaga tgtggggtgt cccaagccat agtcatccgg cctaaggata    132120
     agagtaaagt ctgcaaggca tgttttttca atggttttga ggaggatgtc catgaaacaa    132180
     taacatcctc aaagatgttc aaagaaggag acaagattgg aatcggggtg agtgggggaa    132240
     aagacagtac ggtgctggcc tatgtattgg accttctcaa caaaaggcat aagtatggga    132300
     tagagcttat actactcagt gtagatgaag gaatagcagg atacagagac cactccatcg    132360
     aaacggtatg caagaacagc aaaagctttg gattgaagct taggatagtg tcatttgaag    132420
     agatatttgg agtgacgatg gatgggattg ctcataaaac agggaagaga ggaaattgca    132480
     catactgtgg ggtgttccgt aggcaggctc tagaagaggc ggcaagggaa atgggagtag    132540
     atatgatagc aacaggacac aatgcagatg acatggccga aacagttctg cttaatgtaa    132600
     ttcgaggaga catttccagg cttggaagat gcactcggga aaagacaaaa gagcagaaaa    132660
     atggagacgg aaaagtgata tcgctttcga gactcaagcc gtttaagcac atttatcaga    132720
     aggagatagt tctttatgca ttttacaaaa agctggaata tttttcaacg gaatgcacat    132780
     attcttttgg agcatctcgg ggagacctca gaatgctggt gaagcagctg gaaagggaag    132840
     atccgagagt gatactggaa gtgataagaa gtggggatct gcttcagcag aaggagtgca    132900
     tggacagaac acctggagag tgtgtgatgt gcgggcattc gacatcctcc ggggatacca    132960
     tatgcaacgg atgtactctg atcaagagat tgggtaatac aaaacctaac tattgaggtt    133020
     tacttgaaca ggctgctttt ctatcgagat ccttttcaag aagccagact gatatgtggg    133080
     agacccaata cacaaatgtg acaatacaac tatatacaca aaatattctg acgtctggaa    133140
     gaaacgtcat gatagacaca aagacatata ccaaggctgt tgcccacgtg ctcctatgaa    133200
     ttccaaggcg ttcaatgtga tttaatagga ttatgtatcc catgaatgtt gaacacagaa    133260
     gattgaagac cgaggatggc tcattgaacc tcgacgaaag aaggatgaat cctaggaaat    133320
     aggatgtcaa gccaagtatt tggttgcttg atgttctctt tggtatgttt atactttctt    133380
     caagagaaag aggagtctct tcatctttca cttcgatagg agatcctgta ttatatatgg    133440
     atgcggacac agagtctata atgaagaata actgtgttat tgtgaaatat acatatagcg    133500
     tagtgggatg tatttcaagg gttagagttc ttattaaagg agataacaag tatgcaaatg    133560
     ttagaagcat gaagtttggc tttagattga ttcctgtgtc ttctctattc tctaaaaagt    133620
     tttctataaa tgtggaaatg aaagagaacc atgacgactt tggcatccca ggcttatcct    133680
     ccagcatcat aaccttgaaa agagagaggg atagcattac tatggatatt ctaatgacca    133740
     ttctatttat gtcttcgtag atctcattca cacctctcct cttgcacacc tgatgaactt    133800
     ccatgtagtt tattgggtat tcctgctgta aatacagaca tctcttccaa agcattcaaa    133860
     tacccttcag aaccaccaag aatttaactt tgttctttta ttttatgtgc atagatagat    133920
     cctttatgga ttaagtttta tgcatctcga cagatgctgc gtaaacttgg ctgccatcac    133980
     ctgtttccgg caagatgggc attttagcct tggaactgag gtacaaggca ccgttgcata    134040
     gtttccaggc tttcttatat atttctgtgt gcatctttcc tccaccacct ttaggaggta    134100
     tttctcaaga acatagcgaa atacagactc catgatttcc ccgttcttca taaacaaaaa    134160
     acaatctccc cctcatgaag gttctactat ttgccattgg agttctgtgc aggagaataa    134220
     agctagagcc caaggagcag tttgtattca gagataaggt cacggcaaac cagatgtaca    134280
     agtttatgta tcaggctcca cgatctggaa aaatcgagat gacggtgttt gatacaaaag    134340
     gaagacagat gatcaagact cgagacccgt actcggtgct gtactccaaa atgaatgagg    134400
     atggagagat tgtgatatct gttaagaaca acagttcaaa aggcattaac tttggctaca    134460
     gatgcccaga caccagcaag aaagctcaag gagaccttgg gccaataagc gttgatttgg    134520
     tttcggagct ccaagaagtc ctagagacaa tcattcaggc ccagagagtt cacatcaaga    134580
     aacatgaaga acatgcaagg atggttgcag gatcaaggaa gtgggttaca aggctcttga    134640
     tctttgaaac cctcttcttc acaggtgtac tgtacttctt gcacaaggat atgctgaaga    134700
     tgtttgaaac caaaagagaa gtttaattaa aggactcaac tcttctaaaa agccttatga    134760
     tttcatttgc tgtctcttct aatgtcatgg cgtcgttctc aatgaccaca gagccactag    134820
     aagcaacaag ggggccgtgt tctcttgtcc tatcatcatt gtctcttttc gatatggcat    134880
     cgagcagctt ttcataggat tccgatccat tttccttata tcttctcctt gccctcgtct    134940
     ccgggcttgc cgtaagaaat accttcagat ctgcgtcagg cattatctcg gtagctatgt    135000
     ctcttccatc aacaattatt cccttctttt caagatctat tgtggatctt tggatttccg    135060
     acaccttttc tcggacatac ttttcctttg caacggaacc aacattatta tcaatctttt    135120
     ccccacggag atgcccagat acatcttttc catcaataaa tactctattg tctcttacct    135180
     ctatgttcaa tccaagaaca aactttttct gattctcgtc cttggggcac accttctcaa    135240
     actgccttgc cagggcatat gtcacggctc tgtacagatt cccagatatc agatgagaaa    135300
     aacccagttt ctttgcaaca agatcagatg tgctgctttt tccacttgct gcaggcccgt    135360
     caacggcaat cttatacact ttcattgggg atacaaaaag cctcctcttt aaattccaag    135420
     tctcacagta aggaaaaccc aacaacaatt ccacattcat acgctgcaaa aagatgcgtc    135480
     tctcctatcc ataaatctat aaccctttcc gagctgtcat taaaaagtct tcctttcgga    135540
     tcgaatgcct tcagttcttc ctcggagtgt actagcatca cctcatttcc cttccgcacc    135600
     agctggaaaa gagtcttcgt cttggttttt ctcttgttaa tctttccatg tttgatggtt    135660
     ccatcaaatc ctccaatcaa aatcttcttt tcatttggtc tgcagcagga cagagagtag    135720
     ttgaacatca cggtggctct gcggtggctt ccctcatcat gtaagatttt tgtaacattg    135780
     ttcagtgtgt ccacaataat aacggtatct gtttggctta agtatttgat aaaggtatat    135840
     cccgagggga aggatatcct ttcttcttcc tggaactcgt taccaaatct aaatatcttg    135900
     ccattaagac ccaaagcata aaagcaaaga gatcctttgt ttggacttcc tgtggaatgc    135960
     tctccatcct ttcctttcct tgtctttttt tttatggcta tggatgttat cattcccttt    136020
     atctcattaa ataccgacac aacagagttt tgacgtatcc acacgagaat gcctccatct    136080
     gttgcaaaaa taatatcctc gtcccagtcg atctcaaagt tcaccacccc acttgtttca    136140
     agctgcacca tgttcctgat ttccccttcg aaatcaaacc ttcgaataaa cccgtcacta    136200
     aatagagcaa cacaccggat gacatcttcc tcctgtcttg cttctatctt ccggcagtat    136260
     ccaaaactaa aactcaggat ccgcctcaga ttcagttctt ggtcaaacaa gtagacttcc    136320
     gaagcctccg acgagaattt gaacgttgat tctctctcaa agcctttctt aacgcccaca    136380
     aaaatatatt tactgtgttt ggagggaagt gatacagttg ttatgcactt cccagtgttg    136440
     tacaggaaca aatcatcggt ttttattctt ccgaggactc tgataatctt tttcttaagc    136500
     ataatacttt ctataggccc ctccatcact tctacgatgt ttgattttct gtacgtctca    136560
     aagaccgcct tgtcgacgtc tccacttcta tccagatgga ctatgtccag ggactttttc    136620
     ttgtagcctc ttgtattgga agatgggatt tttggctgtt tggatccata gccatcccgg    136680
     tactcgttag ccatcaaggg attttagagt tgtattttgg ggactccaaa cccataaaaa    136740
     atggtttttg aatccgatct tccagaagca actctggagc gctactccag gcagatcatt    136800
     gtcccgggaa tacatgtgaa aggacagaag agccttggaa gctcgggagt attagtggta    136860
     ggatgcggag gattggggtc tccggccatc ctgtatttgt tatcgtgtgg aatagggaga    136920
     ataggactgg tggattttga taaggttgag atccacaatt tacagagaca ggttatatac    136980
     accgaggcag atgtatctca gtacaaggtc acggctgcgt tatcctttgt caaaagagcg    137040
     aattctttga ttaaggctgt ggggtacaac gagtttctgg gaagggagaa tgtcgaaaga    137100
     attgttgccc cgtatgatat tgttctggat tgcacagaca gcatatgcac aagatatctt    137160
     ttgagtgact gttgccaggc tctttccaaa agtcttatct gtggatcggt tctcagatgg    137220
     gaggggcagt tgtacaagct tactccagat ggtccctgct atagatgcct gtttccagac    137280
     atgagggaaa gaacccttac atgtgaggat gcaggtgttg tggggccgat ttgtggaatt    137340
     attggatctc ttcaggcttt ggaagcaatc aaaacgatta tgggaaatac cgagcctaag    137400
     atgacaatct ataacggtat aacatcaaac tttgtagact ccaagcttag gagttcaagg    137460
     aatgactgca ttgtttgttc aagaaaatgt atcccagaag acctctactt tcccacagct    137520
     aagtgtacgg ccgtctctga tgacaaggca acgaatcaga atgtggagac aattaactgg    137580
     gaagacattt tgaataatct cgactcctat cttcttatag acgttaggcc accaatacaa    137640
     cacgagatgt tcaggataaa aggttctgtg agcattccgc ttgcggatct accagataag    137700
     attggagata tcgaggcgtc tggaaaaaag ataggagttg tatgcaaaag aggaatatcg    137760
     tctcgaaagg gagcttggat actgaatatg aatgggattg aggccttttc tgttaatgga    137820
     ggagtcgaca ggctcaaaag tctcctgaga aaaacaggag ctggtccttg aataattttt    137880
     tccaaaagtc aagtccatac agatgtcggg gaagtcttta aaggaagttc tgaacttgga    137940
     gatctttaga gataagaaga tatgtgtaga tgaggttctc cctcagaatg tggattttct    138000
     tattgttgat ctttcggatg ccttgggact ctctatatct gcattcagcg aagagacaga    138060
     tcactacaga aagattgcaa aaagccgcaa taaacaagtt tctgtaaatt cggcctatga    138120
     tggagattgc atggagccag acatcatgga tgatgtatgg agtgcaatga acatatgggg    138180
     aatagatgga tgtgggaaaa ttcaagtata taggtcaggg acctgcaaga agtcggactg    138240
     gtacaaatac gatatcgtca ttagggttca gccactggat agtggaatat ccaccgacat    138300
     tgatggaaag attctaattt ttggaagggg gagaaagtat cttgagctta gatacaagat    138360
     attaagagac agagttgact attacactca acagtttgaa taggcaataa aaatcccaag    138420
     atttctattt gtttatagga atataatttt catcaagcaa aagcttctgg aggaaagggg    138480
     aaagcagcag cccctgtagt gtagtggtta tcacgcatcc tttacacgga tgaggtcctt    138540
     ggttcgatcc cgagcggggg catttttcta ctgtagatga agaaagaact tctttttaag    138600
     aggatttcct tgtcagaaaa tgatataatt tctctttttt ccttctagca tatttatcac    138660
     cacagatagt tcataatatg cataccaaat aaacaatatt attagcacaa cagatatggc    138720
     tatgttgcac gaactagcaa actcgtcgga gatctccagt tcccttcgaa aaaagggata    138780
     aatccttttg gtaagttcta aaaggtagaa catgatcatg atataaaaaa aaggagtaag    138840
     gactaatgct atagcaaaat taacgggctt tgggaagttt agaagatttt ctacaatgtc    138900
     ctgattttcg tgggagacaa ctacgttaac cacccagcat cccataacct ctgcaagtat    138960
     ctcaataaat gtaatacttt ctatattctc cagaagactc caagccgaag aaaagaaata    139020
     ttgtgctttt acaaaacgaa taacatgctc tggccccaga ttatctttca tctttttttc    139080
     gtttttacct ttcaagagaa tcactagaat agagacccga acaataagca tcaaaacttt    139140
     ccggaggtca atggtcttca tcttaaacac actaataaca cttttgaaga agaatccaag    139200
     agtgatgttt gcgaatataa gaagtgtata aataatacag aaagcctttc taatctctag    139260
     taccattttg acttcttcta tttttttggc ctgcttctct atgttactcc aaactaaccc    139320
     gaactctaga aacctcttga aaggccatag aatatatcgg cttggaggaa aaatcctata    139380
     gattgcatta aagataaagt cccaccgaat taatcctaat ataacgatca ctatgcaagt    139440
     ccacgtaagc cagaaaaaag tccagaatac tcccctttct cttttttttg aatatctgtc    139500
     tttcctttta gtaccatcta catcctgaga cttttttaaa gtgtccatta caaatatcaa    139560
     ggcactgtct ttttttgagt atttgcatct ggctccctgg aaagtaattg cataaaactg    139620
     atgaatattg aaacaaaacc gattagttaa ttacagattt aaaggagaaa tagaaaatga    139680
     catccaaaga ggaatacatt tactaagatg ttatctatct tataatcttc cttatctaaa    139740
     acgaaaggac aaaaacctag aagataaaaa aggtttctgg cctaattctt ttgccatatc    139800
     tatacccttc tcgaacacga aaaagctcaa caaaaaaagg atcaatccac aagctacagt    139860
     aagaatcttc cttgggagtt taaagttctt caagagcttt ttctcaaact tcataaagat    139920
     tcctatgatt atcataacaa agaatgatat gaagaagact ggaaatacca cttccagggc    139980
     cttaagtata tctttctttg cacttacatc gggaatccca cggctaataa agtcaatagc    140040
     aattttcaaa agtgattgaa atttttgaaa ctgtttttct tctataatgg taacagtctt    140100
     tgtcaatatc cctccgctta gaatagctgt aattgaaccc gattcaaagt cctcggaaag    140160
     tatttgagac aagaacagga cgtaagatat aaggattgct gatcctgtct tttctgaagt    140220
     catttgaaat ttcttagatc tccattcttg gattacaaac atcattaaaa ctagatctac    140280
     taatgccttt gcacattgta gaatttctaa ttttctaaaa tcttcggagg aggagtccca    140340
     aaccttatac atcagaattg tataggccat tttaatgcac ggaagtgcca tagatacatt    140400
     agatattatt cgaaacacca tctttttagt tgaggtctgg agagggaaga cttcaaggaa    140460
     ttggattaat atatacgcca taatagttat gtagaaaagg aatactattt tctgtatctt    140520
     ttccttgtta ctgggcctaa tcagaaatct atcctcctcc tcgccatctt ttacatcgat    140580
     gatggagttc atatgcctcc taaagctaaa ttatttatat aaaatccacc aataaagtca    140640
     ccaatcatgc taggccagtc caaaatcaga gaataagcta agattctttg tttgttgaaa    140700
     ttgtttggtg agcagagccc tttaatgaac gggcagaagc aagagaacat cattgaggaa    140760
     aaggatgtgg gatttatcct aagctatgga agaaactatt acgccgaagg aataatggaa    140820
     aaggaagcag agataaggag gttatttgaa caggtgagcc tgaagcttgg gactaaagag    140880
     gtggagacgg gtcttgcacc tccgatgtgc tgggatcttc ttggagatag aaatagaatt    140940
     cagagcgagc ccaatctcca ggttgccagg gtttgcaagg tgcttgaggg ataccaggag    141000
     ccaagataca tgataggaat taagatgata gccaagttta ttgttggaaa aggaaagcgt    141060
     gtggatgcta gccttataca agaggggatg agagttgggg ttgatagaaa caaataccaa    141120
     attatcctac ctttgcctcg gaaaatagat gcatctgtga ctctgatgca agttgaggaa    141180
     agacccgacg tcacctataa tgacattggg ggatgtaagg aggagattga gaagataaga    141240
     gaggttgttg aggcacctct tctgaacccc gagaggttta ttgcgctagg gatcgaccct    141300
     cccaaggggg ttcttttata tggcccccct ggaactggaa agactctttt ggcaagagct    141360
     gtagccaaca gaacaaatgc atgtttcata agagtcatag gatcggagct tgtacagaag    141420
     tatgttggag agggggcaag aatggttaga gagatatttg ctatggcgaa gggaaagaag    141480
     gcttgtatta ttttctttga cgaggttgat gcatttggag gaacgaggtt tgatgacgac    141540
     gatgacaatg aggttcaaag aacaatgctt gaactaatca accagttgga cgggtttgac    141600
     ccacgaggaa acataaaggt tctgatggca acaaacaggc cagacaccct cgatccagca    141660
     cttctcaggc ctggaagact ggacaggaaa gtcgagtttg ggctgccaga ccttgaggga    141720
     agaacatcta ttctgaagat ccatgcaaag acgatgagcg tcgacaagga catccgcttt    141780
     gatttgattg caagactctg taacaacgca acaggtgcag agctgaggag tgtctgtaca    141840
     gaggcaggga tgtttgccat aagagaaaga aggaagattg caactgaagc agactttctg    141900
     aaggctgttg ataaagtcat caagggatac gcaaagttct cctctacccc aagatatctg    141960
     acctataact aaagcaataa acatgttatg tcctgtgtac ctttcttgaa ccacataaat    142020
     ctttgaatgg atagtagttt tggatttgga agccctggaa tggatggaaa tgttttgggg    142080
     gttctaggaa taccattaga gcttgttttt gaggaagggt tagatgctga gaagcaagca    142140
     agtgtgattc gtagagtaga agaaaagaca tgcttccgcc tcaaaaggga aatggacata    142200
     gacatcttga tatctgaagt ggcaaatgac gagacttcaa ccatggagac cttaaagagt    142260
     tatctaggaa agggtctttt tggagggaag tttggttttc tggatgcagt tagtgtgatt    142320
     gtatgctctg aaaagattag tgttgacgag atgtccaagc attatgtgcc aattgatgag    142380
     atcatggggg aagaggttga ggaggtgttt agaagaattg cagaccttga gggaaggaaa    142440
     cggatcgaaa gacaggccaa ccgatggagc ttgaagtctt tgaaggacat tttcaagagc    142500
     aatcccgacg aagacaaaag gtttgctgat gggctctttg ttttggaaag atacaaggag    142560
     gcctatagaa tatactcaag atacaatgga gttgacgaat tttcatgtta ttgtatcgaa    142620
     atgtctatct actgcctgat tttgtcaaag aaatcggttc catcaagtat agtaaatagc    142680
     cttgggatgt tcgggagtga gaaggtatgt ctagttagga taacgagtat agccataggc    142740
     ttttcggaca ttcttgcctt agagatgttg gctctacttc aggaaaaatc gctttttaag    142800
     gctcttgccc aggaaagctt ggctcaggtc ttagatggga agaagtacca tagaaagaag    142860
     atagaaatgt ggtttaactc gagtttagaa ttccgagaga tgaaatatat cggccgatcg    142920
     ataagatgct gcgaatgtta tcttgacctt agcaacttca actttattaa tggaatctta    142980
     cctgaacttg agagaaatat attgctctct cccaatagat atattaagga aactcttgag    143040
     ttaatgaagg gaaactgcag tcctggcttg gaggatggag taatagagaa aagtaaggaa    143100
     gaaatagtca tatggagaga atatcaagga tcgatgtgca attttcaagg agttgcgaat    143160
     gttgtggaat cgatttttgt gcaattcaag ggaagaggcc ttgtaagtat cttgcagaag    143220
     ggagaagaga ctccaaaaac ctactggaca aatcaaaagg ttacctttga tgggccagga    143280
     gagtttatta tcgaggatat tacttttaat gcctgggaag ttgagtacaa agtgaagctt    143340
     ggaattccaa ttgatattag agaggataca ccctttatgc atgtggaaat gaaagacgtc    143400
     catgaagttc tgtgcgggga attatacttt ctttcttgca agatagttag aaaccataat    143460
     tcaagagtca agattctctt tgataacaga gagttcacaa ctagtagcaa tatgtttggc    143520
     tttgagatgg tatttcaggc cgtaggcgtc tatagttgta gaataatctt ggaagctgaa    143580
     ggagtcatta catacaaaga tgtaatgttt acagttattc cgtctttttc gatagatact    143640
     tttaactaca agtattgtct tcctctggta tttctgaaga tcgagagcca tattgaagag    143700
     aattcaagag taagatcctg tttggcactt agcaaggatc ttgaggtttc tggtctggac    143760
     actactactg ggtcatttta ttcctacaag gaatatgcca ttgagtattt cagaaaaaac    143820
     attgttggtg taggaagtgg agatcttgga cagactcttg gagttgagaa ggagaagccg    143880
     atactaccag aaaatctcca gaagctgcta catggtatgg acaaatctcc accagtgaca    143940
     tctgatctac ttttcagcga cctgattcct gtaatggaaa agaagatgat tataccagga    144000
     gaaggaacct actccttttg caccttcctc caggggaaaa aacctctaag agaactcctg    144060
     agcccaaggg ctaaagaacc tgacaaagta tcaaagagag aaaccaacga agtaatccta    144120
     tacagtttga agaatgaaag cttagggacg atttttgatg gatccttaga agaacaacca    144180
     ggaaaaatat ctatgagaat agagattgaa ataccaccta aaagagtgtg tgtgtttgtg    144240
     gttaaaggga tattcgaggc cctgttctct ccagagggtt tatctgatga gggaataatc    144300
     aaacctatct gtccatttgt ctacataaca catttctcac cagcacggtt gaaggaacct    144360
     acaataatat acttatgtgt cagcaattac tatgagcaac atgttctgga tgtggagatt    144420
     tcgtctccta ccatagccat atgtagctca gattccaaat tcagagttga aaaactttcg    144480
     ttctcccttt tcgaggtccg atctgcattc aaaaagagaa agaaatatga agaaagcgac    144540
     atcaaaatta gtataaaggt tgaaaacgag gagattgatc atgaatgttt ggtagagctt    144600
     ccacttgttt catgatattt aggaatagct tcttaataaa aacagaagag aaccctggaa    144660
     atggaggaga aacataaatt ctggaataca cagcccgttg gcaaaaatgg attgggaatt    144720
     atatctaacg aaagatctgt atctctggag aagccaaagc ttcctggggg atttcggctt    144780
     gaagaactag aaagtattga ggaattagcc aggtttcttg aggaaaatta tgtagaagat    144840
     gtccattcag gacatatgct taaatactct aaagatttct tggaatgggt aattgggagt    144900
     gatgaggcaa gaaagaaata ttctgttgta ctccgattgt gcggacggat ggtaggattt    144960
     atatttgctc aggaacattg gatagttatc cgggaacaga agaaccgtgt ggttggagtg    145020
     aactttttat gtgtttcgca ggaaatgcgc gggaggggat tagcacccat acttataaag    145080
     gaagttacaa gacaagcaaa tgtggatggg atcttccaag gagtgtttac aaacggaata    145140
     gaactatttt tcaatatttc tcacgggaga tattaccacc ggcctctgaa tggagagaat    145200
     ctgttcatga gtgggtttag cgaccggatt ataaagtccc gaaagactca tgtgagagaa    145260
     ggaacaaggg tagcagagga aaaagacatg gtggacatag aaaagctgta tctgcaagag    145320
     agtgaaaaac acatgttcta tgaagaaata agatcttcga atatatcatc tacatttaaa    145380
     actgtgaaga atgtgataca tacatatgtc catgaaagcg gtggaaagat tgacgggttt    145440
     ggatcgttct ttataattga cactattgaa aaaaagtcca aaagaaaagt ccaaggagga    145500
     tatctgtact acagaggagg aagggatatc aaagaaatgg ttgaggatct tatatatttc    145560
     gcagaaaaag agggatgcga tgtattcact tgcctcgata caatgggaaa ctcctcattc    145620
     ctggcagacc tagggttttt tcctggaagt ggagaaatcc gatattatct gtacaattgg    145680
     agcactcggg aagtaccgaa agataaggtc ttctttattc ttccatgagt actgtgaaag    145740
     agataagtaa agaaaatgac ttcataaaat cttttaagat ggtttagaaa tatttggcgt    145800
     gttttcttga ggcccaatga agctagtgac tcacaatgag aggtttcact acgatgaaat    145860
     tctcgcatcc tgtgtgcttc ttcgtatata tccggatgct gaagtgataa gaacaagaga    145920
     tgactcgatc atttctcagg gagacatcgt ttacgatgtc ggaagggtgt ttgatcctca    145980
     gtcaggaaga tttgaccatc accaaagaac attttccgaa acattttccc caaaatacag    146040
     gactaagctt agcagtagtg gactcatatt caaatatttc cataagaagc tcttggcctt    146100
     gtacggagtg gaggagtcgt gcagaatata cgagcttgtg gtagacaaaa tatattcgga    146160
     attctttctt tacgccgatg ccatagacaa cgggattgat atatacgggg aaataaggcc    146220
     tcgaagtatt gccgacttgg taagtctgtt taattctgac gagccaaacg aggacttgga    146280
     aaatcagagg ttccttgagg cgctaaagat tgtagataaa gatctagaca attacttaaa    146340
     gagaatcaga acatggattg acagctatga atacgtggaa agtaaaataa aagaaaccaa    146400
     cggcccaatt cttgtacttg acaagcacta tagcactgac ctggttttgg aaattgaagg    146460
     tagccatcaa aaagatttca agttcatggt atttcctttg agaaatgctt acagagtaat    146520
     ggcaatacct aaatgcaaag ggtcattcga gacaaaaaac cctctgaaga aggaatggcg    146580
     cgggctagta aacgaggact tagtgcgggt atctggaatt gaaggttgca cttttgtcca    146640
     ttcttcaggg tttatgggga ttaacagttc tcttgaaaat gccttgaaaa tgtgttcgga    146700
     gtctcttcca aacaacagaa atctaaatca ataaaacaac aatttattca atacgaactc    146760
     atggatcttc ctttgaatcg aacgtttcgt agtcgtcgga gtcttctcct tcttttttct    146820
     tggacagctc ttcgtcgtcg ctctcatcac ttataaaaga tggcggaatg tcgatcattt    146880
     gtaccgacgg cgcatgagat attcctcgaa gattctcata caccgatgct ataatgctat    146940
     ccagactttc tctggtgttc tgattagcta tatttgatgt agggacatct atcttatatg    147000
     ttggagcata atagtcaaag tactcattgt agggtatctc ttttggaata tccacatcca    147060
     gaacaacact tgtcccataa gcccatgctt ttgagacatt cccgatagtg tatcctccac    147120
     cgccgaggag aataagaggg atattaaagc tctgcacaaa cttgatacat ctagaatgtc    147180
     ccaggtgcga aagattgaag catcctaatt tatctccaga aagtgagtct gctcccgact    147240
     ggagtacaat tgcattcggc ctataaactt ctataacctt actaacaacc ggcttgaaaa    147300
     tgctaaagta actttcgtcg tcaattccat cttttagagg aacattgaca gaataacctc    147360
     ttccctttgc taacccaatg tccgagacca ttccggttcc tgggaagtag tctccatact    147420
     tgtgaaagga aacagtcatc actctgtctg tggtatagaa tgcctcctca accccgtctc    147480
     catgatgcac gtctatatct atgtatagaa ccctcttgtt atacttcaga agctcaagaa    147540
     ttcctagaac tatgtcattt acataacaaa accccgaagc ttcgcttctc ttggcatggt    147600
     gcaatccccc agcccagttg attgcaacgt cgtatttccc agagctaatc ttctgagccg    147660
     cataaatgct tcctcctgca gtaagtttgc agtaatcata aagccctgga aacacagggc    147720
     agtcatctct aatgttgaac ttgtgaaggt ctttaatcat ttcctccatg ttttcactgg    147780
     aaacacttga aaggaagttt atataatcca ctgaatggaa gtttgttagg ttttcatatg    147840
     atgcctgaaa tggcctgagg atatccatgt acttgtaaag ttcatatcca acaagaagag    147900
     tatgtgtcat ctttactctc agaggtttca taggatgtcc cattgcatag ctgaagttcc    147960
     ctatttcggg atcgtaaaag tataccactc tcttactact catccggggt taaaaatttc    148020
     ggtatcaaat atcataggtg tactttcagg ccttcggatc ttataggata tggtttcctc    148080
     cattatctat agctaaactt caggagccca caaattcctc ccatctcctt cagcttctcc    148140
     ccagagaaat gtgcaacagg gacaatagat atcttgcagt tcatcccttg gatctctcgg    148200
     cagaacaatt ccatctctct tcttttctca acatcattag gcctcatttt ttcatcggtg    148260
     atcatgagcc ggtctagggc tccgtagtcc attgcttccc taatactttc cattccgatg    148320
     cagaccaggt cagacccttt tgcgaacttg acaaaaaagt tgtccacctc ccttagatcg    148380
     tcaatatact gaactccctg aaaagtcttg gagagatctt tgtctgtgag tattgtattg    148440
     atgacctttg aattagagca tcctctgcat tcaggaggga ccttaaccac acagaagctg    148500
     ctctgtatct tctttaactc cttcgagttc accacagcct tgtaaaactc gtttcttatc    148560
     tcgaatgcac ttgcaaccac aaatagactt atcttatcag catacttctc caatgtctta    148620
     atgacattgg taaatttctt gtttttcatc tcctgcttta atactatact aattttacta    148680
     cgggttacta tagacacaac acattctttt tcgtaaaaca ctacaaaagc tgtttcaagc    148740
     tggggctttg cagcctcttt gagtaatctt atagacatct cctgccattc gtctttttcc    148800
     aatgaaaaag gctgcccaag agttatatct atcgtatggt acgacccaag cttgacatat    148860
     tcattaatta gaacggtctt tcccttaaga tatatggtag agctttccaa gtccacattt    148920
     atggcttcca cttttatttt tagtgtgagt gttactctat gctgcgtctt tccatcaatt    148980
     tggattttac gtgttgtcac cgacgtcacc atatcaccca cttctatgac agaacttaga    149040
     gtgtatatgt cttcttgatg ctctggagtc atttttatgc ttcctgatct gcatttttgg    149100
     tctattttat tcttctcgag cttcatttcc agggccgttt gcctcgcatt tgataaggaa    149160
     ttcggcctgt tttaaaacac ccgtcatttg aattctgcta caaaggaata agttagatta    149220
     ttgatttccc agacatgaac aaagaactcg aagacgtagt ttcctctata aagtccaaac    149280
     tccaagcact aacgagcaac aaaaagggag actcggggac agtgcttata ataggaggaa    149340
     gcagactcta cacaggggca ccttactttg tctctttagc agcgttctat actggatgtg    149400
     agctagtata tgtattctcc gaggaagagt ccatcattcc tttgaaaata ttgctccccg    149460
     aatctatagt ttgtggcatt gagtatcagg agtggctcct tgaaaaggtt tctgcgtgtg    149520
     taattggccc tggacttggg aggccatcgg aggaaacaca agaagaaata agaaagatac    149580
     tactacacct aagccgaaga aatgttcctg tggttgtaga tggagatgga ataaggttgg    149640
     cggagaaact tggaatcgaa aattttggaa ctgtcatcat tacacccaac atcaacgagc    149700
     gaaaacatgt cgaaaagatt gaaaaaagat ttttctatgt tctgaaaggc tctaccgatg    149760
     tgatcttgtg gtcaggtagg gaaataaaaa tcgaagacga aggatgtcca aagagaatag    149820
     gaggacaggg agacatccta gcaggcacta tagcatcact tgtttcaaag tgtaaggcac    149880
     ctgctatgga gatagatgta cttggatcta tattacttgg atgtatgatg gttagaaaag    149940
     caggaagact tgcatatcaa aagtacaaga gaggtttaat aaccagagat atactggaag    150000
     agctcaaaac catctttaaa attgagtttg agtaattatc tatgggcctt tcttcaaacg    150060
     aagggcttct cccttagtaa gctatttgtt gttcgaataa tagtactaga ttagatatta    150120
     tatgatcaaa atatattaca attataaggt atgaaaatat tttagatcta aatttttcca    150180
     tatagcgatt tcaaaataga ttattttcta agtgcaataa attgaaaata tcatggccac    150240
     aagttataca gggatgatat attgaacaga attgtcctta atttccaggg tataatagtc    150300
     atcttattta ttctggtcat taatatagta ttacttttaa atatatcaac agtgtttgac    150360
     atatattgaa aaggtgcatt aattcaacat aaaacgttaa aagaggattc aaacaactta    150420
     aaaatgaaag gaagatacaa gttgagcaaa aagtcaagat tatcgagggc tcaaagagat    150480
     tttcttaatg cttacttcga aatgaatcca aatccaaatg ctcaggagag ggaatccatt    150540
     gcatcccaat cgctgatatc caaagaaaag gttagaaact ggtttcaaaa cagaagatcc    150600
     aaagaaagag gagacgataa ggtatcttct tgtctgagca tttccgatgc aaattttacc    150660
     gaaaccggag ttcatccgat gtcaaatgac ctttatattc ggaggtagct tgatagatca    150720
     tgtctgtatg aggttgtgtt tcaataaata ttggtttatt tgttttctgg agaaggcttt    150780
     cgtcttaaat accggtgaga aatttcgcaa gcagccaagt aagtaatagt gggctgttct    150840
     tatttgggct ttccggcggg agtaagcgaa acatgtgtcc gagagtctat tctttttatc    150900
     aaggattcgg ccaggtctcc gatcctaacg tttctcataa gtgcagactt cacttcgttt    150960
     tcacacagaa ttttgttctc aacaagatac attactccat cctccaatcc ttcaaaagaa    151020
     tccactcttt ccaaggaata ctttatctcc ttaggaatgt tgtatttgat cgacatcagg    151080
     aaatatgcct ccatcacatt ttgatcatac atagatgcct tcttgaggct aataagaccg    151140
     ttcttgatgt cctggagctg gattctgcac atggctaggt tcctcagaaa tactgcattt    151200
     ctttgatcat cggccaccag tctttcatat actacttctg cttccgaaaa ccttttggca    151260
     gatgtaagag cagatgcata taaaaactgt atttcagtat tccatgggac tatttcaagc    151320
     gcctttttaa aagaaattat tgctttttcg gtgtctccgg ctttaagaaa gtaaactcct    151380
     tttgctctta atggttcgta cgagtggtat atgctgagag ccctatcaaa ataattctcc    151440
     tctccggtta tgatcccaag aattatgttc atattgcaca gtctcacctt tgactcgtgg    151500
     cttgtgggat caccgatact tcttacttcc tcgagagccc tttctacagc ctcatcattt    151560
     ctattaagtt ttactagaca attgatgatc tttgtattac acctatattt ctgaaagtat    151620
     acaagagctt ttgaatatgc agagcagttg taataggcat cacctagaag cttttcccac    151680
     tcactatgaa acacaaatgg gatttcaaat attgagtctg ttattctttc atgggtaaac    151740
     tccaagtcgt atggttctag attgagcatc atgaggtaat agtgtgctgt catcttcact    151800
     acttcgcttt tttcattcca tggaaacagc actctgtcta tgtacgcttg gactttcaac    151860
     cttctgagat ccgggcaaat ttccgtatta aagaccctta tcatttccac caaaagtata    151920
     gactgttctc ccacgcttag gctcggaaca atttcgtttt caaacttgta tttttcggtg    151980
     ctatagacat gtttcttttc gttgcttgtg ccattacatc tcacaatcag tatggaattt    152040
     ccataagccc cttcatttgt agggacacat ccaaccagtt cgtaccggaa accatacata    152100
     gaaagatcaa ttttctcgta ttctttaaac gacagcatca tgcatgctct ttccaaaccg    152160
     ctcaattccc taggtataca aaacggctgg ggatccttga gacataagtt catcatatag    152220
     ttcaagcggc tcttctcaat ttcattggct ggtttagcat tctgcaggag atctagaagt    152280
     acaattccac tcttgaaagc tccggaattc tctagactcg gcatttccga acagtaggcc    152340
     gaaaatacat ttgatgcaat aaacgtcctt aaatcttcca ttagatatcg gggatgaaaa    152400
     gacgtacaaa atagacataa agagtccaaa gcccatattt aattctaggt cttactggaa    152460
     agagacgtcg ggctcgtcaa ggagagagag aagttgtttg attgacatgg gctcttcgta    152520
     acatatgtcg gagaagcaag gattctgatt gcataagatc tcataatcgg gaaacccaat    152580
     tttttcaact tcatatgaag actggaaaca ttcatagata ccacattcct tcatgacctc    152640
     aatcgagctt gtagtaccaa acacaaacat cttctttttg ctctcttcct tgatgaatat    152700
     cttcagtgct tgcaatacgg cgttactaaa cctaggtcct atgtttacaa agtcaataag    152760
     tccttcaata tcgtccagga ttactatggc ctcttcagac ttatatgcat ccataaactt    152820
     cccttttata tagttcacct tctcgtactc gcttagtcct atgatgtctc ttggcgaaat    152880
     aatctttata aacggaaaca tcgaagatct tgctgctttc acagctagcg ttgttttacc    152940
     tgttcctgga aatccatgga acagcagaga agatgtggag taaagatttg tctttcttag    153000
     cttttgaagg agattcttgc catgttcgat tccctgggtg aatataggag tctcgtaaaa    153060
     ggtcttttcg aatctgtaga aatcctgctc gtttatcccg aaggaaggct taacctcatc    153120
     gagtgcttga ataaagtcat tcatatagac cttgatattc ttgtctccga caacactcat    153180
     tctttcttta tcgtccttct ctccatggac ctttctctcc aaagcaaagg agacagcact    153240
     ctttacaact gctgttatct ccgctcctgt atagtttttc gaaagtttgg ctattttgtt    153300
     taagtcaacg cttttgtcca ggtagtcgtg gctttccatc gtttttgtat gtatcctaaa    153360
     gatttcaatt ctggattctt cgtcaggaag ggaaatctcc agatgaatct caaatctccc    153420
     tggcctgagt agagcctcgt caatcaggtc cagcctatta gtcatcccga taaccaggat    153480
     gttttctatc gactccactc catccatctt actaagaagt tgattgacta cttggtctcc    153540
     aactcctgct ccactgctgt ttcctcttct tctacagatc gcgtcaatct catcgaatat    153600
     tatgatatga agattgctgt cctccttctt tactttccat tcctcttcag catccttaaa    153660
     caagttccta atgttttctt cgctctgccc aacatatttg ttgagaattt ccgggccatt    153720
     tactatcttt ggtggcctgg cattgagaag agatccaagt ttccttgcaa ttaatgtctt    153780
     tcctgtccct ggaggcccgt acaggattat tccctttaca tgaggtattc caaacttttt    153840
     gatcacatct gagtcaaatg ccctttgtac aaatgctctc ctgaacatct ttccaaactc    153900
     ctgctttagt cctccaatcc caagagattc aaagttgaag tttggatcca acagcatgtt    153960
     ttctctagag ttgtttgaca aaaccagcct ctccgagaca gagttgataa aaacttccgt    154020
     gttcttcaga agaattccat acctcttatc cagagcagtg aacatctccc gaacaaacac    154080
     cttaaatcct aggtctccaa tgtacaagta aaacttttga tcgatgttaa atggaaagga    154140
     tacataaatg ttcttgaact tctcaacaag ctcttttgca tcgagatcaa ccttttccag    154200
     attgatgatc tctatgtcga gctttaagag agagattgga tcgcattcaa caacattcag    154260
     gtgtttgaca cttatctcat ctttcccaac acttttgttt agaaattccc tttgaatctt    154320
     gctcagctgg gcattgcatc catcggtaaa gtcaaactta aaggcatact tactgtccac    154380
     caatataaac tctgaaggat ctagcccaga tgtccttggg atgtatatct tatttatttt    154440
     tcccctttcc acctgttcaa tcttgatgct ccctacaaca tatttcatac aatagggtct    154500
     gcctctctct gtttacaaaa cagcttacaa cattggctta tttctcggaa gttaaagata    154560
     cagaaaaatc aggaaggccg ggcccccgat tagagttaat agaaacagga tatccattcc    154620
     gtccttgcca tcgcatattc cctctaatgc acatacacac cattttggag gcatctcaga    154680
     ccggttctgc ggccctgcct ctgtaatttc ccgaatagat tcaactacgg agtccttgtc    154740
     agcactcaac caaaacagaa aggctctttc gttaacataa atatccacca tgtcttttcg    154800
     ctccgaaaac tctaacagac ctgtaatgtt ttccaagagc ctgctcatca tctttatgta    154860
     gctaaaaaac atacctttct caacctttct tttcgtcaag tgatcgaagt cgtcatacac    154920
     aaataatatc ttgttaaata agtttgagaa cacagacatc tttgcattaa ctcttgtgtc    154980
     catcatggat ttgacgtaca gccttaaaat ctctgcgata tattcactct ctttcaagat    155040
     agcccctagc tggctttcaa gaccattagc cttggatact acttcaagcc ttgtaactcc    155100
     tccaatgtgc gttgacgtga agctacatcc tttgatagac cctgacttgc agcttctatc    155160
     aagcatttgt ccattgagaa ggaacggaac acttgataga gtcactacta taaggcccac    155220
     agacacaata ggctttagaa tggaagtgat ggcttcaagc cttgccaggg ctgcaagaaa    155280
     taaaaccagg cagagaacca tctggactcc aagaaaaaac attattttgt tttcgtatcg    155340
     gattactgga cgtatgtctc cgccaccagt gttttcgctg tcttgataat tccttgctag    155400
     cgtcgaaagg tagtttagaa tctcctggct ggccctagca tttggaagat tagaaaaata    155460
     tttcttgatt tccatcctta gctcgtttaa agatatattc aaataccttg tagaagcatt    155520
     gaattcaacc atttcatctt caattttctc tgcttccttc ataaataact taaacacgtt    155580
     agtaaactcc tctaggattc tctctacttg tatttcaatg ttccttagat tcaagacatg    155640
     cctcttcaaa ttttcatcat tttctgcctt gaactggaaa attttcataa gattcccaag    155700
     aaagactttt ctcttttcgc catttccggc atttctatta attgttgact gtccttgagc    155760
     cttgaacacc atggaaacct ggtggcctcc cccggaaaca ccttccgagt aagtcctttc    155820
     ttttaccgaa gatttttttt ctacaggaat gctaggactt ttcctctcca gagtcgcaag    155880
     agtggttttt tttctgatat ctcgtccctt agtgctagga ttttcctctt tctgtctttc    155940
     ttcttctgtc ccaagatttt tatacaaagc cagatgagat gctgtagatt ccttttcaga    156000
     gtgtcccgta aggcttatgt gagagagaag attagaaaga tggctccttt caaaggaatc    156060
     cctgaactta actcgccaag gatttcccca tgcactccag aaccatgtac tggaatttga    156120
     gttgggcagg gatttaccaa gcattctatt agcctctatg accttttgca gattgtacga    156180
     gcagaatata aggagaaacc caatggtgta taaaagaaca ttacctccat ctctagagct    156240
     cctgaagaat atcaaagcaa ggccaaagca cgttatcaac agtaggagaa acaggtatat    156300
     atcaaacctt aaatttgttt ttgtctcttg aatgaacaac cggaatgggg attgctgagg    156360
     cggccttagc aagggttctt taagtataag aagccttagc ctagatgcta gaaacatttc    156420
     tcccatcaga acacatagtt ttatccttct cctgaagcac ctgtttcatg aatccggttg    156480
     tatcatatcc catctaagtc tttccaattt ttaagaataa aagaaaggaa aacaagaggg    156540
     gtatggactc cgaatgtaaa tacctattca agataatctt gattgggaat agtggagttg    156600
     gaaaaacctg cctcatgaag agatacacgg acgagacata tagctttact caatccagca    156660
     caataggtgt tgatttcaaa ataaagtctc ttgaggttga gggggagaga gtgaagcttc    156720
     agatatggga tacggcagga caggaaagat tcagagcaat tatatccaat tattatcgag    156780
     gagcacatgg gattataata gtgtttgata tgggaagtaa ggagtcgttt aataatctcg    156840
     gagattggct aagtgaggtt agaaagaata caaatgaaaa tgttgagata attattctgg    156900
     gaaataaggt cgatgataag gaaaaaattg tgattactga agaagaaata gaaaggtttc    156960
     tgggggaaaa caacattgaa aagtcgtcgt tttatatgac aagtgcaaag gataacattt    157020
     gtgtcaacga tagctttgaa tatctaacga gaaaacttat tgataaatac aagaaaatag    157080
     gttttggcac tggaaaggag tctttcaagc ttaatgtagg agatccaaaa aaaacttgtt    157140
     gcctgtgatt taattgatta aagctctttt caattcacat tcctcgaagt ttttattctt    157200
     cttagataat tgatgatctc ctcaggttct gacgttctat taaggagttg atatacaaca    157260
     ctttcctcaa tgtagaatcc tgtatcggac tttgggattc ctagagtttc agccagacac    157320
     cttgtatcta tgataggctt gacgagatag cactctccaa tttcttgttg tataatgctg    157380
     tacacaactc ttagtccatc ctcatacttt tcatgattgt cttcaatgta ttcaattgca    157440
     gaatatatca ctaacgattc ataccatgtc tcccccataa atctcactat cctaattaag    157500
     tcttcatctc ctatcttctt catatcatat ccagacagaa aaacaagact ctcctcgatc    157560
     ttgtttatcg ttttgacaaa tctcctagaa gatggaagtg aaatcttcat gatataagca    157620
     tttgagaaca gcagactttt cccatttgga acagtcgatc tgctaaagaa gcataacaca    157680
     gtgtatagat ttaaaatctc ccttctgtat gtccttcccc acaaatttgt gatcttttct    157740
     acagtctcgc aaaacattag acctttttcg taaggtgtct ccctttccac aggtggctta    157800
     aacacaggac ttacatatcc tcttctaact atctccagga gcccgtactg ccctcttgga    157860
     tagtggagaa ttttaaatat ctctatgtga attctttcgt tggaaacctt ctttccaagc    157920
     gctcttttga ttctctcgtc catcaacgcc tcttcgatct tcccgtcgat tttgaatcca    157980
     agcttagaat gaaatctgaa gattctcaca agccttagag ggtcatcaaa gagggttgtc    158040
     cttggatcta gaggtgttat tagaagcttg ttctttatgt catcaatacc cctcccggtg    158100
     tagtcttcaa cttccttggt aaacagattg tagaatagcg agtttatggt taggtctcta    158160
     cggaaagcat cttcctgagg agttcccgga ttcacattgg gaatcctcgt ttcagaatat    158220
     gtttcgttcc ttagatttac aaagtcaaca cagaatccat ttatccttac aactgctgtt    158280
     tcaagatgct tggacttttc agggttgtcc tttatcacat ggacttctgt gagtttctgg    158340
     cctgtcgagg atttcattag tcctgctgca aacttgtatc cgctaatatt ttccaacgct    158400
     atatccatgt cgaagctggg atggcccatt atcttatctc taacccatcc tcctgcaact    158460
     cttggagtta catttccaaa ctctttggca tgacttctta ttaggttgaa gatatcctcc    158520
     tcggcttctg tgcaatttat ctggacgccc atgagggacc aaacaaaaca ccttaaatac    158580
     agatcgacct cgcttcgaga gaaacaaaga tcaaaaagtc atgagagcca accactacaa    158640
     tccaagcccc aatcttcctt cttgggactc ttcaaactta ataaagaaga gaattagaaa    158700
     gtagatactt aggtggaata gcgtatcttc ggccctccaa atccgctcga gtcccgtaaa    158760
     gctccttaag atgataaaat agatatagtt tgatatcttg gttgtattat atgcaactat    158820
     cccaaacctc tgtatatagt atgcgctcaa gaccctgagt agaagagagg tgatcaaaag    158880
     aagaattgat ttggaggtgt ttttttctat aaacacatgg atatcattgt atctcaatcc    158940
     agagtcgacc aatataataa acgaatatat ccagatgtaa aatgagcttg ccaggagaaa    159000
     ctttggtagt ccgcttcgat ttgtcataca aaccgtcatg aagtctgaag aaacactaaa    159060
     gattacataa agtgacaggt aaatgattcc aaagagaacg tcgaagaatc cgtcattgct    159120
     atattgaaca gatttataca cattcattag aactaccaga acaaaactga aattccttaa    159180
     gatattctcc ttagctgttc ttgacagcat gaacataagc agcacagata atggatagca    159240
     taggcccctt gcagccattg ctgttttcaa agacgtcatt cctgcgcctc gataccaaga    159300
     agaatactct ccaaatgcaa atagtccgag cggaagatat tctggttgta tttggacggc    159360
     ttctttgaaa gtggtgtttt taattgcaaa cggaacggac atcattaaaa caatgagaga    159420
     cgacagaaaa ttttctatgg taagtatcac cataaaatgg gcctccagat ggtctgagga    159480
     taaatatagc tggagagccc ccaagagaga cagaatctct ccgatgtaga gtttcttttt    159540
     catttggcaa aggggtgaag tttgaattta tggatgaaga aaaggggtgt tctcccggat    159600
     agaggaaaaa cttgtagaga gataagatat tgttcctagg cagagaagtg tctaggcatc    159660
     acaatacata gatgttaata acatcctcga aaaaaagatt ttcaggtgac accgcggaat    159720
     acctaaaaag gagattttat tgtgtatacg ccacaataga aaataaattg gatcaattct    159780
     atattaatct gataaaaaag ggtatattta aaataaatag ggtataagtt tcatggattg    159840
     ttttaaggaa aatctttaga acggatctaa ctatgttatt tgtcgaccca attttatcaa    159900
     tcaaattcga aacaacaaac ctcccttcga tttggttata aaagactcaa aaatttaccc    159960
     caaaatggct agaacaaaac aatccgctag gaaaacaaca ggaggaaaag ccccacgcaa    160020
     gcagctgtct gccaagtccg cccgtaaggc tgtggccccc gcctcaggtg gtggggccaa    160080
     gaagtccagg tacagacctg gatctgtggc cttgaaggaa atcaggagat accagaagag    160140
     tacagacttc ttgatccgaa gacttccttt ccagagggct tgccgttctg tggttaagga    160200
     gtgtagtaat actacagaca taagattcca gggcccggct cttggctcaa ttcaagaggc    160260
     cttggaggcc tatcttgtta gtttgtttga agatgctatg ctctgtgcat gccatgcaaa    160320
     gagagtcact gtatttccaa aagacataag ccttgttctg aaactcagaa gcagacacgt    160380
     caaatccatc agtgattaaa atcttcactt tagttctcag gtttctagag gataccttct    160440
     gtctataccg agtttattag aatatctcat tgttccctac ccttagctcc tgattttttc    160500
     catgtacatt aaggttagtg gtatcaacaa gatgatcaat agatatgact tgaataaggt    160560
     atttacattt accaggccta tatacaaaac aatagagcat tctccagatg ttcggttcta    160620
     cttctatagt actctgcatg agattgcaat ggcagagaaa ctcaataaaa gaagtttaat    160680
     tgagtgcttg gaggtgagct ttatcaaaaa cccactaaag gagaagtcct gtttatcaat    160740
     ttcctcctcc agatcttcct gttgcttata cactgtatgc gacagagatg tttctataga    160800
     tatgattgaa aggcttttcg gactacctgc ccgatgctac tttagatggg gagagttcaa    160860
     ggagatatac ataattgagt ttaaagaagc tgtggagata aagaaggcag actttacaaa    160920
     atatgtattt gctttcgagg actatataga ctatgtaata gagaacggcc ttttcgacca    160980
     ggagtgagga aataggaatt tctcaaaagg gggaggaata tctccctgac aaaagtaaga    161040
     atggagaacc aatgccatat ctttcctttt tttattcctg aggtttccaa agtgaaggta    161100
     gagtattttg acctgaatga agatacaggt actataagag ggattttttg tgttaagaaa    161160
     aagttagaaa tggacattga cgtgtttatt tgcaacaaaa tagttacgga tcctttcttt    161220
     ttttgggaac cagcctgctc ggggtccgta tttgaaaaag gtctagagct tgtgaggaga    161280
     ggcctaggat ttcccaaaga ggatagaaaa gggcccaccc tcgagaaaat gatcacaaag    161340
     gtgaaaaagt aaacacccaa tccgtagagc attcttgttt tttatcttca atttacaaga    161400
     aatatgttgc agcaaaattt ttaccccatc gagtaatgca ttttacatct gccatgaagc    161460
     gtgtcaggct tccatcgtct gccgttgccg tccggaagga acctagatcc aaaaacatct    161520
     acctccgtgc tctttcagac ttctatacca aggtggccga taatacatct gtcctggcaa    161580
     tcaagaagat ctctaagaga ttgaagatgt cgaagtcaga cagacggccg gtcaaaattt    161640
     cgaaaatcgt tagcgagata ggagaatcca aagataaggt tgctgtcatt gttgcaaaag    161700
     tccttgatga tgataggatt atggagattc ctccccttaa gattattgct ctccaatggt    161760
     caaaaggagt gaaggagaag attgaaagat atggaggaag cataggaact cttgaccagc    161820
     tttttgaagt ttgtccaaac atggatgata tacatcttat ttcctcctcc aagtttgcta    161880
     gaaggtctgc taagttctgg ggtcctgctc cgggagaaaa gggatctact acttatccaa    161940
     gggcaaacca gaagtgccat aaccgtgaga agcgtgtcat gatgaaggga agaaaggcgc    162000
     cgcaatccaa aaggacaagt gaagaataaa atggtctaag ttttactaat atatctctgt    162060
     tgggaagatc tatttgtctg gagctggcaa tctcaaaaaa tcttctatct ctataaagca    162120
     tgaacaaaat tcgcattcca ccctggaatt ctcttcattg agtactttgt attttcctcc    162180
     acacctgcac acaatagacc cgatgtcgtc tctgttacaa acaaaataag gaacctcctc    162240
     atattcttct cctctttcat atttctcgta agattctctt aactttatat actcgtttat    162300
     atctcccttg cttctgtctg gatgtatcag gagtaatctc ttcaaatact tcattcggac    162360
     ttcttctttt gaagctcctt tcttaacacc cagcaaactg aaaatagaca ttaagggata    162420
     cagagtttgt taaataacgt aaagacccgg gggttggtaa attcaagaga cacagcaaag    162480
     acctaggaaa ttctaaaacg gctacaccag tgttttatag atggccaatg gtcgaagccg    162540
     aaaatgaaac attgttttag aaacttctta aaaacagatg gtaaggttac atcatgctta    162600
     ttctctcact gttaatgagc gttggtgcat actatctacc gcctacaagg catgcattca    162660
     taatctctgc tagaacactg ccaccatatc gcctagattc attcccattt acacaggtgg    162720
     ggccctacaa gacatctgga gatcccatca tatttgcaag accatctaga gttgataaag    162780
     agacatctac ggaagggaac gagaaaagtg tgtctggaga gaagaaggaa gagtctaaga    162840
     aaggcctttc taatattata tttggaagca ctgtgtgcag attcttcttc tacacggcga    162900
     tggcagttat aatattcttc atagggtatc aaacgagaaa aagccacgag ggagggtcct    162960
     acgtaagact tcctacaaca tcaaataact aataaaaagc ctaagaaatc gtttttgtat    163020
     tgtgtaaata cgatgtggga tttagtagaa gaaacaagag acacttttac aaagcttaat    163080
     ttggttccat cctttaatgt aagactctac tacatccttt tagttgatgt tgttttttct    163140
     gttcaactct tctgtctctt cctttgtcaa gaacctacct gagggagctc tcagcctttt    163200
     catagcatgt ttatgtctac tttcatgcaa atagtttctc ttgtttgtta tcataagtgt    163260
     atctaggatg tctcttcttg actttctttt cttaatccag ttgagctgct tggcattgac    163320
     ataaagaggc tgaaaaggtt gatcgctgaa cggaaaagaa tagtcataag caccgtagtt    163380
     gcttttatct ggatatccta catctcttag ttgctcgtct tcaaagctga tgtcaccgta    163440
     tcgggtgttt gggccctggt ccataatgtc tctgtgctgc atacaacatc tattccgtca    163500
     aaacttttgt aaatcttcct cctgacttgt ttcaggatgt ttgtttcttc caccaattgc    163560
     atggtgagtt gggatcgttc gagatggcat ctctactcat caacaatata tgcaaagctc    163620
     aaaataactt tgggatttct agtccagtaa ggtttgtaat aaggttcgtc ttatctaatc    163680
     tttatttcat catccctctc cccatccaac tcccaaaagt ttatgttaga atcagaagat    163740
     ccagatacaa agtacttttc atcgtcggaa caggaaaagt ggatcactct gttcttatgc    163800
     cccaagaagt atctttctac cttgaaagag gacatctgtg acagtctgat gtcatctttt    163860
     gagtatccgt gtgtactcag gatcttgttg gacttcaacc atcttagatt acaaatttga    163920
     gagccatagt ctacagatct tatcaaacac gagcttgatc tactcgagtt tacgagattc    163980
     atgtcccata gcttgattgt tttgtctgca gttcctccac cagacaccaa caggtttggg    164040
     gaaagagggg accaacttat ggccttcact gcggccttgt ggctggaaca ttgtttaaga    164100
     ggatgggata agttcctgta atcataaata taaagtctat tgtcgttccc gccggatgca    164160
     agaaacctaa ggtccttgct tatgcttaat ccacagacct cctgacgatg gtgtagaatg    164220
     gttgccacag ccttctccga gcgaagatct gttatcttta tttttctatc tctgcttcca    164280
     gttataatgt ttgcattttc cgactcgatt acacctattc ttgatctgtg gaatgaatac    164340
     ctggttatct ttagagaggc tatatcaaca ttcaacatga caccgataga agtcccaagg    164400
     gcaacagtgc tagtggttgg gttatatttc acagatgtta ttccaagact gctaagatta    164460
     caaatctgca atgtcttcga ggaaaagaag ttgtgaacaa acaaacagtt gtctgcagtg    164520
     aaaaatacat tttctcctga ccagtcaatt agactgctat agaagtcgtc gggaagggat    164580
     ttaaccttca attgtctata tggctgaatg attattcttg gcccaaggtt ttggcttcca    164640
     acagtactta aatacggaat ttcgcccatg gaacaggcaa accttgcctc atacatttcc    164700
     tctttagttc caagatcata gaagtttctt tgtgcatatc tggaagtagt ttcctttttg    164760
     tttattagga atctgtccat ctatgtttgt ttatgaagac ttcctctctc agataatttt    164820
     tggtgtgtta tttgatcaaa tagaaatcaa gatgctttag cataatgaaa gagataattt    164880
     atcaagtcca gtagtttcaa acacagaatc taatagaagc tccagactat cctagaactt    164940
     ggaatctttc cagcagatcc ttagtatcca tcgtttctat atccgcgttt tgctgggaga    165000
     ctaggctgtt tgcaacaaac attttaaacg actggaggtt cataaccttt tcctctaagg    165060
     tgtttttagc tatgagtcta aaaacattca cagttctttt ctgacctatt ctgtgagctc    165120
     tatccatggc ttggagatca ttaaaggggt tccaatcgtg ctcatacatc acaacagtat    165180
     ctgctccagt aaggttaaga cctaaccctc cgacttgcgt ggtgagaaac aatatctggg    165240
     ttgtacccgt gttgaactcc tcagcaatct tagctctagt cgagctaggt acggatccgt    165300
     ctagtcttga gtacttgaat ttatacttct ccatgatgtc ctttataaca aaatctatgc    165360
     tggatttgaa ctgaaaaaaa ataagtattt tgcttcttaa atcttctcct ccgcaaaggg    165420
     aaattatatc ttcaagtgct ttgaccttac aagacacttc actagaatcc ttgaagtggc    165480
     tcatatggga aaccgcaagc aaaagatctc ttgtcctttt gaacccgacg ttcttctggt    165540
     ctatctttcc atactccagg tctacatctt caagtttctc cttgccccct ctttcattaa    165600
     tctcacgata tagcttttcc tgggcaggcc caaggtcaac aattatgtca cgaattatct    165660
     ttggaggaag gtctttcagt acatcgatct tcaatctgcg gagaataaat ggaagaactt    165720
     ttttgtgaag aaggttaagt ttttcctgag ttttttctat ttcagtatca gacatcttta    165780
     cattcaacga cccatactct ttttcggaac caatgtaatt gggcattagg aagttgaaaa    165840
     gggataccag atcctctaca ctgttatgca ctggagttcc tgtcagaact atctttcgag    165900
     agcactttat catattcatt cttgagtata gaattgtgtg tttgttccta agaacatgcc    165960
     cttcatcaac tacaacgtaa aaccaatcct tctcaataaa gcttaaatag tcattcctaa    166020
     atgtttcata ggaagatatc aagattccat attctcctcg gttttctctc ctgtaaatct    166080
     ctgcagttac gaaggggaaa aacttcttaa cttcggcttt ccaatgccca gtaaggcttg    166140
     aaggacagat tactaagatc ttcttctttg tcttataaat ctcggagcaa aggaaagtca    166200
     acacctgcaa ggtctttccc agacccatgt catccgcaag aattccgttg agactgaatg    166260
     aatggagaaa attcaaccat cttaccccct ctatctggta gtctctaagt ttgactagta    166320
     ttgggcattt tatatgatac tctgggatct tccttacatc aagtagcgag tcaagggatt    166380
     ttttctcatt ttcaatcacc tcaagtagat ccttagatat cttctcgttt gttctaaacc    166440
     caagagttgg aataatcttt gaaaatagtc ttgaggatgt cttccgattt acatcacttg    166500
     agatgttttt aagaagtggc ctgacaaaca aaggattgaa agaatgatcc ccgttcatca    166560
     agacagcatc aagaagctca acatctagat tttcaagtgc cttcctcaca aacttctcat    166620
     tgaactccag agatttcata aatccattga ttactgtgat atttctctcc tgaagtgcat    166680
     catcaaatat aaacgctatc ttttgaatct gcgaggcttt tgtgtatata tgaacagttt    166740
     ttgagaagaa gtccagtctg ttttccaggc ttccaacctg caaaaagaag ggatgatcaa    166800
     gaaatctacc atcaaacccc tcaaagaacc gaagaaaccc gttccttcct gaagacaatc    166860
     tttcatatgc aacctggaga aaattgtcga cagaaatctt ctttgcatca tagtactcca    166920
     ctatcatttt agagaacaga tccaggaact ggatgcaggt ctcaacttca aatagggctg    166980
     gtgcattgca aagactagga aattcaatag atgctatcat cctaacatag tctatatata    167040
     aaggatccac cattggatgg attgaatgga tctcggggtt actaagtttt ttcttaaact    167100
     ctttctgagg tgccattctg agatccttgc atttgccaaa gtaatctcct aactcttcta    167160
     tacttccaga catcggagtc ccacctttat gaagttcctg ggcagaccta tataatgcaa    167220
     gaaaagttct gtctatcata gtctcattgc cagtctgcaa atctggaaat tcattcttca    167280
     taatgcattc aaatagaaga catctgttct ttagtatctc atcctttcct attacattta    167340
     tcccactctt tgtgaaatag aggtcttcgt aggaaacaaa atcgtcttct ctgtaaggct    167400
     catacagact tcccccaatg acgttcatga aatgaataat caagtttctt ggaaggtcct    167460
     tgcgtttctt gagaatctta attgctaact ttcttatctc ttccttttcc tctattagaa    167520
     ccacttctgc cacaaggaag tcgatcgact cttcagagag attttctacc atattcaaaa    167580
     tactggtcct gacctcagga accggagaag taaaacacgg gaatatatct ttcagccttt    167640
     ctggaggaat ggagaactct ggattttccc gatatatctt ggtcaggaga gaaagattgg    167700
     atgtttttga gaccgaaata acctcttccg attcaatgtt ttgccagcac ttgtcaagga    167760
     ctgtatcaat tccgtctatt attgagaagt ggcagagaag ctctgcactg agcagcttta    167820
     tgtcttcgtc cgggctactt agaagggata caagcttctt gcaaagccca ttcttgtctt    167880
     caacaaactc cttcaaatat ccaagtgcta taagtcccga aaactggact tgccagtctt    167940
     cattgtccaa aaatctaagc agttgctcta ttatgtcatt tggccctatt aaaggatata    168000
     tatatgacag aagatatgca gctgcatctc ttaccggtgc tacagttcta tcttccacaa    168060
     agtcattgaa tttatctgtg acaagaattt catatatctt tgaaaagagc ttagagtcaa    168120
     ttcttatttg aatttctcct tctcttttgt ctatttccga aaacattgct gcaaatgcaa    168180
     gaaatgctcc atgtctctta taccactcat aactcagtag attatcactt atttgttcaa    168240
     aaaagtcaaa cacattttca atcggtttct cttccacctt ctgtcttttg atggtttccc    168300
     cgcttcctgc cttgaagtcg atgtcgctca ggaagtttgt ctccacatgc tccagctttg    168360
     ctatcttctt aatcattctc ttctgctcct ggacagatgg tgcttgtaca ttgaattgct    168420
     ctcctgtcga tcccaaatat atgctagtgc ctttcttgta ctcaatcttg aaattagtca    168480
     caagcttaaa ctggaacatc agagacttga gaatccgggc cccatttttt ctatcctcac    168540
     tcccctgccc acacaagagc ctgtatgttt gcttaagaat ataaggagtg aaatcaacat    168600
     actcttttat ttgagaaacc agctcatccg tagtatattc cttcagaact tttgactggg    168660
     ctgtgttcag tgttgtgaag aacttttcca acctattcat acttcctggg gttaatgaaa    168720
     tgctttgtat ttatattttc acgctacagc ataaactaga tagtctgcat tcttcaatgg    168780
     tcatgaaatc catttattcc tttgcttaag acaataatcg tccttgtgac ttattaggta    168840
     gattcctttt caccttggga aaccacacca agatcaatgt acaatatcct gccaaatacc    168900
     tttagaatct tagcccgaag caattggagc attttcatcc gattcaaaaa ataactggta    168960
     atttcaaaac ataaaataaa gtaatttctt ttgttgaaaa tggcaaagaa agaggttgtt    169020
     aaacacgatt ttgatattga atatccattt tgggatgaca tagacaaaga taaaattcaa    169080
     ttcaaaaagt tggagaatgg atactcaata agctatggcg atgagaaaga acatgagaat    169140
     gaaaatagaa gagagtatag gtcacggtct atatccttct cgcaaactta tggaggaaga    169200
     aaggtgaagg atgcaaacat ggagattgag ggaggaaaaa taaaagtaaa gggaaggttt    169260
     tgtgacgaaa aataaaagca tttactggta ttttatctta tatagaatga ttgctgttag    169320
     aaccagagta agtacaataa aacttctcag agtattaatt aatggataga accatacttc    169380
     tgccttatgc cacagctcag ggggcaagga ggaactttcg accttctttt tacaatatgg    169440
     gcagaagggt ttttttccaa ggaggcacca tcccttaatg cagtcttcat ggaaagaatg    169500
     ggtgcatact aatgtatgta tcttttcact gccattaaat gattttgtgc aaatcatgca    169560
     gagagagtta ttatttcctt ttccaggtac cccttctttg ctataaaacc ctgtggaaat    169620
     ggccacagtc tcgcttaaaa agaaaataac ctctctgctt agaagcccga aatacaggaa    169680
     gaacagcaaa atggaaagag aatatccaag gttcttcggg ttcagataga aaaatatgaa    169740
     ggtaagggat tgccccagaa ggattcctaa atttgaaatg atgaacaacg ttttaaacac    169800
     gccgtaaatg tccctcatca catcttttcc aagagatccc ttcaatactc taaccgtgtt    169860
     gaaaagtata aagccggaga atcctagcca gcagagggga agaaagtagg actgaatgta    169920
     aagaaaaaaa ccagggggaa acaacagaag gatgaaaaaa acacagaaat catggctctt    169980
     cttgttgatc cccttccaga cagcaaagaa tgtttggatg acaagtgcat acacggctat    170040
     tactgccatt ttctgtaaaa catctccaag agtgggctgt ctttctatta ttatcacctg    170100
     ccttacaggc ctgtactccc cagcaattct atattggctt gaataggcca cattttcaga    170160
     gtcatcaaaa aaagactcac tttcgtactt ggggactcta ttattcttgg agtctttact    170220
     ttcttttttc tcggctgcat ggcttaactt ctcgttattt tcttcttggc tcatttaggg    170280
     caccaacaaa ttggtttaca tatcatagaa tttaatcgac ccgaaacaac aaaaatcaaa    170340
     gtaggtatgc gcttatatgt ctttaattac tagaatttat ggggaggctt tctttaatct    170400
     tttccgagaa gcttgctgag agaacagcgt attgcttctg ttaccttgtc tatcctctcg    170460
     tttgttacgc ttagattctt tggaaataaa tggctaatat cacgaagata gaccggtttt    170520
     ggggtgctga actttttgag gttgcaaaga cgattcagca aaaagacgag attctcatgt    170580
     ctttcctcca tgttcaggca ttcttgaatg tactggagaa tgttctccag gatattgtca    170640
     taatcgtata tagcctcctt cagctcagat atctcacata tcattatacc ttcctttctt    170700
     tcaagttccc ttagatgagc tattctcttg tccctccatc ttttggctgc aatccgattt    170760
     ctttcttttt tccatatgct ttttatcctt tcctgatcag actgccttat agaagactca    170820
     aagatgtcca ttggatggca gaattggttt tcctgctcgg cgatatacct atatttttcc    170880
     tgatgaattg gaatcctatt ctccaaaaaa cttggcccaa agaagtagta cggatgtatg    170940
     taaggctgat ttccatcaat aatgggcttg gaatcgtata tcccatgtgt actttttgga    171000
     tactcgtttt cataattgat attcttttct ctgctttcca tgaaatggtc aatctctctc    171060
     atctattcca tataagcggg tgatggactg aaatgcttta attttaatta cttcagccaa    171120
     ttaattgctt aatttgtctt ttgccataag gttcaggttg aaagcaaaag gatctcttcc    171180
     tttctgtgat ggaaaagaac ctgaattctg gaatttcaaa gacttgccta ttctgggacc    171240
     aaaataatca atccccctat tcatgataaa ttagtatttc ccacccctag ggagatgtct    171300
     gaaagtatga catggaagga gtttgtggaa aataggagag ttcaagcctc caatctgctt    171360
     ctcacccacg gttttatgat tgagtcgtgt caaaatcatc catttaaaac aaaaattata    171420
     atcttaaaca aacaacataa tggaaacgat caaatgtgtt cttgtgggag atccatcggt    171480
     ggggaaaagc tggttaataa gcacatttat aacaggtagg aatccagaag gttatatccc    171540
     gactcttttc aacaactaca gcaaggttgt tagtactgga gataaaaagt acaacatgac    171600
     gctgtgggat acagctggaa gcgaagaata caacaaactg aggagcttgt cttttcagga    171660
     aacagatgtt tttctggtat gttacgctgt taataacatc ctctcgtttc acaataccag    171720
     gagatggata gaagagcttg ctgagtacga tgtcccgatg atcttgtgtg gtaccaagtg    171780
     tgatataatc gacgggaaca ttgtagaccg aaaccttccg ataaagttaa gcaaggagta    171840
     caaactatat ggattcatgg aatgctcttc catagagcta ataaatgtaa aaagggtctt    171900
     tgatgtagct ctagaggcag cattgaagcc tcgtaaaagc aagtttcgat cgatctggtt    171960
     ctgctgtaag tgtggataga tgtggtaagt gtccaaataa atatttttat agtactctag    172020
     aaaacacaac atatgctttc cgatgtgctg aaatatccct ggaattagcc ctttcaggga    172080
     tgagaagaag acaaagaaga caaagctcaa atatattcca catgctcaca aagaaccaga    172140
     tagttgaact tagagaggct tttaacttca tggatgttaa cagtgacaca tttgttgata    172200
     gagcggatct agagagcttt ctggagtcaa taggagcacc tttttcaagc gaggaaattg    172260
     atgagatgat ggccgaggga ggagacagca tgacatatat gttatttctg acaatgatag    172320
     gagaaaggct tagctgcact gatacagaaa agaacatctt taatgcttta aaggagtttg    172380
     atgacaatgg ggatgggaca atcgatgaaa agctgctaag gacatggctt acagaaaagg    172440
     gagaccaaat ggcaagggaa gatgttgact tgctcctaag gggttgtgca gaaaacggaa    172500
     gggtggattg cagaagcctg gcaacaaaaa taaagtacgg agaaatcatc actgaataaa    172560
     catttttctc ttgtaatttc cgtccataaa gaaagagatt gaaaataaat caatttactt    172620
     tatcaccaag gatttcgagg gaaggtctcc tgaaccttgt ctagctcatt cagtatgacc    172680
     gtctgcttct gtcgttcctg tagtgcgttg tccacgtctc ttaggatctt ctcccccatt    172740
     ccccttaaat cctccaaaaa atcaatcacc tctcctttgt tctgtatgac agcaagcttt    172800
     tcttttttct ccaaaggtag atacgtccta tatatgcggt ctaagagagt acactttccc    172860
     tcttcttttt tgaggcggtt ataaactcca ccaaagatct ttctgtatat ttgcaggcat    172920
     ccatctattt ttgacttaag cttctctgac ctcattctta gtccacctat ttttttccgc    172980
     aggaagtcat acgagtcatt aattcttcta catgcatcca tctggagaga cttcctatgc    173040
     tcgatttcat ctcctttcaa tagtacaggc atcatagttg gatcacttgt cagggaaatg    173100
     ttccatagag tctctggaaa gtccaaagga cgtgcgaacg gcccatcaac cttgttgtag    173160
     aacacatatt tgaacttata gttttgggat gatggatcat agctcttttc gatgttatct    173220
     attaaggtta agagctcctg gtctttctgc atcttatatt ccatgggctc ttctggccgg    173280
     aagggtttaa taaagaaact tgtacaataa attttagttt gtttttttaa cagtgaagat    173340
     gaagttagaa aagtctgcaa tcatgagaaa aaaaagacaa ggatacagtg aattcatcgt    173400
     tgatgacaca aattggaatg gccaaagaac aatgctgata aagttgcatt ccatatatca    173460
     gatgtatcgg agtgcgggag tgattggtga tgtaccgcca gacatgcctt ccaaatcatt    173520
     gttaaaagca tcaagaggaa ccattgcagc tgggtacaag ctccacctcg ttaagatggc    173580
     tcttattgat gaacgtccat tcaagttcaa cttcgaatct agacggtact atttcaagaa    173640
     tgtaaatatc gtatttcttc tcggaatgat caaaaataag cccgagcttg tttactcaat    173700
     gcttagcaat ggtttcccta acaacatcaa ctcctcgatt tttggaagcc cgatgtttcc    173760
     aacctacttc cacctcgcct gtgcaatgca tcataacata ttgtctgttt tcctaaagtt    173820
     ctctccaagc tactctctat gctggaatgg tcttactcca caaatgattg catcgtttag    173880
     tggaaaatct ttggaatcta aacaaccttt taattttgtc tcaatgaagc agtatttact    173940
     gttgaattca tttagaggat tcaagattac cgagacagat gaaaaaccta tcttcctaat    174000
     agattttctg tgcatggaaa acgacatgga ggaagccaga agagtactca acagaaatcc    174060
     agagctgtct agagtcagta agatatgcta tctagctcaa gataacatag aatggattat    174120
     gttcttaagc aggtaccaaa catcggtgca tcaggagttc aatggaatct ctccccttca    174180
     tataagctcg ataaatggaa atttcgaggg gctcgttgca cttgtggcgt taggaagcta    174240
     cataaactct agggatcgtc agggaaatac accaatgcat tactgcgcaa tgatgcagca    174300
     cttccgatgt ctggagttgc tcatcaggct cgggggaaat atgaacatgg taaacaggga    174360
     aggaatcagc acagaggata ttttaattag ccaaggaaaa gtctttgata ttaaagaggt    174420
     agatctagaa ctcccagagg ccttgttcca aactctggga gattcagtcg aattcagaca    174480
     tcatctatca ataattgata ggatcaagta taattgtaac cacaccatcg tcaaaaaaaa    174540
     tagattcaca ataacatcat tgttgaactt gccgcataag attgattaca cagaagattt    174600
     gattcaaaag gttcaaggtg ttaaggacac aaggagagat agctattcgc ctcgccagtc    174660
     attacaaata ttcttgaaga acattcaata agacaatgta ttcgaaaccc tgaatggagg    174720
     gatatgggag ctgcagagtt gttattggaa acgaagcaag aatgattcca gaggaggaaa    174780
     gagtaatccc agaactcacc cacgaatgga aggcctatgt taaggcatcc ccagaaatag    174840
     taaaaagggt tgaattcaaa ttgcatgact catttagcaa taggttggtg aatgcagaat    174900
     atccattcga agttgtagaa agaggatggg gagagtttag cattcaaatt aagatttttt    174960
     tgtttaacgg agaaaaaata atgactagcc attttctaca actccatgga gactccgatg    175020
     tggtaataag cgaaagagtc gatgagattg tattcaaagg cgaaagtagc ccggatactc    175080
     ccttggatga ggaagaggaa gaatatgaga ggatagaaac aagtattttg ggaatgcttg    175140
     aaaagtttaa agaaattaat gaatgaagaa atcgccagaa cagacaaatg gcttaggatg    175200
     cagaaatata tttggcaaga gttgtatttg caatactaat aaatgagaga ttttgtagga    175260
     aatttgtatt attaaactac ttgaaagtta atcccagatc tcagatacct agctaaaatt    175320
     ccccaaataa cacggttcta gaaagcatcc aaatgtcaac aatatttttc taatacttgc    175380
     cgctcagtat agaaaattca attccagaat ggcactgaac tcgtattgaa tcatttaact    175440
     tcataaggaa ttagagttct cagtgtagtc ctatagaaat caacagttac tttccaaaaa    175500
     aaaggatcac aaaggaatta ggcttcctgt catttttcca tcaatgctta gattacgatg    175560
     gtaaatcaga ttctctttaa gacatcatat gagaagttac ttcagccaat cagaaagttt    175620
     tctaaaagta taaaagtaaa gcggcttgag tcttcaatgg gtgaaacttc aaagaaagac    175680
     tgcaaccact ccacaaactc ccagtgcgag gcttgttgcg agaaaaataa agcctgcgag    175740
     gccaaggata aaacaaaagg tagcgttaat gaggctaaag ataaaacaaa agaaactgtt    175800
     caggagacta aagacaagac aaggaatgca gcagaaaacg tcaaggataa ggtagacaat    175860
     aaggacaaga acgaggtata cgataatatt aaggaaaagg gaagcgaagc atgggataaa    175920
     acaaaagaag tcgcaaagaa tatgaaggag ggatttaaag atcttgccaa caacgataag    175980
     cagaagaaat gaattaaaca tcttagctta tttttattct taaacactat tatcctttct    176040
     ttatctttcc ggaaaaagct tcggcctgct tactcttaac tttctaagac ttggaagaga    176100
     agagactgga ataaaaatgc atcagcatac tacatttcag acttcccgaa gcgacccaag    176160
     gttgcgactg cttgaatgga agtttatatt aagatagggg cctctttatg gccaatttca    176220
     ttatataaaa tacaactgat ttttggctta aaacaacaat gacataggca agggctttca    176280
     tagagtatga gaaaagaagc agagaaagac caaaatggag tgaatggtcc tgagtcctcg    176340
     aaactcaacg aaaagctgat gtcgggggga cgtcttttcc gtgtgtgcct gactggaggc    176400
     ccatgcgggg gaaaaacgac actccagatc tcggtagcag acatgtttga aaacatggga    176460
     tggcatgtgt ttcgatctcc agaagcagcc actattctcc taggaggagg aattaacctg    176520
     ataaagagaa ctcctctcca acagaagata ttccaaacag gtgttctaaa ggtaacactt    176580
     caaatcgaag acgcttacaa taacttggct agagacattg cagaaaatgg aggagatgca    176640
     gttgtgattt atgatagagg aacaatggat ggatctgcat atgtaactaa aaatgattgg    176700
     gaagaaatct gccaagaagt aggaatgtcg gaagttggac tccgggatgc acggtatgac    176760
     tgtgtgattc atcttgtgag tgcagcagac ggagctgaaa agcactacgg gaatg         176815
//

If you have problems or comments...

PBIL Back to PBIL home page