(data stored in ACNUC8465 zone)

HOGENOMDNA: ENINT1_4

ID   ENINT1_4; SV 1; linear; genomic DNA; STD; FUN; 193740 BP.
XX
AC   CP001945;
XX
PR   Project:42703;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Encephalitozoon intestinalis ATCC 50506 chromosome IV, complete sequence.
XX
KW   .
XX
OS   Encephalitozoon intestinalis ATCC 50506
OC   Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-193740
RA   Corradi N., Pombert J.F., Farinelli L., Didier E.S., Keeling P.J.;
RT   "The complete sequence of the smallest known nuclear genome from the
RT   microsporidian Encephalitozoon intestinalis";
RL   Nat Commun 1(6):10-10(2010).
XX
RN   [2]
RP   1-193740
RA   Corradi N., Pombert J.-F., Farinelli L., Didier E., Keeling P.J.;
RT   ;
RL   Submitted (22-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Botany, University of British Columbia, 3529-6270 University Boulevard,
RL   Vancouver, British Columbia V6T 1Z4, Canada
XX
DR   StrainInfo; 819376; 0.
XX
CC   Linear chromosome is missing portions of the telomeric regions.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..193740
FT                   /organism="Encephalitozoon intestinalis ATCC 50506"
FT                   /chromosome="IV"
FT                   /host="Homo sapiens"
FT                   /strain="ATCC 50506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="nasal tissue"
FT                   /db_xref="taxon:876142"
FT                   /culture_collection="ATCC:50506"
FT   gene            complement(36..2475)
FT                   /locus_tag="Eint_040010"
FT   rRNA            complement(36..2475)
FT                   /locus_tag="Eint_040010"
FT                   /product="5.8S-23S ribosomal RNA"
FT   gene            complement(2516..3808)
FT                   /locus_tag="Eint_040020"
FT   rRNA            complement(2516..3808)
FT                   /locus_tag="Eint_040020"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(<3822..>4994)
FT                   /locus_tag="Eint_040030"
FT   mRNA            complement(<3822..>4994)
FT                   /locus_tag="Eint_040030"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(3822..4994)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU06_0090"
FT                   /db_xref="InterPro:IPR022115"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G1"
FT                   /protein_id="ADM11296.1"
FT                   /translation="MLLIKFLALLNVLRGSESGPSTDIERKRNPVKSFLCEGNYRKLIF
FT                   YPFVFRNGLVIASPSTRYDEIKETEKEYVEDVIMGFCSLIFDCMGPVAISPYKKWVYSE
FT                   IAKEVLIESDKTRYFNSIDIYKKKKEKSKGVTLGFILKKITWENIHLLNEFGNRLIDKV
FT                   ETETKKLNKDPSSSEEEKEKEKKKLEIVKKYAKLILTKEQQNLMISAFNIVHDACVYLW
FT                   EKKENREHFILKMRLNRLYSDKIEFSLGDGPMKKREGSDIVLLGYLSHDSLIYVYNKYG
FT                   IEVAAELVKEVFLEHKDDSEFCADRIIEREEKRRRIEEIERKAESERYSEELIREEEEE
FT                   KRRSRGKESGFGLVLVSSERDLCSTVGMEDFLGFDVAVARGLLMRDLRDF"
FT   gene            complement(<5370..>6836)
FT                   /locus_tag="Eint_040040"
FT   mRNA            complement(<5370..>6836)
FT                   /locus_tag="Eint_040040"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(5370..6836)
FT                   /codon_start=1
FT                   /gene_family="HOG000150305" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040040"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0120"
FT                   /db_xref="GOA:E0S6G2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G2"
FT                   /protein_id="ADM11297.1"
FT                   /translation="MVQDQKKRNDKPLGFLGMVKKGNKTLLSAALGLFLGIVKSQLDLA
FT                   GEIFKADLSMKSGDLKKAESIYKEISQYFGNSGVFREKYAEFLMSRGEYDEIIKRFGED
FT                   QEMKGKTTRASECLSILLSSNVRLISTLVKESPYSGPVLRAYIQVCLIDEKLEEAAKFI
FT                   KKSRVMFPSEPEFIHQEMQLYFLTGMFSAGIKELESLGYKGIASSFKSILDSYERVKKS
FT                   NLSSKDKYRKLDVLARSISLIESDSNFFPSIFSTLKLNVILELCKNGIESGEKGLTNRA
FT                   QYLYSKRKSEDAMYLYIMALVFDGKISEAEEKLQEFKFRNTKLKNHIWNQIETAKAEKE
FT                   RERKAKEERRYKKRRYMDGSQRMSRNKGDFLGYYKILGFKENQKPSEKEIKKAYRKMVV
FT                   ANKKRKKTEGEEKEWEENFKKLNKAFGVLTDKKKREMYDGGIDPDNPQQTGGFGEDPFQ
FT                   EIFRGFGDFAGFGFPQERRGRRTTTTYFYF"
FT   gene            <7186..>7386
FT                   /locus_tag="Eint_040050"
FT   mRNA            <7186..>7386
FT                   /locus_tag="Eint_040050"
FT                   /product="40S ribosomal protein S14p/S29e"
FT   CDS_pept        7186..7386
FT                   /codon_start=1
FT                   /gene_family="HOG000231300" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040050"
FT                   /product="40S ribosomal protein S14p/S29e"
FT                   /note="similar to ECU04_0125i"
FT                   /db_xref="GOA:E0S6G3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G3"
FT                   /protein_id="ADM11298.1"
FT                   /translation="MTFEVLFDIPVKKNEQSGPHSHRKPFGKGSRSCVSCYTFRGIIRK
FT                   LMMCRRCFREYAKDIGFVILD"
FT   gene            complement(<7401..>8090)
FT                   /locus_tag="Eint_040060"
FT   mRNA            complement(<7401..>8090)
FT                   /locus_tag="Eint_040060"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(7401..8090)
FT                   /codon_start=1
FT                   /gene_family="HOG000150304" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040060"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0130"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G4"
FT                   /protein_id="ADM11299.1"
FT                   /translation="MSSKILTQKLEDLQPVVTAGCVIQSSYELVENGIDATLSDLILPG
FT                   FVNFFGPGLCANIVYKQAELSKESLISYFVGMIIFSILSQTRFLWISSAIFPVMGKGFM
FT                   LISLKNNNKPFHLIVGWLMALEMSGVLVQKLLFNKKMKVTGDKVGEIFILILGLGLGRL
FT                   YRLPDYTMMVVVFLIALGPFVQYILSLPPFSQKKQKKERAKYPRIKLPKRRAAQKAQDT
FT                   LKTGKMK"
FT   gene            complement(<8219..>8827)
FT                   /locus_tag="Eint_040070"
FT   mRNA            complement(<8219..>8827)
FT                   /locus_tag="Eint_040070"
FT                   /product="40S ribosomal protein S5"
FT   CDS_pept        complement(8219..8827)
FT                   /codon_start=1
FT                   /gene_family="HOG000039066" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040070"
FT                   /product="40S ribosomal protein S5"
FT                   /note="similar to ECU04_0140"
FT                   /db_xref="GOA:E0S6G5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G5"
FT                   /protein_id="ADM11300.1"
FT                   /translation="MSYKNHKKFYPQGMSEIKLFEKYSYDEVKVENLSLKPYINLSRHG
FT                   IVPHATTTITKGTMGKARIPIAERFVCSLMRHGRNSGKKRLAINIFEDACFIIHSMTKK
FT                   NPLQVLVDAIINAGPREDTARIGRAGSMRRTSVDVSPLKRISIAISNISAGIRSASFRN
FT                   RITLAEAIANELIAASTGSQNSYAVNKKKEIERIAQSNR"
FT   gene            <8810..>9160
FT                   /locus_tag="Eint_040080"
FT   mRNA            <8810..>9160
FT                   /locus_tag="Eint_040080"
FT                   /product="hypothetical protein"
FT   CDS_pept        8810..9160
FT                   /codon_start=1
FT                   /gene_family="HOG000150303" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0150"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G6"
FT                   /protein_id="ADM11301.1"
FT                   /translation="MIFIGHSFDFEFTTKTSNPIRCAFGKQFFMLLFSDNTGMYKGSTH
FT                   HVCFVVPVHYPSFVRSLLKPKHLSLKESVDYLFKFKTPEDRNRFTLYVGSISNTCFEII
FT                   KELGPARKVSKK"
FT   gene            <9690..>10265
FT                   /locus_tag="Eint_040090"
FT   mRNA            <9690..>10265
FT                   /locus_tag="Eint_040090"
FT                   /product="hypothetical protein"
FT   CDS_pept        9690..10265
FT                   /codon_start=1
FT                   /gene_family="HOG000150301" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040090"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0160"
FT                   /db_xref="GOA:E0S6G7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G7"
FT                   /protein_id="ADM11302.1"
FT                   /translation="MYNPRNHLGFVFLLERYHLSYENTLPPETIAVIPMHGKNKGIAIS
FT                   NIHPRIRLKDIIDIFSVFGNVIGFQVLKEGFALKFESFPEKSLSMDNFPLVHKRMKVRL
FT                   IELADDYDTFQRGTVVMFNPSLDVDEIRDECCMFGCVTEVIRKQNGIYVICSSEADGES
FT                   IFMNMYGRYYNKERIRCWITDEKSLLGE"
FT   gene            complement(10371..10444)
FT                   /locus_tag="Eint_040100"
FT   tRNA            complement(10371..10444)
FT                   /locus_tag="Eint_040100"
FT                   /product="tRNA-Lys"
FT                   /note="tRNA Type: Lys, Anti Codon: CTT, Cove Score: 66.23"
FT   gene            <10599..>11576
FT                   /locus_tag="Eint_040110"
FT   mRNA            <10599..>11576
FT                   /locus_tag="Eint_040110"
FT                   /product="endoplasmic reticulum membrane-associated
FT                   oxidoreductin"
FT   CDS_pept        10599..11576
FT                   /codon_start=1
FT                   /gene_family="HOG000150300" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040110"
FT                   /product="endoplasmic reticulum membrane-associated
FT                   oxidoreductin"
FT                   /note="similar to ECU04_0170"
FT                   /db_xref="GOA:E0S6G8"
FT                   /db_xref="InterPro:IPR007266"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G8"
FT                   /protein_id="ADM11303.1"
FT                   /translation="MLWTLGTLLITIAALNPDQIDLSISRVNNTTYRTLEKLVSKDSYS
FT                   LVKTKDLGEFSSPSKCTLLSCLIKKSSIFNEEYINLLEVKEAYTGYKTNDGSAETWRKI
FT                   WEISGEDSLLPTLVSGLQFSIFTHLSSFHKKFFTVYFPNPALFHKKFQDKHRLNFYLTY
FT                   LLLRNCVGGIDMDCPEMDKDLLDVVQTIRAQGSTNWVRQTLDLEKTIQRVDKMIDLLKN
FT                   INCEKCQLWGTIQLKGLRAALKVFSGSSNLDNLERFFLANLFMRLSVSVRENIKLRRYK
FT                   FPLLVSVSLYWMEILSFATSFLIILLVSRVRNKFKSKIALKSCM"
FT   gene            <11662..>12432
FT                   /locus_tag="Eint_040120"
FT   mRNA            <11662..>12432
FT                   /locus_tag="Eint_040120"
FT                   /product="transcription elongation factor S-II"
FT   CDS_pept        11662..12432
FT                   /codon_start=1
FT                   /gene_family="HOG000149490" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040120"
FT                   /product="transcription elongation factor S-II"
FT                   /note="similar to ECU04_0180"
FT                   /db_xref="GOA:E0S6G9"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR016492"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6G9"
FT                   /protein_id="ADM11304.1"
FT                   /translation="MDQITNLEEIKRLIKCKDLKALDSALSGSQNISASKLKELISLSD
FT                   SKKVQTLIESKYAEIASQMKEEGNSKQRKNEEGFIVQEADIDSSSALDEVATGDSQKDR
FT                   SIKMFFDAFKTNISDCCNRSAALLAKQITVEIFGRSPSDIAKLVRSKCLNLKDKNNPVL
FT                   CRRVYDGDISPSRYVDMTSEEMKSENLKNEEVKMIEDSLYECQIPTQKAETDMFKCSKC
FT                   GERKCSYRQLQTRSGDEPMTTFVTCECGNKWRFC"
FT   gene            complement(<12515..>13129)
FT                   /locus_tag="Eint_040130"
FT   mRNA            complement(<12515..>13129)
FT                   /locus_tag="Eint_040130"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(12515..13129)
FT                   /codon_start=1
FT                   /gene_family="HOG000150299" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0190"
FT                   /db_xref="GOA:E0S6H0"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H0"
FT                   /protein_id="ADM11305.1"
FT                   /translation="MNGEIPEPENISLTSREFLDELRGRYKKEVAREHNRTIFGENPQK
FT                   YRKMGLNEYLEKDNETQEEIVIPKMNGNELASLAQEANVSIKVDKLNRDPGIIVLLVEG
FT                   TLTAIKSFKIRMEQIHNKLPGDIYVDGEAKVLDIPSGREDLVIGKNGVNVYKLQKDFKV
FT                   IARVIDGANSGLKALLISGNDKDRVQEACNYVIDLIYRDFN"
FT   gene            13185..13258
FT                   /locus_tag="Eint_040140"
FT   tRNA            13185..13258
FT                   /locus_tag="Eint_040140"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA Type: Ile, Anti Codon: AAT, Cove Score: 63.26"
FT   gene            complement(<13285..>14037)
FT                   /locus_tag="Eint_040150"
FT   mRNA            complement(<13285..>14037)
FT                   /locus_tag="Eint_040150"
FT                   /product="Ser/Thr protein phosphatase 2A regulatory subunit
FT                   beta"
FT   CDS_pept        complement(13285..14037)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040150"
FT                   /product="Ser/Thr protein phosphatase 2A regulatory subunit
FT                   beta"
FT                   /note="similar to ECU04_0200"
FT                   /db_xref="GOA:E0S6H1"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H1"
FT                   /protein_id="ADM11306.1"
FT                   /translation="MLKSDDMEERALISEFLIKISGFSKCLEAVFLGLCNEFINFIENS
FT                   RTHVGMEEALKIVGELSRRKAIANEDMAVFHHQIILRMAGTRFWGESKEIPGVVRAICR
FT                   NYPRMASLTIKHLIKIFGGACSITKSTILYIVKEILKTISDETYRNLEDDFCKLTAISL
FT                   GSYHHLVVEGAAEMLLENHRILSRHRRASIPKIFGPIYRTSKRFWRMEGINKTLRSLYA
FT                   ILEIDHRLFEECLKSYNMRRWKNKWMED"
FT   gene            <14550..>15746
FT                   /locus_tag="Eint_040160"
FT   mRNA            <14550..>15746
FT                   /locus_tag="Eint_040160"
FT                   /product="glucose transporter type 3"
FT   CDS_pept        14550..15746
FT                   /codon_start=1
FT                   /gene_family="HOG000149489" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040160"
FT                   /product="glucose transporter type 3"
FT                   /note="similar to ECU04_0210"
FT                   /db_xref="GOA:E0S6H2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H2"
FT                   /protein_id="ADM11307.1"
FT                   /translation="MDVEKSSPVQKSVFYSALMSSASSLLFGMSLTVIGCMYPHVSKRW
FT                   EETMNKTEVNNLWGITSSNIFLGCLISNVLVNAIRPNMKKALLLNNIFHVTGYIIFLLD
FT                   QNFKSIFSGRLIIGLGSGITCAIVPIYTSLVSSKESRGFLLSFHPLGICIGITIGNTLS
FT                   SLNSDSTWRIPLFIALLLVALNFLSLLGIIDPSHQEASSEVSFPSLFKNPRARKSIFLA
FT                   VLVHISQHLCGVDYITLFLKDLFPVDMYSPEVMTVAISSFSVLVTGLFARYVDFIGRKP
FT                   LIIASSLISGTATAMLTFNIYPAFATLLFILGYNIGLGPIPWFITAEIFPPEYTNPACL
FT                   LGVSLNWLSAYGVLAALYPFHLRYGRFVFSFYTFCTILFAGLMALFFTETKNKAPDFQ"
FT   gene            complement(<15762..>16793)
FT                   /locus_tag="Eint_040170"
FT   mRNA            complement(<15762..>16793)
FT                   /locus_tag="Eint_040170"
FT                   /product="histone acetyltransferase complex SAGA/ADA
FT                   subunit ADA2"
FT   CDS_pept        complement(15762..16793)
FT                   /codon_start=1
FT                   /gene_family="HOG000149488" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040170"
FT                   /product="histone acetyltransferase complex SAGA/ADA
FT                   subunit ADA2"
FT                   /note="similar to ECU04_0230"
FT                   /db_xref="GOA:E0S6H3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H3"
FT                   /protein_id="ADM11308.1"
FT                   /translation="MAISCSNELRKVSVLCDNCFIGMESLVYVKCSECGIDLCLLCFVN
FT                   QIETSLHSKCHEYRIVSGMNTKIHGREWTLMEEILFVEGLGVCGIGNWPEISKYVGGKK
FT                   DVESHFYKIFGFQRNTCKPLRMSKSVSNPYRGLIGSYMPFREDFDVEYMNDHEALIKDV
FT                   NFEEGEGELKGRLVEAVLDSYIRIIMFRNRRKHITLDRNLVDMESLKTKNEKSGIGDTI
FT                   KWITPYLTKQDFNVFFRGLYIEKKLYDLLKGYSRKENSTYEEEIGYIKNFCSERERKLC
FT                   EAYGLSINVYLELRKEVISCLIKKKEFVKEDFDRLFGFLKETDELYSFFLENGWIRKEE
FT                   EKD"
FT   gene            <16923..>18227
FT                   /locus_tag="Eint_040180"
FT   mRNA            <16923..>18227
FT                   /locus_tag="Eint_040180"
FT                   /product="hypothetical protein"
FT   CDS_pept        16923..18227
FT                   /codon_start=1
FT                   /gene_family="HOG000150298" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040180"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0240"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H4"
FT                   /protein_id="ADM11309.1"
FT                   /translation="MVAFGDICEDEIEAFLLSHIDIPYFRNNPSYISLWQRYYYKTKEP
FT                   GVLFLMKYKKVSQYYHWIYVELSRLFMKNGHYGISRAILDMGIACNAYDKKVLKDEIEK
FT                   IPLSTTVFSDHETSALINPKGFVALGKVWNSYRETLFYNRELFILDGEEISFEEYRSRI
FT                   WSKKTALSCPRVSHRVETDVPSREEHSLNNKTRILSRGSCRIHNQDGRKRENNSAEVTE
FT                   NILASGQEIIIDDLIYYIKEVIDEKRYRMICISNEVSKDLMNRGDLLLHEVSKTTIDLI
FT                   QKLDSNYVPPFNVKKLGSRMFLLYDFYYFGSLKSCLDVPTSIRSNIALYFMAQLADIFN
FT                   EMKKVGLGFTSFSLESLCVSEDCRLKIVDFDWSLESPEINYGEIMRDFLQQYTNFPTDA
FT                   PDITEKIRSELEKIKLKELIVKYKIHIYEKICKYP"
FT   gene            <18338..>20164
FT                   /locus_tag="Eint_040190"
FT   mRNA            <18338..>20164
FT                   /locus_tag="Eint_040190"
FT                   /product="HrpA-like helicase"
FT   CDS_pept        18338..20164
FT                   /codon_start=1
FT                   /gene_family="HOG000149487" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040190"
FT                   /product="HrpA-like helicase"
FT                   /note="similar to ECU04_0250"
FT                   /db_xref="GOA:E0S6H5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H5"
FT                   /protein_id="ADM11310.1"
FT                   /translation="MSPYLYRLPIEVHKDKILDTVGKFKVCVIKGPTGCGKSTYIPYLL
FT                   SSFFPSSRIAIVEPRRIAVMSLYKTLSSVIGRVGYKMRFNKSIGKDSKTIVYTDGSFLN
FT                   DMDEGRFDYIIIDEVHERSIRTDIILGLLRRNIRDIRGKVILMSATVDTEKISRYFGAG
FT                   VLEIPGDSYPVRIEYLPECTSDYIVESYCIIKKIALSKESTWDGFESKNRDILVFLPGE
FT                   EDINDLYVLLRKLPVVKVYKVFSALTDKDQSKIYEPCKLRKVILSTNICETSLTIPGIG
FT                   YVIDSGLHKVKIYDQMNYLGIQAISKESADQRLGRCNRTGPGTCYRLYTEDIYNELSPQ
FT                   KSPEICRSDLSQAFLQLLKHRRNPLKFEFLDYPTRTNAIATLDFLMEKGCINIIDTRKQ
FT                   SSDRRLDAISMHQECNADSKKMSLEDLQLKITSYGKVVLRHPFDIHLSHFYQQSLDKGV
FT                   GYLASILVSLVSQDNCSFLKYKSKSQKTDIEFLISLFEGYLESEDKKQYCIKHEIGIKY
FT                   MEIAKRIFSALNRKKDGDIEMIEKVFSFAYQHNLCERMKDGSYRHLKGGSVVWIHPTSC
FT                   FFKRKDRFVVFVDVFYTTKAYANIVGRYFKTF"
FT   gene            complement(<20232..>21152)
FT                   /locus_tag="Eint_040200"
FT   mRNA            complement(<20232..>21152)
FT                   /locus_tag="Eint_040200"
FT                   /product="DHHC-type zinc finger-containing protein"
FT   CDS_pept        complement(20232..21152)
FT                   /codon_start=1
FT                   /gene_family="HOG000150297" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040200"
FT                   /product="DHHC-type zinc finger-containing protein"
FT                   /note="similar to ECU04_0260"
FT                   /db_xref="GOA:E0S6H6"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H6"
FT                   /protein_id="ADM11311.1"
FT                   /translation="MGWKEFRNEVLRVAAFTIYPTLELYVYFVFVGILCLEDTEFDSWM
FT                   IFVLFVAYHVIVTYKAMFYMKLFINEGTSTLEIFPDIPQDGYDMKLKGMNKFVEEEMMK
FT                   QTIAKIKLCSKCKTYKPPRSHHCGTCKRCYLKYDHHCALLNTCIGFHNYKFFYQFMILN
FT                   LVSVIFFIVTIFIYMTLGIPKTKGHWVNYIVSMSLMGIEFVFNLSLLIFHTWLIGMNET
FT                   TIEHYALNDYVTGDHSLSHIFQEGPMTTLTDSIDRRTLNPYNLGWKQNWKQVFGTDPLD
FT                   WVTPSYSTVGNGISFPKNYDEYDII"
FT   gene            complement(<21382..>21795)
FT                   /locus_tag="Eint_040210"
FT   mRNA            complement(<21382..>21795)
FT                   /locus_tag="Eint_040210"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(21382..21795)
FT                   /codon_start=1
FT                   /gene_family="HOG000150296" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040210"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0270"
FT                   /db_xref="GOA:E0S6H7"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H7"
FT                   /protein_id="ADM11312.1"
FT                   /translation="MDYLGPMKMENFVRRMEEEIRGEDDVKKEELSCPEPISNTPLHKK
FT                   RKMVISPCNLQRRKCVAENSTIEKKESTFMSCRKCGKKLKLTNNYNCRCGNTYCIMHRF
FT                   HDQHGCTFDYKTIAMAKLSAQNPRVMGKKIGEP"
FT   gene            <21883..>22905
FT                   /locus_tag="Eint_040220"
FT   mRNA            <21883..>22905
FT                   /locus_tag="Eint_040220"
FT                   /product="RNA polymerase II transcription
FT                   initiation/nucleotide excision repair factor TFIIH subunit
FT                   SSL1"
FT   CDS_pept        21883..22905
FT                   /codon_start=1
FT                   /gene_family="HOG000150295" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040220"
FT                   /product="RNA polymerase II transcription
FT                   initiation/nucleotide excision repair factor TFIIH subunit
FT                   SSL1"
FT                   /note="similar to ECU04_0280"
FT                   /db_xref="GOA:E0S6H8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004595"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H8"
FT                   /protein_id="ADM11313.1"
FT                   /translation="MAKQFSWEQEYKRTWEDRSDRKVNEFNTETGIFYSNNRKGIVRHL
FT                   HVIIDVSEAIDKSDFLPTFRTNVAKILEGFIPSFYSENPLSTLSFLSVRDVCVKYISSM
FT                   DMDIHAFLGQTGSKWFSLLNGLEGSVEIIKNTTHVKEILVIVASTSTRDPHGYTEVLTK
FT                   LKVHNIKVHFISLCGEVTLYKSISKATEGRFYVPVDVGHLSIIMKELSHPTDFNGTTLS
FT                   LVKIGFPLPVIEPSVCACHLEMKSAGYECPVCKTMVCSLPVSCPICNTQLVSTLNLSKS
FT                   LRFLYPLKPFIEKEGKMCRICQSKGGYQCELCKSIFCNSCNGFVHNTLSFCIYCELPYN
FT                   "
FT   gene            complement(<22919..>23425)
FT                   /locus_tag="Eint_040230"
FT   mRNA            complement(<22919..>23425)
FT                   /locus_tag="Eint_040230"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(22919..23425)
FT                   /codon_start=1
FT                   /gene_family="HOG000150294" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040230"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0290"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6H9"
FT                   /protein_id="ADM11314.1"
FT                   /translation="MRSLFMPVYEKRFETTEYDVFAYTTVSQGILTSGDCIELVSPVYI
FT                   NFPKEFVLKGSKIFCKVKTRGSYGELRLIKIKRISRPSNGYAVLKKLIPSVFDVGFIRR
FT                   INFQSYLYSNRDTIMRSSVRVLGKEVVNQINLWKRINWNYEQDPESPEDEIRDVSSDIL
FT                   LSDYW"
FT   gene            <23447..>24184
FT                   /locus_tag="Eint_040240"
FT   mRNA            <23447..>24184
FT                   /locus_tag="Eint_040240"
FT                   /product="protein tyrosine phosphatase"
FT   CDS_pept        23447..24184
FT                   /codon_start=1
FT                   /gene_family="HOG000149486" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040240"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="similar to ECU04_0300"
FT                   /db_xref="GOA:E0S6I0"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I0"
FT                   /protein_id="ADM11315.1"
FT                   /translation="MTVNKELRDILSGYHDRIKSKICENKLDEAIYLVDSLCATFKSPS
FT                   SPYDRSSCTPYSNEVSEKYGIGEYINASFVPALGTLFIAAQNPKDEKKDVFIDLLVKSN
FT                   TSLIVSLINDPKYFEEEWLKDRKIIKYMGKDLFIDETYDVQGRDIRRLRYINWVDFSVI
FT                   TREEMEQFHSHFNKVRTDTVVVHCIAGVGRTGTFIMYDILKKMENVTLDMFVDVFLNLR
FT                   SKRAHLVTNKVQLEFLKSIFLGN"
FT   gene            complement(<24228..>26615)
FT                   /locus_tag="Eint_040250"
FT   mRNA            complement(<24228..>26615)
FT                   /locus_tag="Eint_040250"
FT                   /product="26S proteasome regulatory subunit 4"
FT   CDS_pept        complement(24228..26615)
FT                   /codon_start=1
FT                   /gene_family="HOG000149485" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040250"
FT                   /product="26S proteasome regulatory subunit 4"
FT                   /note="similar to ECU04_0310"
FT                   /db_xref="GOA:E0S6I1"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I1"
FT                   /protein_id="ADM11316.1"
FT                   /translation="MEEDELKIIVERIRDPDADIQNNALNMLFNITKSSHSKSIDTINF
FT                   QYLADNLPMLEEVCKDLSEDKRKWLCDIISAICVIDDEKKLLEYRIEGNVIDLKEWGHL
FT                   YVKKLTGCIADVKNGKMDLPFERTREVSRKCIDFLFKHNAEFEAIDFLLEIRGIESILE
FT                   YVDTHNYNRIVLYLEDMNSFVELSEVILGIYLKMNDHSRYVVGLIKRQKTKEAIEYVKK
FT                   IEDRDYKKQCLYILARCNLYYEVSDPEEKYILSNSYIKEVYRSVGTELEIDKPSKMDGI
FT                   FRGFKYDKDTKQLASVAIANGFVHMGYGRDPIFVPQEGDSRVPLDYEAILGCDVPDLIS
FT                   VFGSIGVIESWNSEKVMETLQEHIFSDSSHRKTGSLLGLALSGLRNFEERPAILALLSN
FT                   NLQSNNSIHVIGTLLGIEAMFSGTQSEEVRELLQPLMFSDCNEVVFFTAFTLGSVFCGS
FT                   ADEDLTSLMLQTFLEKEKESETQFFRFLMLGLASLFYRRKDVECGIMEIGGSLGKHQNI
FT                   LIKGFQHAGSGDSNIIESILTDSFTGDTDALLESLGLLSCALVSMGDETSSQMVGRIVS
FT                   SSLLLDSSHLRSVLPLCYSILYPSNPQVNVLDILEKSLNIGETNCIISTIVSLGFIGAG
FT                   TLNSRITKILDQQYSYYYKDLKVLPVLKIAQGLVSLGKGLLSISPLCFDKTTFMPKNTI
FT                   GLFSTVFMLLDSSISPLITSHSYMFFLLCQACTPKYVTCSEKINIRVGHPINTVGMVGE
FT                   PKKLSSVQMHTSPVVLSEKTRAETDENVCSSYIEDVLILKKN"
FT   gene            complement(<26749..>28548)
FT                   /locus_tag="Eint_040260"
FT   mRNA            complement(<26749..>28548)
FT                   /locus_tag="Eint_040260"
FT                   /product="putative class 3 lipase"
FT   CDS_pept        complement(26749..28548)
FT                   /codon_start=1
FT                   /gene_family="HOG000150293" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040260"
FT                   /product="putative class 3 lipase"
FT                   /note="similar to ECU04_0320"
FT                   /db_xref="GOA:E0S6I2"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I2"
FT                   /protein_id="ADM11317.1"
FT                   /translation="MEVDIKIRKVEVPENTYDTLVLCYDGEEVIFKDRAVMTFKTFHHT
FT                   VIGDSRILLMKNSFPWDLCMGFVLLNHCFFRNGDEKQEHTLDIYHGRYRDKASSYDFEP
FT                   KEVIGKLHYTFGRKIYDERDMREEDEISGFVQKVFGFFFSNEKAGTILSIKKLVDYVNR
FT                   GSHGCRLNILFGGLLVEKTIAEINARFTKNIDLVLEVSHEELPRVFDEANGRRSFSPSE
FT                   GGIKEDKENEKRLFRLKLPTHCSLCEKDGRDESSICIPSILSSNGYLLCNLEMLRKIKR
FT                   LFYFAMGSYANSWPSMFLRPQASVGESVSDERRAVLKLLGIENKDLLCMHLEPSEVVQH
FT                   IIFHDRENERVVISFKGTTNSEETIQDINCEYAEFSNGFVHNGFKRLSTHFINNHINSV
FT                   EKILGDIGSKKLLLLGHSLGGAISILVKIMVEEMGLLENVDVEAIVFSSPPVVSEEIAS
FT                   RFAKGITVIIYGNDIIPRMSYGSVLDLKFLCCSIGEKHGPMDSCGEMEKDMDLILTHLR
FT                   RTNLYPKLYLPGELVHMKRIRCSLNKNENPMVTFKLVERRFFEQIILVKHAPKHHMVGH
FT                   IASVIDHGISMLEKREYINSNWV"
FT   gene            complement(<28730..>29110)
FT                   /locus_tag="Eint_040270"
FT   mRNA            complement(<28730..>29110)
FT                   /locus_tag="Eint_040270"
FT                   /product="60S ribosomal protein L14E/L6E/L27E"
FT   CDS_pept        complement(28730..29110)
FT                   /codon_start=1
FT                   /gene_family="HOG000210138" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040270"
FT                   /product="60S ribosomal protein L14E/L6E/L27E"
FT                   /note="similar to ECU04_0330"
FT                   /db_xref="GOA:E0S6I3"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I3"
FT                   /protein_id="ADM11318.1"
FT                   /translation="MLFVPNMIVVVTNGKNAGKKAVVIKQLDERCVLTACVVRVPKESE
FT                   DHQPKWIQRRNAKFYIILKKYNISHLIATRYKADLGLAAIDYNGIEENAETKKVLTDKT
FT                   KDAMMKTWKEGKAKFLFSSLSF"
FT   gene            <29155..>29460
FT                   /locus_tag="Eint_040280"
FT   mRNA            <29155..>29460
FT                   /locus_tag="Eint_040280"
FT                   /product="hypothetical protein"
FT   CDS_pept        29155..29460
FT                   /codon_start=1
FT                   /gene_family="HOG000150292" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040280"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0340"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I4"
FT                   /protein_id="ADM11319.1"
FT                   /translation="MEKIELIKGIEANAERILEDFIEILQYLRSEGSDKCDEVQNLLFA
FT                   SRRTVDLIDSSLEIYHYLIRLKYLTSDVSRLVPLKKEDESGILEDLFEDLNTRLGI"
FT   gene            <29591..>33016
FT                   /locus_tag="Eint_040290"
FT   mRNA            <29591..>33016
FT                   /locus_tag="Eint_040290"
FT                   /product="DNA topoisomerase II"
FT   CDS_pept        29591..33016
FT                   /codon_start=1
FT                   /gene_family="HOG000216693" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040290"
FT                   /product="DNA topoisomerase II"
FT                   /note="similar to ECU04_0350"
FT                   /db_xref="GOA:E0S6I5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I5"
FT                   /protein_id="ADM11320.1"
FT                   /translation="MKTIEETYQKKTPVEHILLRPDSYIGSVEKEMQQMYVWDEDNSKM
FT                   VFKNIEYVPGLYKIFDEIIVNAADNKIRDPKMNVIKVSIDPEKNEISVYNNGRGIPVRI
FT                   HKEENVYVPELIFGNLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSKEFIVETADCEVKK
FT                   YYKQRYRDNMGIKEEPEISRYTKEDFTRITFKPDLRRFKMNKLDDDTVSLLKKRVYDLG
FT                   GIVKDVKIFLNEKKIPVKGFKEYVKLYIPSGVNIVHQVINDRWELALTTSEEQFQQVSF
FT                   VNAICTSKGGSHVNHVVERIVDPLLEAIQKKEKGLSVRPFQIKSCMFIFVNCLIENPAF
FT                   DSQTKENLTLRVSAFGSKCEPISDFVKNVIKNTSLVQKVTSFAKARQSQQLKKTDGAKT
FT                   SRLSGIPKLEDANFAGTSKSKDCTLILTEGDSAKTLAVSGLSVVGRDIYGVFPLRGKLL
FT                   NVREASHKQIMDNAEISNIKKILGLQHNKIYEDVSSLRYGHIMIMTDQDHDGSHIKGLI
FT                   INFLDHFYPSLLKIPGFLQEFITPIVRASKKGEVKDFFTLPEYEEFKKNSDGWNIKYYK
FT                   GLGTSTSADAKQYFSNLPIHVKYFTPLIEEDKELIDLAFNKKKADARKTWLLNFEPGTF
FT                   LDQSQPQISISDFVNKELILFSMADNIRSIPSLVDGLKPGQRKVMFSCFKRNLRSEIKV
FT                   AQLVGYVSEQSAYHHGEQSLCSTIVNLAQDFVGSNNINLLLPIGQFGSRLQGGKDAASP
FT                   RYIFTSLSPLTRLIFNENDDAILSYLNDDNLSIEPEFYVPIIPMVLVNGAEGIGTGWST
FT                   SIPNFNPVDVVENIRRLIRGEDPVEMIPYYRNFRGTIEKVGEGKYQVSGIYEGDMDLEI
FT                   SELPVGTWTLNYKEFLESLVQAGVVKDFKEYHTEKTVSFSVKLSKSISNLKLSTTITIN
FT                   NMVCFDENLGIKKYSTPQEILKEFYDVRLRYYSIRKENMLKVMKEELVKLENKVRFIKE
FT                   VSTGELVISRRRKGEVIFDLESRRYARVDDYEYLLSMSILSLTVERIEKLNNEHAKKLE
FT                   EYNKLESKTPKELWLDDLEVFEREYLKIVERETKEYDDELNGCVRKKGKKPKSRKETTY
FT                   RPKKAKKPKSPQVTENSSDDNSLEEKPWKKYSLI"
FT   gene            complement(<33101..>33616)
FT                   /locus_tag="Eint_040300"
FT   mRNA            complement(<33101..>33616)
FT                   /locus_tag="Eint_040300"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(33101..33616)
FT                   /codon_start=1
FT                   /gene_family="HOG000150290" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040300"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0360"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I6"
FT                   /protein_id="ADM11321.1"
FT                   /translation="MSILQNDIDAIIRRYKGLQIREKEYKDIVGTLVGGTLEKAPHPKI
FT                   IELIEIFVSAKTKPIYLNEVKNYLFENDKDLYRRYAGMFERNPGVFEAFGIQGEERVLP
FT                   LPQDEPVVFKSLKPKLADFAKRKSKTLRKTIRKESKMSAYHKVMKEKSASIEYQKKIDA
FT                   MYRKARKE"
FT   gene            <33679..>34881
FT                   /locus_tag="Eint_040310"
FT   mRNA            <33679..>34881
FT                   /locus_tag="Eint_040310"
FT                   /product="hypothetical protein"
FT   CDS_pept        33679..34881
FT                   /codon_start=1
FT                   /gene_family="HOG000150289" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040310"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0370"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I7"
FT                   /protein_id="ADM11322.1"
FT                   /translation="MVDKMDKRSIRKLYLRKDPKDPYFRSSLTRLVAIGNPYLTFILHA
FT                   MFRDVLPGIPCPAPFGILMKSGKTISYIVRRLMGRKVVLEAKSESEELYSNKWNESDYA
FT                   DIMKFLLNIERTNKRLLFVDQPFIRNVISKISEAEKARIIRFLEVSPLSISIMRTIRTE
FT                   NLTDTHLAVINLLKAKTMPYEEGFRYVHESNVDFKLLKRTFLKSTFSQIQKYFHILVDF
FT                   FPEMMFGIRKPYSNRMQIFADPLSIPLKPRLLCVYIPACIYFIRRKSKSLSLVKNLDVL
FT                   IKTIYIEKILSVSPRRYLLKKVIHQLILDTPILVKVIVMRRFPPNLIKKMVEYIPSFHL
FT                   AYELSLKILSNDPSDSFYEELVEELLKKYPTKSNVKRFQACSHLFSNSLLERLKYLTET
FT                   V"
FT   gene            complement(<35128..>36306)
FT                   /locus_tag="Eint_040320"
FT   mRNA            complement(<35128..>36306)
FT                   /locus_tag="Eint_040320"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(35128..36306)
FT                   /codon_start=1
FT                   /gene_family="HOG000150288" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040320"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0380"
FT                   /db_xref="GOA:E0S6I8"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I8"
FT                   /protein_id="ADM11323.1"
FT                   /translation="MFGDLFNMSLYDSSLLIQSIPGLLISLSGLILMGSVLIDATDDPR
FT                   LAGVPVILEANCILAFKGNIELTFAMYLSSMSQSPLFIYRRYFRYVFDNSSMVLAQSVA
FT                   IGLVIGLIGMAGGILSGGLSEGLGLSILAGALVSCILTSILFIILLVISIELSKFMDIN
FT                   PDNIILPTISSFGDYTNVRSLVYFTKWFRDSSPSSCLSYIFLSISLMPLCLCFVLVSKK
FT                   RIPLQPVEVLLATYGISTASGYVLETFSTRFPVLAPSFPVFGGMSVSIAFIYLHRIFTS
FT                   INNRTIHNSRKSYITLVLASILMSLCYLGMAALMGILYSREFCVLFIISFVFQVTILLS
FT                   GISLLVEYLDKKEEDTGVLALPLISSISDLLSTGFLITICVILDLFDIKNGF"
FT   gene            <36596..>37330
FT                   /locus_tag="Eint_040330"
FT   mRNA            <36596..>37330
FT                   /locus_tag="Eint_040330"
FT                   /product="heat shock transcription factor"
FT   CDS_pept        36596..37330
FT                   /codon_start=1
FT                   /gene_family="HOG000149484" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040330"
FT                   /product="heat shock transcription factor"
FT                   /note="similar to ECU04_0400"
FT                   /db_xref="GOA:E0S6I9"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6I9"
FT                   /protein_id="ADM11324.1"
FT                   /translation="MEKSNASFNFDKIPKFIMKLYKATNNEKYKGISWTPDGLKIHIYD
FT                   RDVFVKETLPLISKTREFGTFVRMLNSYGFVKSKDIEEEDIYYNKNFRKGREDLLGFDD
FT                   TLRMIKRKKSNDIRMRIGDGSLKDVVEYLYVQNQELYTELSACKERIERQERALNGLIE
FT                   ILSRVFRTNSQDFGARIKPNAHNLHDEMDLFLGELSGPLKEGYEPPSPDVQGKGIPELS
FT                   FKPGENFQVDSDSKNDRYDAFF"
FT   gene            <37460..>39769
FT                   /locus_tag="Eint_040340"
FT   mRNA            <37460..>39769
FT                   /locus_tag="Eint_040340"
FT                   /product="hypothetical protein"
FT   CDS_pept        37460..39769
FT                   /codon_start=1
FT                   /gene_family="HOG000150287" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040340"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0410"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J0"
FT                   /protein_id="ADM11325.1"
FT                   /translation="MEIRKRSRIVRALVALLALTSGAVTIIASIAKLQNYIKFSPENDG
FT                   RLDEFGFHRSSLEVSVEEFGCISLRFSDIKEDYFSIGEKEGREEKERLYLEFIINTLGQ
FT                   ISLQKDDEGISEKKDLSREKENLRILVCEIRYNICKNSKLAGIKGKTSSDPSSVALRRF
FT                   LGLDRNFLSHCDLETEETKKMLKVIQGHWPFRLEDVECKVFGKTLPLKGYVASILANYL
FT                   LECKIEKQKRMARDANILMRIETSGEVENTKPSEFVILNDGECMSPETYMNIVREILFL
FT                   AKYKNIISSLSEAKENPLCADELWFLLQKCKNSFNRNLSYKFDRILDSKPRGNLEAENG
FT                   QNCKVDNSLAGFLGVSEDFRDGELRQIKEKDISILEHYQNFLSEMVDEKVYYHILDAKK
FT                   AIKVKDYMAVLLLRNYKDKIYKLAGEIEKKNVSLVKINGRSIEMRRYLWFLVRLMHRAE
FT                   SLSNSASNKELSNGLRKLRENFILYIELLIHGRRIDHLDPPSRAVLRLLGKGEIESINT
FT                   EDIEPEHSYIFENEELCISSRNNVFSTKCNLNGTEVSLGSYAVSVISKYLKEYGKYNKE
FT                   KEDSDSNVFRNVNEALSIRYEDGRPVGTEYFVMVRSMFRKAFCYELEHLLRKAIFDDEP
FT                   GSSIIKYYLDWKIRNIDEFFLKAFRITMNIFDQGGKRVPSHAASMIERILGNDVFFMGN
FT                   IRPKPKDEKLFKSILFRFPRKYKKIECYFGNKKFRLVNLVGKAIVEYLRSDPDGHEGLS
FT                   LELERSLVPETASYEE"
FT   gene            <40167..>40949
FT                   /locus_tag="Eint_040350"
FT   mRNA            <40167..>40949
FT                   /locus_tag="Eint_040350"
FT                   /product="putative 26S proteasome regulatory subunit 12"
FT                   /note="Mov34/MPN/PAD-1 family"
FT   CDS_pept        40167..40949
FT                   /codon_start=1
FT                   /gene_family="HOG000209236" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040350"
FT                   /product="putative 26S proteasome regulatory subunit 12"
FT                   /note="Mov34/MPN/PAD-1 family; similar to ECU04_0420"
FT                   /db_xref="GOA:E0S6J1"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J1"
FT                   /protein_id="ADM11326.1"
FT                   /translation="MSEASVIVHPLVLLSAVDHYKRKGTKRVVGILLGSDDGEVHITES
FT                   FACIFEEDEDGWFIDTSYIRSMFDLFYKVNHKLKIIGWYHTGPKMYGDDLDITRSLSNF
FT                   VENPFLAIINVHLGENDLPVQTFRLDEQDEFVHVGCSIEAEEAEEVGVEHLIRDIREEA
FT                   SGSIASRINGIKESLLVYKGVLSEIRSYLEDVISKDIHPNQEIIDLCQEIINSIPKLEK
FT                   PLDENLSDCYVSVLAKTVIALNDLRRNRLENGIEMGTP"
FT   gene            <40982..>42106
FT                   /locus_tag="Eint_040360"
FT   mRNA            <40982..>42106
FT                   /locus_tag="Eint_040360"
FT                   /product="hypothetical protein"
FT   CDS_pept        40982..42106
FT                   /codon_start=1
FT                   /gene_family="HOG000150286" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040360"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0430"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J2"
FT                   /protein_id="ADM11327.1"
FT                   /translation="MSSNRARFFCKFFFGVCSMEISHIVFLDNGDTSKVNQQVVCGKYL
FT                   VFNSPWDDSQADTKIKRDGRTLDIESKEIILKVASGKIVYLETVYPVSTGVEFVELISP
FT                   PNPYDFFLLRKHFLSKLTGVCPRPMEKEVTYPKKRRIGCFIMPVILCILRKPLEYFLVN
FT                   IPSRIVDYIMNSSVEEKQIITIKTTLGAYVKFFTTIQSLFLRLGFPVVFIDGIYMIPTA
FT                   ACLSIFSRLGLFLAKLLVESIHLLNNSSYNPLKKRRDSVVLNTDQIFMSVLIFSFLLLI
FT                   TFNVVHFYVLYIFMNLCLIALTTFSDFIDFVLIDISKFHTYTLSTDHTKHRQIKLKYTK
FT                   VSIYHKIKFAIQASLLSSKTLKDTVLAKYLLEIK"
FT   gene            complement(<42162..>44042)
FT                   /locus_tag="Eint_040370"
FT   mRNA            complement(<42162..>44042)
FT                   /locus_tag="Eint_040370"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(42162..44042)
FT                   /codon_start=1
FT                   /gene_family="HOG000150285" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040370"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0440"
FT                   /db_xref="GOA:E0S6J3"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J3"
FT                   /protein_id="ADM11328.1"
FT                   /translation="MKSVHVSQLRAGSFNLTSLVEESVDIKEDNVFQTHTNLVELVGDL
FT                   ENIREGLFFKREKLNTKLRTVQEGLKLDKIDDLSKEIGQIVLEPLGPSRDVLEKNKKIN
FT                   HLKRMEKAVKYLMEVEKGNFNVIDSLISSDSEEDWRFLCFLLYSISKVTEDCEKLREYN
FT                   KAMEDKMLDVFEIGNKQNNKTMMRSAYNSLLEMGKESFLVHSYIYSLDLFKEPVRMENK
FT                   EEKIIDLDFHAVEHSTFVELISKIRDAYDDKFRDLGDIFVNTKDVYKMIHKKVYDDIIS
FT                   TALGDYLKGTSPCTFLLGLESCHRNLQILGSFIETIDPDFDESHATEDLISQYTRIAVD
FT                   KEKAFFDQIYEILVLRKPCNTKYIILGEEVGNDSSNIFMYKQLLNTINFALERCNKFYN
FT                   EEEEDELIDFFSWKINGFVTSVYDSMQSKFEVIKLLQFIYLVTRKYFGDKFQKLGVFRN
FT                   KINKKLKDAFEDQIETCAMRIGVRVKQENFVNLEGCERVLEVIEKEISEASEMSIRGEN
FT                   SKILINRILCDLYSALYSRILHLTFDEQQSRNMVEYVSRVLEFAKNFGSAEAVQKLTHL
FT                   LNLGLLISISEGDFESFYASLAGKVSDDEILKAIHCRKDGEKMQQRIFVP"
FT   gene            complement(<44143..>44901)
FT                   /locus_tag="Eint_040380"
FT   mRNA            complement(<44143..>44901)
FT                   /locus_tag="Eint_040380"
FT                   /product="40S ribosomal protein SA"
FT   CDS_pept        complement(44143..44901)
FT                   /codon_start=1
FT                   /gene_family="HOG000232073" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040380"
FT                   /product="40S ribosomal protein SA"
FT                   /note="similar to ECU04_0450"
FT                   /db_xref="GOA:E0S6J4"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J4"
FT                   /protein_id="ADM11329.1"
FT                   /translation="MPQDNTRISDSIKIPEEFVKLLILSQAHLGGTSANKNFARYLYGT
FT                   RPHDKISIIDINAMWEKLIIAARAFCGIKHPSSIAVVSTKTFGRKPVVKFCEAVGATPI
FT                   TGRFIPGSFTNSEVRRMYDPRILIVSDTYADKQAILESQYCNLPTIAFVNADNSLVGVD
FT                   IAIPMNNRSPSAIAAGFFILSRLISYMKTGAELARDMKEVELFLFRDSVELEQLIEEQL
FT                   LETTNTVLNVGKEEILGGITAENTEEWNGF"
FT   gene            45092..45206
FT                   /locus_tag="Eint_040390"
FT   tRNA            join(45092..45129,45171..45206)
FT                   /locus_tag="Eint_040390"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA Type: Ile, Anti Codon: TAT, Cove Score: 34.37"
FT   gene            complement(<45259..>46092)
FT                   /locus_tag="Eint_040400"
FT   mRNA            complement(<45259..>46092)
FT                   /locus_tag="Eint_040400"
FT                   /product="dimethyladenosine transferase"
FT   CDS_pept        complement(45259..46092)
FT                   /codon_start=1
FT                   /gene_family="HOG000227963" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040400"
FT                   /product="dimethyladenosine transferase"
FT                   /note="similar to ECU04_0460"
FT                   /db_xref="GOA:E0S6J5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J5"
FT                   /protein_id="ADM11330.1"
FT                   /translation="MVNPKFNKQHGQHILKNMGVIDTIIERAKIKPTDTVLEIGGGTGN
FT                   LTMKLLQKAKKVICYEIDPRLAAELAKKVNGTPGMAQKFQLFVGDALKHDFPHFDLCIS
FT                   NLPYQISSPFMFKLLKYDFKCAFIMFQREFSDRLVAKPGSSEYCRLSVGAQMLAQVDHV
FT                   LKVSKNSFVPPPKIESSFVRIEPRIPRPPIDLEEFDRFLKICFLRKNKTLKANFRNSSL
FT                   VSKVKGNPSFENTTPEEVFEKVLSRAELDGARAAKMSIDDFLALLLEFRKVGIYF"
FT   gene            complement(<46139..>46945)
FT                   /locus_tag="Eint_040410"
FT   mRNA            complement(<46139..>46945)
FT                   /locus_tag="Eint_040410"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(46139..46945)
FT                   /codon_start=1
FT                   /gene_family="HOG000150284" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040410"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0470"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J6"
FT                   /protein_id="ADM11331.1"
FT                   /translation="MEGIKLFAEVPNVSFRLIRGISDCKEFVVYDGNVFCLTNRSTLIA
FT                   LSSGEEYTFYGDILKMGIYEHYIYLVFKTSKIIVFDAISREVVVNLPEMRRGVKKVIMG
FT                   RTRMHFLGGDGVLYGSAFEDIKYFKNQSICREKDGYSIIQDFWVSGDSIFHATPLGHVY
FT                   KDSSLVLKVFDTVKLLVPREGYLYIVTSGDLLLKYDTCRAKILFKKDIGSSRVVGDNLI
FT                   AFGGMVTDLFGEVSVEVPRDASWVVRGEKSLYVLTPSGVFFGDLSD"
FT   gene            complement(<47041..>48708)
FT                   /locus_tag="Eint_040420"
FT   mRNA            complement(<47041..>48708)
FT                   /locus_tag="Eint_040420"
FT                   /product="MdlB ABC transporter ATPase/permease component"
FT   CDS_pept        complement(47041..48708)
FT                   /codon_start=1
FT                   /gene_family="HOG000149483" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040420"
FT                   /product="MdlB ABC transporter ATPase/permease component"
FT                   /note="similar to ECU04_0480"
FT                   /db_xref="GOA:E0S6J7"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J7"
FT                   /protein_id="ADM11332.1"
FT                   /translation="MKEVMKRSSKLSAVRDILFKYILGSPVVRVIILPVIAILLVAGYG
FT                   EIFITEILNEIQEKADETEAVNGKIKVYLAVALSSYVFGFVSLFVMSSYIETICRDYII
FT                   DLYREHISMSFLDFKKIGVGDMISFMNRKVLSLRDVLESIIKCFIMSLFCVLITVIKIR
FT                   SGIENRYGLLMAGVVIVYGVCVIVLNHYRNIIRLKMNKEIDLSNRKIYNSILNYDIIKS
FT                   YNNEELEANELYKCMKGQTKYAKIYWSWLQVGNFIGENMFVIAMFIMTVRFSNGDTKNI
FT                   GFRDYTLIFSLSNQLRMYCVDISNSFGMILLNLTNIAQNRSEPSREDIQEIGYYKENLE
FT                   REIKIEGLEISIEGKKLIRNVSMCIRKGEKIGISGDNGGGKTSFARALLGFLDYSGSIQ
FT                   IDGMELNGLSKEGLRKMIAYSPQESQLFNKSVIGNIRDGNSRLSDEEIVEFCKRYELDG
FT                   VFKNLDGGYQTLVGNGGNRLSGGQKQKVSMMRTVVKDASIYIFDQVTSHMDKESENRLV
FT                   DMIMKNLSDKTIIMIMRNSDLLNKFDKVYHFSDGVLFS"
FT   gene            <49385..>51625
FT                   /locus_tag="Eint_040430"
FT   mRNA            <49385..>51625
FT                   /locus_tag="Eint_040430"
FT                   /product="ubiquitin protein ligase E3A"
FT   CDS_pept        49385..51625
FT                   /codon_start=1
FT                   /gene_family="HOG000149481" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040430"
FT                   /product="ubiquitin protein ligase E3A"
FT                   /note="similar to ECU04_0490"
FT                   /db_xref="GOA:E0S6J8"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J8"
FT                   /protein_id="ADM11333.1"
FT                   /translation="MNSCLKDEYRRQLMGDCNQMPCHKVFCRGGLKDEVVEALSELLSR
FT                   YGDVFLCRNICKTIDEASGRSLGEDGDIILDFFFCINGMGPKRGPASEIRTCEDDDGAR
FT                   KPRTKNEEDKGVLRLEGGMESMEWAKRKFKKKGVPLFKNKTGNRFGCLKINEMKDEFDG
FT                   AGRLDHSICTLISRKEEISEEKRYILIGVLHLLLKKYENSLHLTLGMMIIRIYYSISRY
FT                   DDIEEIYYPILYKVFCNIRSLYSEMLKKTSLSEGIGCEGGKIDMREGRAICLYLPRFTR
FT                   LDLSMLVDNITTTLNSEEVIDSRESKRVDNLLGMLHMLYLINEECGFLSYKKFYLSAFC
FT                   SRMNFREEFKHFRTRSKTPLNFPFILPVHIKAELIKYENNDKMKTSLQDSFFKSLFEGH
FT                   VDPYLFITVNRETVYRDSIEIFKKMNVLDAKKQLRTTFKNEEGVDSGGIRKEYFQLLSQ
FT                   EIKEDERLFEHTENRIWIRPHKGDEEEYEAIGRIIAIAFYNNIVLNIPFPSLFFKKLLD
FT                   RKPTLDDLREISSGIATSLRNLKRLSKDEINGLDLRFVAEHIVDGTTRIYPLVKNGKNI
FT                   KLTSENMKLFIEKYIEFHTDTLIKPQFEAIRRGFYSIIDRDKMVYLDPKELEKIMMGSN
FT                   TFDIKAIRSTTTYSGFQEDSPIITYFWEIFEALNRKKKKKLLQFITGNDRIPVSGSASL
FT                   KLIIMKNGCDTDRLPSSQTCFNTLLLPEYSSKRKLEKKLETALELTAGFFLL"
FT   gene            complement(<51641..>52063)
FT                   /locus_tag="Eint_040440"
FT   mRNA            complement(<51641..>52063)
FT                   /locus_tag="Eint_040440"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(51641..52063)
FT                   /codon_start=1
FT                   /gene_family="HOG000150283" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040440"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0500"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6J9"
FT                   /protein_id="ADM11334.1"
FT                   /translation="MKNKVLYSKKMSNSGTKGSKMVFVRISKRSELWENNNKHLYEYSV
FT                   GSDKVTLSLYGGRRGVFYECKGVSRIGVEEEEGFGISLGEDEAAFLEEFRCSGLRRNIK
FT                   ENLYAGRKIHRPIDPAINLDFSSDGGEETLFLGKRR"
FT   gene            complement(<52130..>52978)
FT                   /locus_tag="Eint_040450"
FT   mRNA            complement(<52130..>52978)
FT                   /locus_tag="Eint_040450"
FT                   /product="putative RNA-binding protein"
FT   CDS_pept        complement(52130..52978)
FT                   /codon_start=1
FT                   /gene_family="HOG000116208" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040450"
FT                   /product="putative RNA-binding protein"
FT                   /note="similar to ECU04_0510"
FT                   /db_xref="GOA:E0S6K0"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K0"
FT                   /protein_id="ADM11335.1"
FT                   /translation="MEDGVKFCEDDFKHEFAEMSSETVMFPKYREKYIEQTQKYIEKAL
FT                   EAKKISCKIDMGERTIDVMTNRSTRDPFIFVKAVNFVKLVSRGVGIEEAMKVLEDEYFC
FT                   EVVDIKKMASSEKVFEKRRDRLIGPKEMTLKAIQILTKCHVLVHGKTVSIIGSFKGIEE
FT                   VKKIVVDCMNNIHPMYQIRSLIEKRKLEEDKSKEGEDWSRFLPKIKKSNKKSKKKVVGR
FT                   PSGNMPLDVPKRKEDIEMETGEYFVDGDFDFEERESSRERKKKREEKKKRDVEKYVPPD
FT                   E"
FT   gene            complement(<53006..>53680)
FT                   /locus_tag="Eint_040460"
FT   mRNA            complement(<53006..>53680)
FT                   /locus_tag="Eint_040460"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(53006..53680)
FT                   /codon_start=1
FT                   /gene_family="HOG000150282" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040460"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0520"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K1"
FT                   /protein_id="ADM11336.1"
FT                   /translation="MRKDIDGRREKYIYYLSVVRFIHGKLENDRNKVLKWVEDGRAFEV
FT                   CGKVGVPDALDGSKMVKMKRRDLEDILFTFGFQKREYVNSHIYFHRYFRKGEDFDEDKM
FT                   YFSYIFGYEYTGGFLCPDAWERGDIDVQKWYKHMCNVYESIDEMLNLQSEIIKKLWEEI
FT                   AKLVRVGIERTRILPEPRRCIVRGPRRVWKGVEASQGEKTVEDSFVEVVGRKKRERIQK
FT                   FV"
FT   gene            complement(<53756..>54505)
FT                   /locus_tag="Eint_040470"
FT   mRNA            complement(<53756..>54505)
FT                   /locus_tag="Eint_040470"
FT                   /product="heat shock transcription factor-like protein"
FT   CDS_pept        complement(53756..54505)
FT                   /codon_start=1
FT                   /gene_family="HOG000150281" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040470"
FT                   /product="heat shock transcription factor-like protein"
FT                   /note="similar to ECU04_0530"
FT                   /db_xref="GOA:E0S6K2"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K2"
FT                   /protein_id="ADM11337.1"
FT                   /translation="MVGKSKSVEKEIEILYEMVDSTRFTAIEWSKSGRCIVIRNPGMFR
FT                   FITGPFFGFCTGIEEFKRLLESYGFKKIGRSGLKYYNKFFQRQKKNFLGMIYKVNHKSD
FT                   REIPKEEIDSMNENIRIMMSEVPQMIGRLRENEKKISKLRDSLFSLCSHMKTLKPYHEF
FT                   KSINYDPSNKIEFEESMLEWAKRYFQDNANCSFGFLDEVGDLEVPKVPQKSPPKKKEKE
FT                   KVKKTSGITVNLKVKRHKFNDIVQDFQ"
FT   gene            complement(<54526..>55533)
FT                   /locus_tag="Eint_040480"
FT   mRNA            complement(<54526..>55533)
FT                   /locus_tag="Eint_040480"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(54526..55533)
FT                   /codon_start=1
FT                   /gene_family="HOG000150279" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040480"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0540"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K3"
FT                   /protein_id="ADM11338.1"
FT                   /translation="MKPNTHLKKLLKIDISPDSSYSDIEVGLSNLKRIIKSTSQKEVIR
FT                   GGIRKMGQLFHAKNRIAKSLALKYLEKVSKHVEEVDTNILHMFYSTDPRISDLAVRYVC
FT                   VFSRFFKNNDIVFYHVYRTKSKYRRDALQALILQSPRYRAYEKDFGVGDLDLFENVRRN
FT                   APEEYFGRLALPKLVELSSMYPCLVRYFKFTRKFLGEELEKRDRYSQGVLHRLGKILGV
FT                   EERRETMWDEFLVCLAWMKHGRFDKSIRVLERLCSLEISKEYKIIFEVFIRKMSRRLDS
FT                   RDGTARKRAQITISSSFEIELCGLSQNSVYKMLFRLFKDGVKYVDSKSRKAKNV"
FT   gene            <55759..>56247
FT                   /locus_tag="Eint_040490"
FT   mRNA            <55759..>56247
FT                   /locus_tag="Eint_040490"
FT                   /product="hypothetical protein"
FT   CDS_pept        55759..56247
FT                   /codon_start=1
FT                   /gene_family="HOG000150278" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040490"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0550"
FT                   /db_xref="GOA:E0S6K4"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K4"
FT                   /protein_id="ADM11339.1"
FT                   /translation="MSIENKPFSFTYIIRNFHRIISKGKDGAAWSPCGREVIITDSAKF
FT                   QRFLEKLSRKKKGSKLDYLKRNGFIRGKTMNQKSVFSHPWFVRGQKDLLKNFTLKNSFC
FT                   WSQGIQMGSHGEPDDPLDSLKLGLFDLGRTLFNLRNSCLDLNSHIQLLFNMAKSKSCE"
FT   gene            <56306..>56956
FT                   /locus_tag="Eint_040500"
FT   mRNA            <56306..>56956
FT                   /locus_tag="Eint_040500"
FT                   /product="hypothetical protein"
FT   CDS_pept        56306..56956
FT                   /codon_start=1
FT                   /gene_family="HOG000150277" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040500"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0560"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K5"
FT                   /protein_id="ADM11340.1"
FT                   /translation="MKSRERVLEDIRNRLRTLLSSRKCIGMESIRDDFFFMITNPKIFD
FT                   ELVMEPVFSCNKYWEFKRLMYLCGYSHINRCMFMKGGEKEGRAPSILLKRPEEKDLLRF
FT                   EEALEDLRKKYLDLEEILDDVWDRLDNIDGALERSMGAIRDVFNKGAEVSGVDLQEING
FT                   LVDSLMKYDESESMDTFSEGATPEESDIEAFSSSSEEGHTKVLENKEKKISFF"
FT   gene            complement(<57002..>57958)
FT                   /locus_tag="Eint_040510"
FT   mRNA            complement(<57002..>57958)
FT                   /locus_tag="Eint_040510"
FT                   /product="UAA transporter protein"
FT   CDS_pept        complement(57002..57958)
FT                   /codon_start=1
FT                   /gene_family="HOG000150276" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040510"
FT                   /product="UAA transporter protein"
FT                   /note="similar to ECU04_0570"
FT                   /db_xref="GOA:E0S6K6"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K6"
FT                   /protein_id="ADM11341.1"
FT                   /translation="MGSLNKHVSLMLHVVGIYAFFLVFGIYGEKLTTTTYHGRRYESVL
FT                   FPLVLQSLGGIVIGRVMMSCKGVEGGLGRAILFHYAYLASLSLISAQLGFLSLRYISYP
FT                   TLIIAKSCKLLPIALMNFLIYRRTLTRRKYFSLCLISISVLSFSYFDGKNSSGSRLSLI
FT                   GILVLTTSLLADGIINSTQDHIFRKFQASSFHMMYYTNLFRFLISFTVILLTDNLRYSI
FT                   AFIKATPEVAPDLLLYSTFNIFGQIVIYSMIQSHGSLTLTKVNLTRKMFSILLSLIVFG
FT                   HKIKKIQALSILGVLGSIALEAFDTKTQKQTGEKKHL"
FT   gene            complement(<58360..>58887)
FT                   /locus_tag="Eint_040520"
FT   mRNA            complement(<58360..>58887)
FT                   /locus_tag="Eint_040520"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(58360..58887)
FT                   /codon_start=1
FT                   /gene_family="HOG000150275" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0590"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K7"
FT                   /protein_id="ADM11342.1"
FT                   /translation="MDAKINRNSKKIVKLLPKIGYRIPYQIIVECNFVSALNRYFLGLR
FT                   HINDLFKSQPKLFITKCVYKKLKEIGKDHKRGISKYLEILHCNHKEVRDPLSCLRRVMR
FT                   KSNKNHYILASNCPEITDLIGVERKIPAVTCKGGRLCISADLQKVPMYSEFRTEADENE
FT                   LNRLEALFSGES"
FT   gene            <59135..>60457
FT                   /locus_tag="Eint_040530"
FT   mRNA            <59135..>60457
FT                   /locus_tag="Eint_040530"
FT                   /product="lysyl-tRNA synthetase"
FT   CDS_pept        59135..60457
FT                   /codon_start=1
FT                   /gene_family="HOG000236577" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040530"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="similar to ECU04_0580"
FT                   /db_xref="GOA:E0S6K8"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K8"
FT                   /protein_id="ADM11343.1"
FT                   /translation="MSIRLHSRFCFFIISSCGESIQLVVDAKKEGSEQIIKFLKRGDIV
FT                   GFIGNVGRTRTLEPSVFATDVKVLTPCLRTIPTEHFGLKDPETIYRRRYMDLLINRESK
FT                   ERFEKRTQIIRYIRSFLDSRGFLEVETPMMNLIPGGAAAKPFITHHNELNLNLYMRVSP
FT                   ELYLKKLVVGGLDRVYEIGKQFRNEGIDLTHNPEFTSCEFYMAYGDYNDLMKMTEELMS
FT                   GIVQEMFGTDTIVYNPRKRGEEIKPVSLSFKRPFRVISIIEELNTRLGLDLSGETLDNE
FT                   ETLEKLLGVCEKEGIHVEKPRTLTRVLDKLIGHVIEPQCVNPTFIKDYPIAMSPLAKNH
FT                   RSKPGLTERFELFINCKEVCNAYTELNNPFEQRERFLQQAQDINAGDDEAMMNDEDFCT
FT                   ALEYGLPPTAGWGLGIDRFVMYLTNAANIRDVIFFPTMKPE"
FT   gene            <60613..>62373
FT                   /locus_tag="Eint_040540"
FT   mRNA            <60613..>62373
FT                   /locus_tag="Eint_040540"
FT                   /product="X-prolyl aminopeptidase 2"
FT   CDS_pept        60613..62373
FT                   /codon_start=1
FT                   /gene_family="HOG000255713" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040540"
FT                   /product="X-prolyl aminopeptidase 2"
FT                   /note="similar to ECU04_0600"
FT                   /db_xref="GOA:E0S6K9"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6K9"
FT                   /protein_id="ADM11344.1"
FT                   /translation="MLNLMEMYGVDGYLTLTSDEHLNEYIGEGDQRVRFLTGFSGSNGM
FT                   AVTCAYPALYTDSRYYIQAANESKKYKLKKMEEDERIEEYLEACKCKQIGICKKFMRSK
FT                   RYEDLKKRLESKGISLKPIDEDLVDILWKDKPKRTFNKVYSIEEERISKYKEELMELCQ
FT                   DPEDKNILEGKVLDRDVSVVGRTYKEKIEEIRSFLEVGQTMVFTELDTIAWMFNLRGSD
FT                   VSYNPVFYSYALLSKDSAKLFTNEGNIKMDGVEVYPYDDFSKHAAELEGDIIISGECNA
FT                   YIKDLFKNVQYCDKVRLLQSQKREVEIEGFRLSYMFDGMALVELFEWIDLSLDKGISEK
FT                   NIKEKLEEIKKRFSGYVQPSFESIVGGGPNGAIVHHKASDRPVSRDEVILIDSGSQYMF
FT                   GTTDTTRTLHFGNPKDEERKSYTRVLKGQLRSMRMKFPLSMNASVLDSMSRIDLWSEML
FT                   DYGHATGHGVGHFLCVHEHPPTISFGGEQTLKPGQVFSIEPGFYKEGEYGIRIENLVYL
FT                   KEINQKFYKIQNLTFVPYHLKLVDTAMMSQEEVDHLNRISEEIRLILKPLMKGRPGYRY
FT                   LMENTEPISK"
FT   gene            complement(<62491..>63231)
FT                   /locus_tag="Eint_040550"
FT   mRNA            complement(<62491..>63231)
FT                   /locus_tag="Eint_040550"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(62491..63231)
FT                   /codon_start=1
FT                   /gene_family="HOG000150274" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040550"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0610"
FT                   /db_xref="GOA:E0S6L0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L0"
FT                   /protein_id="ADM11345.1"
FT                   /translation="MDVRDGEPDFINSQAQERTNALKFLKALIIVEGFLKVLKIVTSFI
FT                   ILFLTRNEKCEVPLKLFLLVYMVITIAKFGIFMSKNLPFFRISRIPEYRENTDITLFSN
FT                   FIEALLLFWYLIGFNWIQECENCNVANPLLYYTTVVFVGLGFVAFIAPLLAIVLLLFLI
FT                   TFVKPKLQEVMYKDQNDVSDDTYHCAICFDNYIPGIKLKLLPCGHHFHQECIDEWLDLK
FT                   DTCPLCKRNINLLYDLIDPPEYDV"
FT   gene            complement(<63361..>64452)
FT                   /locus_tag="Eint_040560"
FT   mRNA            complement(<63361..>64452)
FT                   /locus_tag="Eint_040560"
FT                   /product="putative methyltransferase"
FT   CDS_pept        complement(63361..64452)
FT                   /codon_start=1
FT                   /gene_family="HOG000150273" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040560"
FT                   /product="putative methyltransferase"
FT                   /note="similar to ECU04_0620"
FT                   /db_xref="GOA:E0S6L1"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L1"
FT                   /protein_id="ADM11346.1"
FT                   /translation="MDFRNEVRSVLCLKALGTSEEEVPNCIQKIKESIRKIPRIPSVIR
FT                   TRKKYDTFKILTETDHDLLVLINEDFLSQEDVLIHIELELCYEYFTYSEALQRILPKEV
FT                   QTPSSFEIVGSIIHLNLDEEQMKYKNVIGQVVHDKTGRTVITKIGQISNEYRSFDLEVI
FT                   GGDPVLETIHREGDILFCIDYRNVYWCSKLQSERMILVKKFQVGDVVCDPFCGVGPVSL
FT                   AALKKGCRVYSNDLNSHAIECLRKSIKINKLDPKKIEIFNLPAAEFLEKMAGREVDHFF
FT                   LNLPEYSLDYLQKISAWGNKSLVHCYFFCKSNEDVIQYIFSRVGLRADPAMIKIVRKVS
FT                   PSKYMYKLEARCLSLQRGFEQSH"
FT   gene            complement(<64534..>65058)
FT                   /locus_tag="Eint_040570"
FT   mRNA            complement(<64534..>65058)
FT                   /locus_tag="Eint_040570"
FT                   /product="ubiquitin conjugating enzyme E2"
FT   CDS_pept        complement(64534..65058)
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040570"
FT                   /product="ubiquitin conjugating enzyme E2"
FT                   /note="similar to ECU04_0630"
FT                   /db_xref="GOA:E0S6L2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L2"
FT                   /protein_id="ADM11347.1"
FT                   /translation="MGKKGGFSRGLLLKDYKRIQENPNEYYSVGLVDGDIYTWEILIFG
FT                   PRMTPYENGIFKGRMLFPLDYPDSPPSFRFCSKMWHPNIDENGNVCISILHNPGEDEYG
FT                   YESLGDRWLPVRTPESVILSIITLLTSPNCESPANVDAAQHLRENEKEYKKKVMELAAI
FT                   TLDLYDKESSN"
FT   gene            <65242..>65712
FT                   /locus_tag="Eint_040580"
FT   mRNA            <65242..>65712
FT                   /locus_tag="Eint_040580"
FT                   /product="40S ribosomal protein S11"
FT   CDS_pept        65242..65712
FT                   /codon_start=1
FT                   /gene_family="HOG000231341" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040580"
FT                   /product="40S ribosomal protein S11"
FT                   /note="similar to ECU04_0640"
FT                   /db_xref="GOA:E0S6L3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L3"
FT                   /protein_id="ADM11348.1"
FT                   /translation="MEEVKKLKVFPRQTGVYLKPYAADGEQPERRVRAEVCGFKAPETA
FT                   YTRQYIDKKCPFTGDINVRGRTFKGIVKKMKAEKTIVVVVNYVHYSKKYKRYSRRHTNF
FT                   SVHMSPCFEGMINVGDTVICGETRPLSKTKSSVVLGYTKKATPGSFKLLESI"
FT   gene            <65801..>66154
FT                   /locus_tag="Eint_040590"
FT   mRNA            <65801..>66154
FT                   /locus_tag="Eint_040590"
FT                   /product="hypothetical Swi5-like protein"
FT   CDS_pept        65801..66154
FT                   /codon_start=1
FT                   /gene_family="HOG000150272" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040590"
FT                   /product="hypothetical Swi5-like protein"
FT                   /note="similar to ECU04_0650"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L4"
FT                   /protein_id="ADM11349.1"
FT                   /translation="MKLLNDWEKEEIIHKSKIVNFDFLEKKDFISEVKDGFYYLSKDIK
FT                   AVETELWKKANDELADHLDIKDIDKEIKRFIFLLNRYNEIKDIGQELIGRIASLRQTTA
FT                   RDIHEELGMETEL"
FT   gene            complement(<66175..>67062)
FT                   /locus_tag="Eint_040600"
FT   mRNA            complement(<66175..>67062)
FT                   /locus_tag="Eint_040600"
FT                   /product="putative lipase"
FT   CDS_pept        complement(66175..67062)
FT                   /codon_start=1
FT                   /gene_family="HOG000150271" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040600"
FT                   /product="putative lipase"
FT                   /note="similar to ECU04_0660"
FT                   /db_xref="GOA:E0S6L5"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L5"
FT                   /protein_id="ADM11350.1"
FT                   /translation="MLLYLLQTSLYDMDYRIWNTSHPSGDGAENSPKVNTALFQEHTLN
FT                   FLERIYLLEFIWMASNAYSSHDLDTVQARFGYDGDGLRAKVFRHDEKIVIAFKGTTLSV
FT                   MGMGIGKTSKKDKFLDKILYSICKSRRCEEEKRMEFGRIGYFDDALKIIDSVKEAYPES
FT                   RLVLTGHSLGGTIASLAGIRYGLPVMAFSSPGDAYMANILGLYTIGRAYDNIVHIGMCN
FT                   DVVFKGECNKPYSPCSILGYSIETKCHIGRSLCIKDGGKDSLAYHPIDVMKEKIMMPEE
FT                   IVLIEGSQNTDCIY"
FT   gene            <67132..>68040
FT                   /locus_tag="Eint_040610"
FT   mRNA            <67132..>68040
FT                   /locus_tag="Eint_040610"
FT                   /product="putative dolichol kinase"
FT   CDS_pept        67132..68040
FT                   /codon_start=1
FT                   /gene_family="HOG000150270" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040610"
FT                   /product="putative dolichol kinase"
FT                   /note="similar to ECU04_0670"
FT                   /db_xref="GOA:E0S6L6"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L6"
FT                   /protein_id="ADM11351.1"
FT                   /translation="MESVSPWIILLDIIDLAVGAIQLGTQKRMDGVLERFIVIVMLKCM
FT                   EREMQSRSPLIGARHLIACDSSKPLLTRGLECLGIVDLPRYISETLGEIKREPGAFAEI
FT                   MSISLACFVVQAFLFRSSSTNLKRKTFHVFAFLVFYKGHRLSFLLSEGFFLILGLLSPC
FT                   RHVNSLLTPYLSRHDREHSVLSHVYLLLACTYPRMFMRHKEYVSALISICFQDSMASVV
FT                   GEWFGKTEKSIQGAIGGVVSGIAIYFALYRKVDMVLFFIVAGIVEYLIPINDNIAIPLS
FT                   AISYSWLSKKIMSSIPSWAVV"
FT   gene            complement(<68006..>68716)
FT                   /locus_tag="Eint_040620"
FT   mRNA            complement(<68006..>68716)
FT                   /locus_tag="Eint_040620"
FT                   /product="RAS-related GTP-binding protein Rab11"
FT   CDS_pept        complement(68006..68716)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040620"
FT                   /product="RAS-related GTP-binding protein Rab11"
FT                   /note="similar to ECU04_0680"
FT                   /db_xref="GOA:E0S6L7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015595"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L7"
FT                   /protein_id="ADM11352.1"
FT                   /translation="MMECFGYGFRYSALISPICLFGMPGITKSENFDYLFKIVLIGDSA
FT                   VGKTNLLSKLTRNEFHKDSKATIGVEFGTITFKIGEDIVKAQIWDTAGQERYQAIVQAY
FT                   YRGTSGAAIVYDITNKDSLKKATSLWLKQLRDFSPSEIPIVLIGNKKDLEDDRDVDTQK
FT                   GKDEAVTNELSFFETSALTGENVREAFLELVKTIHKKVKTQKASIGKRKLKSVEFSKEN
FT                   LKEVKPQPKKGCCS"
FT   gene            <68736..>75857
FT                   /locus_tag="Eint_040630"
FT   mRNA            <68736..>75857
FT                   /locus_tag="Eint_040630"
FT                   /product="vacuolar protein sorting-associated protein"
FT   CDS_pept        68736..75857
FT                   /codon_start=1
FT                   /gene_family="HOG000149480" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040630"
FT                   /product="vacuolar protein sorting-associated protein"
FT                   /note="similar to ECU04_0690"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L8"
FT                   /protein_id="ADM11353.1"
FT                   /translation="MGSLFGSPMLKKILLRALNKFLGNYVENIDKHQFELGIFKGYVSV
FT                   SNLRIKSSVISRLFEGRVVSNSIGTLRVLVPWKSFSRKPIEIYVKDVDIKLGKAGFCWC
FT                   FLDEKLCTECVEYEKYEFMTKLDKLSVLSDAREDNSTLFKDLIAGDGFRVLIENVNVEY
FT                   VSGASIALRVQKVEFNKKTKGEVKNMKIFDAVGIEVVGASKVLGPFDIYSKIKMLPKDI
FT                   NPRIEVSLNDFHVEVKQQIAEEILRGAREYAEDRVRWTLFRSYLEYREILRTAREMNLW
FT                   KDQEDPASSDRSVAMEIWKRLIRLQKKAMESKGVVLEEIPGIISKIKEYREILGRSGLS
FT                   FKEVERKKRCEREICLERLLKVKRSLSEVSEKKSWKNILSFMKEEANNKRTSMIIPATF
FT                   SVGEATVVIIDEKHQGFKIVVPKTRVGVKDLLSPSRLDFKGDKWRLYFIDARLNERDPH
FT                   SELISLLLDVRGTLIQDGAGLYVKGIAKEWKVLGYRRELPHCFEGFMRLVKRSYVPSYG
FT                   LAAPRGKTRADFKVDIVSMESDLERFVKIEPSSRYGIECAGMVLSYVNDEINTKRAASL
FT                   TISSSFVYRVNSVSKEREALSNKIETTVLLVDNVFYVKTSMVDLYAHGVYPNDFRGNGV
FT                   VFPVGFVVPNFEVCSDAIRINGPDGRAELQRIKMSGNGGSIFDMEIFKGKVLDSNGKTM
FT                   CRIPRMKIEARIGRALLLDVVYLKICGRARRIARLARGMTWMANGEVSTKVIARIKRIE
FT                   GDIRCKGSILRIIVDEYFQGLAKSVRAVLNESIINIENFEAGEEFGWKSAVLTIRKEDL
FT                   KNLDGFGRIFKKIGSRSSAFKASAGGLVIKLLNGGEIEIESLRIFRDEGGMIIYPFEVK
FT                   VFNTGDSSTSADSRKREVEMCISKIEISDTKATIEGSIKGEINEETLIKIKDGIKEIPI
FT                   PSGGSLETVVLLDISLSMVISGNPLKIACPLTLWQKADEYEITLQQIEIASGDGQNTNL
FT                   FEVHAKGADGVLRLSVSKMEIHIEPFRLASILYPLVHGTGDTDFVKKVEVDIEEIFAKT
FT                   KSIDGIRMRNVRYRDELLLQFSVLDEPGSKVAYKRVNGSESYLLSVIGGSYELSSLAAL
FT                   VSFCSSEYMQIYSKFGIQVSRARLHVLCMDLKVLLGDALFALRINLPIVYFDMEDLNSF
FT                   KGRALCSLDVYDSNSMEFIPFIEENVLLARKYGTFLDVRTLTKLRILYLDEITSTIWSL
FT                   FASEETGITMFGKPFRNKVSIRNITDTVLWVKTKRYAGRVGKGQFHEFDVDYDEHRIQI
FT                   GKDEACALVYIVNSCSTSFVSEGKSFVIEVTYDGKLRGITITHVLSFLNLCDIELMGKM
FT                   DYLDGSALELHMLPEFHHTIPQEKDFFLEIGMHGKYVSAGKINVSSAPKDATSTFGMIC
FT                   KLGLVEIGIDTVVRNAGSVSCVVIILYPIFEVMNRTASVLNLILSVGKDNTPGGESETQ
FT                   KKNIPLSVDRDCKEDIYGISFSELPLLYVQSLGSRATARAFENKASIEINSHYSGEIRK
FT                   EQAEIISFFGRHTLAHRIRMVIYSPMVIINHLGNDIWINGARFGPGPSCSNRLKDIHSL
FT                   AVGEYSIEESVEVGKKFTKAFILKKRGFKGHKTWKSHEGQEWSNEAIFGGFGPKTGIQP
FT                   SCIRLLLEFGEDQGRRIIECKYTYLIRNQSQMRLLAVSEHVCYYVEPHEEVPLNTSTNG
FT                   FYLFIADSVNIRSPRLSGVFIPLDIKIRKYFKLQGSDAILFSVSKVTDSGQHVFGIRTE
FT                   KYWPYTIHNGIDVGLRFSQKYDTIEHYVEKGSVYRYAPDSLMLDPEILLCIEDQIIQVN
FT                   LNEDQVLLVHGITVSISQGSTTRVVRVSRGEISSSECRICLGIVIDSLSISLVNKEGNE
FT                   VLCSHIEGLEIGAECISREAGIPELMAHPKYVEFVIQGTAESIQVDNQSLFCAFPVVFH
FT                   PLDKYLRIETERRNRKKLLVFDFTFGSSAQNVSVSNLYFKTEAFALNIEENLAKSIREM
FT                   FLRKKEREVKSYEKNLRIQNLKMERMGAKVNFLKDIESGFVSNVVGLFINNISDFSLEI
FT                   DGMKETCLYTTFQELEDLLASFYLSQLQKNLYKVLTHLDFMGNIGSFTESVSIGIKDLL
FT                   TEPSLNSNVACGIFKGGKSFLKNTIYGVSNTVGKFSKSIGTSAKFIGCSADPKHEKFRH
FT                   SYARDMHLLIPRARHSKGPMTSILKGTGNLFDSITRGMVGIATSPVEGASNGVAGVVKG
FT                   LGKGVLGAFAGPIAEVADLVTNISDTIKTSMNGRVKRIQYPRPAGFLGWYDEGLSQGFY
FT                   IFMSMAGKVHEEERFVDGTFGDFNGRCQLVLTTRRLLISDTTTILDVCLGSIVVEGDDR
FT                   KLKIGEFIMSIERPSFVASVKSIIERC"
FT   gene            complement(<75944..>76849)
FT                   /locus_tag="Eint_040640"
FT   mRNA            complement(<75944..>76849)
FT                   /locus_tag="Eint_040640"
FT                   /product="Ser/Thr protein phosphatase 2A"
FT   CDS_pept        complement(75944..76849)
FT                   /codon_start=1
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040640"
FT                   /product="Ser/Thr protein phosphatase 2A"
FT                   /note="similar to ECU04_0700"
FT                   /db_xref="GOA:E0S6L9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6L9"
FT                   /protein_id="ADM11354.1"
FT                   /translation="MIESYLEKLFKCNLLTEAEVKDLCEKATEMLMKEENVVSVKAPVT
FT                   ICGDVHGQFYDLMELFKVGGLPPYTNYLFMGDYVDRGYHSVETISILLCLKVKYPDRVW
FT                   LLRGNHESRQITQVYGFYDECVRKYGTSLVWRYFTDLFDFLPVAAVVGNDTFCCHGGLS
FT                   PSFDTLDQLKAIDRKVEIPHEGPMCDLLWSDPDEKLGWGPSPRGAGFTFGKDITDAFNE
FT                   RNGLKMICRAHQLVMNGFNWSHEKGCVTIFSAPNYCYRCGNLATLMEMDEYGTYSFTQF
FT                   EPSPTKIETLVSTRIPDYFL"
FT   gene            <77104..>77901
FT                   /locus_tag="Eint_040650"
FT   mRNA            <77104..>77901
FT                   /locus_tag="Eint_040650"
FT                   /product="M phase inducer phosphatase"
FT   CDS_pept        77104..77901
FT                   /codon_start=1
FT                   /gene_family="HOG000150268" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040650"
FT                   /product="M phase inducer phosphatase"
FT                   /note="similar to ECU04_0710"
FT                   /db_xref="GOA:E0S6M0"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M0"
FT                   /protein_id="ADM11355.1"
FT                   /translation="MTNSSAFTSSDNEQYSTAVDKMHIKPFYEILWSSSDNIELEDLGN
FT                   DPFVDNSVFDSIGISHLRPSGKEGKCKEKGMWTSLHGVRNQNRASPAPVAGRHLIDFWK
FT                   DFSNGEVFSLPTLGPGKSDSIQRISVDVAKQVVEGMYNIDYLVIDCRFPYEYQGGHIRN
FT                   AVNISSARELGILFRKPKVLIFHCEFSSIRAPKLAQYLRNMDRMKNPYPLLTIPEVYVM
FT                   EGGYRKFYSKYPSLCDPKGYITMGSLGYRDLYKKNKFRSNKRY"
FT   gene            <78430..>78894
FT                   /locus_tag="Eint_040660"
FT   mRNA            <78430..>78894
FT                   /locus_tag="Eint_040660"
FT                   /product="type 2 peptidyl-tRNA hydrolase"
FT   CDS_pept        78430..78894
FT                   /codon_start=1
FT                   /gene_family="HOG000150267" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040660"
FT                   /product="type 2 peptidyl-tRNA hydrolase"
FT                   /note="similar to ECU04_0720"
FT                   /db_xref="GOA:E0S6M1"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M1"
FT                   /protein_id="ADM11356.1"
FT                   /translation="MEIPVEIASNFWKIAFFLLVLYVVLEKRPRIRTKKPVEKGEYGMN
FT                   IIINKDYNMTKGKVISQICHGMASVMEHLFRNKELFLEWKRNQEPKIVLKASGGEIEEI
FT                   IRLAKKNGVYYHKIHDAGRTQVPSGANTVLMLGPALRYKLLSISGHLKLY"
FT   gene            <79087..>79611
FT                   /locus_tag="Eint_040670"
FT   mRNA            <79087..>79611
FT                   /locus_tag="Eint_040670"
FT                   /product="hypothetical protein"
FT   CDS_pept        79087..79611
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040670"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M2"
FT                   /protein_id="ADM11357.1"
FT                   /translation="MNSKMFLVVIIFWIFQVVEVGVIDALEHAFVNAKVYQVHNFPDIL
FT                   GMDYNKDIRYINFYAFLSGVICTWILVFPLTIKLVILAVFGTEDDSEKVGDYFLWFHLA
FT                   LLLLLTFADILILWTCDRDTLRAQATDAYGLYYIYRNHKLFYLSHLVAEIVSLVGVVFY
FT                   GCLFKDIYLAG"
FT   gene            complement(<79657..>80337)
FT                   /locus_tag="Eint_040680"
FT   mRNA            complement(<79657..>80337)
FT                   /locus_tag="Eint_040680"
FT                   /product="6-phosphogluconolactonase/glucosamine-6-phosphate
FT                   isomerase/deaminase"
FT   CDS_pept        complement(79657..80337)
FT                   /codon_start=1
FT                   /gene_family="HOG000150266" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040680"
FT                   /product="6-phosphogluconolactonase/glucosamine-6-phosphate
FT                   isomerase/deaminase"
FT                   /note="similar to ECU04_0730"
FT                   /db_xref="GOA:E0S6M3"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M3"
FT                   /protein_id="ADM11358.1"
FT                   /translation="MLRKVRKNKIWVFSKQPLILFLDLCPISLKPLMDVLFTEDFSTEI
FT                   YRILKEYSGRSLALMISGGSLLQCLEDKRYLTMDTSGWRIFYSDERADQNHLNYTGSIG
FT                   FISKTNADVHRIWTSRPLDEAAKMYSAELPDIDVCLLGIGGDGHICSLPPGCKELESDD
FT                   YVVALEGDFPISPRRVTVTPKFINEKIRDLYFVVPSSRKKGVSAPDRSITEKIERSFMV
FT                   ILEK"
FT   gene            complement(<80312..>80650)
FT                   /locus_tag="Eint_040690"
FT   mRNA            complement(<80312..>80650)
FT                   /locus_tag="Eint_040690"
FT                   /product="60S ribosomal protein L22"
FT   CDS_pept        complement(80312..80650)
FT                   /codon_start=1
FT                   /gene_family="HOG000149479" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040690"
FT                   /product="60S ribosomal protein L22"
FT                   /note="similar to ECU04_0740"
FT                   /db_xref="GOA:E0S6M4"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M4"
FT                   /protein_id="ADM11359.1"
FT                   /translation="MATASEKTTRKFTVDCTKPASDSLVSPSDLGAFLQQKIKCHMGKK
FT                   EKLLQIEVSGNIVEVNVTGGFIPKRGIKWQIARFLHMKKLRAFIKIFAQGPDGFELKYI
FT                   NVEEGKEE"
FT   gene            complement(<80710..>81999)
FT                   /locus_tag="Eint_040700"
FT   mRNA            complement(<80710..>81999)
FT                   /locus_tag="Eint_040700"
FT                   /product="seryl-tRNA synthetase"
FT   CDS_pept        complement(80710..81999)
FT                   /codon_start=1
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040700"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="similar to ECU04_0750"
FT                   /db_xref="GOA:E0S6M5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M5"
FT                   /protein_id="ADM11360.1"
FT                   /translation="MIDIGLIRDEKSREKVVESEKKRFRDGTGVERAYELDRRKIETNF
FT                   RLDQINTRVNQLDREIKSGYKQGKNKEDADLGEKVKEMKDIQGEAKRLKEDVKVIEDEL
FT                   SKVMKGIGNIISPKVVVSNDEKDNEIIRSYRSGRSIKKDPKPFCVLMKDFTHPEAGAKV
FT                   VGHRGYYLSGKMARLAQALSRYAIDFLENKGYVYIQTPVMLKRDVMGKTSQLSDFDDQL
FT                   YKVEDDLYLVATSEQSLAALYMDERIVPQETPKKFCGQSLCFRKEAGAHGKDNAGLFRV
FT                   HQFEKIEQFVICSPEESERHHEEMIKICEEFYQSLDISYNVVSIVSGELNDAAVMKYDL
FT                   EAYFPNAEKYRELVSCSNCTDYQSRELEIRYGIAKENNRKVYVHLLNGTMCAIQRTLCC
FT                   IVENYQNERGISIPDVLQGYFGGDSIELGL"
FT   gene            complement(<82053..>88031)
FT                   /locus_tag="Eint_040710"
FT   mRNA            complement(<82053..>88031)
FT                   /locus_tag="Eint_040710"
FT                   /product="U5 snRNP pre-mRNA splicing factor Prp8"
FT   CDS_pept        complement(82053..88031)
FT                   /codon_start=1
FT                   /gene_family="HOG000150265" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040710"
FT                   /product="U5 snRNP pre-mRNA splicing factor Prp8"
FT                   /note="similar to ECU04_0760"
FT                   /db_xref="GOA:E0S6M6"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M6"
FT                   /protein_id="ADM11361.1"
FT                   /translation="MPSSVRKERMPPEHLRRIIRTSKDMHPSFMGAMRYMPYALHNLVR
FT                   SMPMPWESIRYVDVVYHVSGLVTFVTEKRRVDVEEYKNRWSHASMLFSSEERKRGLVRV
FT                   LRYPVFDDDEPVVDYGSIIGLPVPTAIGSQDNIKWKEDFRDVDEGYLFNCKAFLISRHV
FT                   GVQLENGPYVTERSGNDVNIMEREPGLERIAYPYLYNRSTRVQVLEKTHLDAISPFRRE
FT                   KREDGRRKKERHPADIPLLKGECLRERTDEGPKVRNLLRNYARITEKKTKKRPPSHILK
FT                   KLKNTRYFQRTEIDWVEAGLQLVYQGHRMLSEVLRRKKLSYLILDWNFNLKPIRQLTTK
FT                   ERKKSRVGTSYHLTREMLKLVKHLVDIHVLFRQGNIDGYELMANVDHVLNNVGVLTGIY
FT                   RYKYKLMKQIKQCKSWKRLSDYIGFKGWGEQWRTWCFMFRGHIPLLGRYISGLVTRIAE
FT                   GRDYNPKPLSKQRSESGYDVALKRQIMAEVSSVLHPTQVRRLLQHFSEAWRCWKANVPY
FT                   HIVHEHIKELGIRRSASLSLEQEGLKGTSETTIVNLEAIRPMVDTLQEGEGNTTISSKQ
FT                   SVVTFSDNFVLNIQEQGKMAGVKHQKELFELQGIIDRYVRLRSGWYIESAINGGEKSKK
FT                   GEKKRLGKITRLYMKERMAEQAEYLSQPFLKAAEAVAIYKLSAEYFRSKGTGKILFPEK
FT                   NEEKFLSIAVDRLKKNATAEECEFFDKALEDSADTIFKIKKSLLTQRSFKEVSVTLKRY
FT                   GSGGIEYYHVSYMERLVDAFLCAYLFYESERLNIFPEFIKPGDEMDLKALMDLCEKISS
FT                   FSGVDGERVVLYEGKYSGIMKMIDNNLLSKLLKLVLDPTLADYIISRNNCLVFYKDMRY
FT                   TNHVGFIKGFQLSAFVYKFYSFIIDLCVLGEDVFMDEKSSIKLYFRHMDDVYILFKLKK
FT                   EEESALLSDYGKGTEWFEDVMKDRRGNYFDGICGNLYDEETEEFDSSNGRERLKLLEKC
FT                   VHAEVATRLLPSLGRIRFRGCSIFPGVKFSMGGIDVMISSKKIHERSSWKLENGMYANL
FT                   AVSDKSVEMFESNIMHIVNTSGSATFLKVATRWNTQILSFTMYYRECICDTQGLEERLR
FT                   KAECMIQNVVKKGINSKMPVRFPPVMFYAPKEMGGLGMLSAGGVRLFQEDVSDMEEEKH
FT                   KTIPGILDYTSRWDDEFSESSRVWTEYGRSGKIEPEKGIPRMSTLLQRSRWLLYDRGFR
FT                   IISMFKKYSSNPEWFWFTDARHDGKLWSMEGFTADVLKVLGGLEGIADHTLFGATYFRS
FT                   FSKVFWEDSVAGGYRRLTNAQKMGLSQVPNRRFILWWSPTINRGNVYVGYQVQLDQTGV
FT                   FMHGKLPTLKISFVQIFRNHLWKRIHESVVKDLCDMFKKYCDTKRLEVHGKKSYRFGSS
FT                   CADILLSGDFYVQSPMCISEETEGDGERCDGLWIDVQLRWGDYDKRNSRKYARVRFAEC
FT                   VRDPQTRYPVQNGFIIVLDLCYNTWSAYGNLNGELNTVIRDSMEKILMENSMLHVLRER
FT                   LRKALQLYTSDVEVVNNSGEMFNSGLLVDVKALLKKEKMLFIFDPGSGNLYFKSYSGES
FT                   KKIRQIRFLAAQDIFLMGEELKKRSVVVSEDMVDAMENFSIDHPSISVKTCLSIPPFSN
FT                   LVKLKGFEKEKCVRSINLYEKWRETSRFTNFCRLLLVVHGMDVDETRVKDLGINEIWPE
FT                   ISDSEWIKKEIELKDLIVESYCTIYGIEPSSLSQNEIRDIVFGFKAGLGREEEGKVIDT
FT                   EIKNSKMVFNRPGHVSFGGSDGWRSRYVKLDRMSKSGDLERWILEMLEKGNCKTEFLDQ
FT                   VDERKILKIPLNLVRKFMEIMDPHVLVFGLVVGGDPISFGLVPQFSSLSVIHSSLFTPE
FT                   SNIVGVVMNGNNLQTVDLLHERYKIIDGLAILIDDRIKVMKKEECGWKEMEFVLTGDMG
FT                   VFLIPEMWNYNFARPFYDDSLKYTWRIGAPQGFYDGSCRVGHFSKFWKDRDREEEWEEN
FT                   "
FT   gene            <88122..>89159
FT                   /locus_tag="Eint_040720"
FT   mRNA            <88122..>89159
FT                   /locus_tag="Eint_040720"
FT                   /product="hypothetical protein"
FT   CDS_pept        88122..89159
FT                   /codon_start=1
FT                   /gene_family="HOG000150264" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040720"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0770"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M7"
FT                   /protein_id="ADM11362.1"
FT                   /translation="MEARSLSTTTEKLVVSRAIDIYGVADEDSVTKYITAMYGYIHPNR
FT                   WKTIYQEVLDTCAKHGYSSPVDFCEDLRLDVARKMYMEKALLYNRLLEGEEVEWPEQHM
FT                   EHDWNIGDIEKIDELSKGSEDILDKRLLYPTVDPRIIKQHVEAMSKWQSRAEESRNGVG
FT                   KAEEKKKEYGIEDKERRRFYHRMSNEEKELDDFLDRIEEEHYNMPQSGVAPNRLREKYP
FT                   ILKASPIGSGYPGFRMEGSDVSLENQYRAVVKKILGKTMHGSNDRQWRQELRIIVQYHM
FT                   RRIGMVNEIEKVNALIDSSTMSHTLMNILMLLQELVERPRNQELVQDYLFFKKDILMFG
FT                   NYYRK"
FT   gene            complement(<89234..>89980)
FT                   /locus_tag="Eint_040730"
FT   mRNA            complement(<89234..>89980)
FT                   /locus_tag="Eint_040730"
FT                   /product="eukaryotic translation initiation factor 6"
FT   CDS_pept        complement(89234..89980)
FT                   /codon_start=1
FT                   /gene_family="HOG000230605" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040730"
FT                   /product="eukaryotic translation initiation factor 6"
FT                   /note="similar to ECU04_0780"
FT                   /db_xref="GOA:E0S6M8"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M8"
FT                   /protein_id="ADM11363.1"
FT                   /translation="MKNSQGPMSYRIDFEGSSEIGAYISLTNTYCVVGRSQSNNVLKFL
FT                   QETVAIPIVETTINSIRSVGSQCRGNRHGLLVPHTITDQEIMHIRNTLPENVVVRRIEE
FT                   RLNALGNVVLCNDHVAIIHGDLDGESEDIIKDVLQVPVYRHNIGQEPLVGTFGALNNQG
FT                   MLVHPLTSQECQKELSELLEVNVIAGTVNGGSPCIGGGVAINDWMCVAGVKTTNVEMTV
FT                   IESVFDLSGDQDLEARRRAIVDTIVK"
FT   gene            complement(<90022..>90267)
FT                   /locus_tag="Eint_040740"
FT   mRNA            complement(<90022..>90267)
FT                   /locus_tag="Eint_040740"
FT                   /product="small nuclear ribonucleoprotein F"
FT   CDS_pept        complement(90022..90267)
FT                   /codon_start=1
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040740"
FT                   /product="small nuclear ribonucleoprotein F"
FT                   /note="similar to ECU04_0790"
FT                   /db_xref="GOA:E0S6M9"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6M9"
FT                   /protein_id="ADM11364.1"
FT                   /translation="MEESYGGKPSRENPKQFLHRIRDKNVSVTLKWGQVYEGVLVTSDN
FT                   YFNILLDKCIEKDGESEAMVGEVTIRCNNIKSIAES"
FT   gene            complement(<90366..>90935)
FT                   /locus_tag="Eint_040750"
FT   mRNA            complement(<90366..>90935)
FT                   /locus_tag="Eint_040750"
FT                   /product="putative vesicle transport V-snare protein"
FT   CDS_pept        complement(90366..90935)
FT                   /codon_start=1
FT                   /gene_family="HOG000149478" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040750"
FT                   /product="putative vesicle transport V-snare protein"
FT                   /note="similar to ECU04_0800"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N0"
FT                   /protein_id="ADM11365.1"
FT                   /translation="MLFFWIVSFAMCSRIQKILRPGDKEVYWAILDSKDVELTIQLNQY
FT                   SDALVYYKIIKPGEVDDDSEFKEELIESVNAKYTTPGAYRIEVFNDGFEKASISIYTDV
FT                   MSSGDVDNDNLAIKNLFLDLEAKLMSLYRTNTRLKTIQENNIAEAKRIRNGLYIMFAIP
FT                   IMYVIIGLAKLHTTKAMFAPKKGSRI"
FT   gene            <90998..>91552
FT                   /locus_tag="Eint_040760"
FT   mRNA            <90998..>91552
FT                   /locus_tag="Eint_040760"
FT                   /product="recoverin-like calcium-binding protein"
FT   CDS_pept        90998..91552
FT                   /codon_start=1
FT                   /gene_family="HOG000149477" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040760"
FT                   /product="recoverin-like calcium-binding protein"
FT                   /note="similar to ECU04_0810"
FT                   /db_xref="GOA:E0S6N1"
FT                   /db_xref="InterPro:IPR001125"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N1"
FT                   /protein_id="ADM11366.1"
FT                   /translation="MGSGASTIPGDTEEDARQFSHFPSKDIQEWSSSFRSEYPGGLMTP
FT                   KDLEEIFRSFFPFGSPTNFSRRLFETINIGQTTAIDFHELLIAYSILIKGSDHEKLRWI
FT                   FRFYDKDNDGLVSKEEMVEVVQYLADMTSHTLDVSIDSEGIVEEIFTSVGGSKSFLTFE
FT                   DFKALSTKNEKLFKMLTPFSE"
FT   gene            complement(<91618..>92856)
FT                   /locus_tag="Eint_040770"
FT   mRNA            complement(<91618..>92856)
FT                   /locus_tag="Eint_040770"
FT                   /product="Nop5-like nucleolar protein"
FT   CDS_pept        complement(91618..92856)
FT                   /codon_start=1
FT                   /gene_family="HOG000196310" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040770"
FT                   /product="Nop5-like nucleolar protein"
FT                   /note="similar to ECU04_0820"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N2"
FT                   /protein_id="ADM11367.1"
FT                   /translation="MIYLVETVVGYGLFDKTDLSEEPRLVETYKFESIDEALESSGLLI
FT                   KGEVPSNLERFMKLAEVKDKEVLAVDDQKLVEPLSKKFLRKVVYLNDDVQRLIRSNVHK
FT                   YFGMSGREYSERILCIAHKISMEKVKIVPEKIDTMVIQSVSLLEDMDRDINLHCMRLKE
FT                   WYGFHFPELSSVTDNNRKYLRLVVAIGRKESIEEKKEELKEIAKDEWERIVSLAKTSMG
FT                   IAMDSSDVLNILEDAKSVLKSFEFRDELVEYIRVKMEDLAPNITSLIGEVIGAKMISKA
FT                   GSLSNLAKMPGSSIQIMGAEKALFQALKSKTNTPKYGMIYGCSLLGQVDSQHKGKIARS
FT                   LASKIAIAARIDSYGEKVTNEAGIRMQEAIKRRIKDLEARSRSEKKPVKKLKYEVKPDF
FT                   YDDSKDSKKIKLK"
FT   gene            complement(<92905..>93744)
FT                   /locus_tag="Eint_040780"
FT   mRNA            complement(<92905..>93744)
FT                   /locus_tag="Eint_040780"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(92905..93744)
FT                   /codon_start=1
FT                   /gene_family="HOG000150263" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040780"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0830"
FT                   /db_xref="GOA:E0S6N3"
FT                   /db_xref="InterPro:IPR008728"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N3"
FT                   /protein_id="ADM11368.1"
FT                   /translation="MESFVKSTGYKRIEHLSTGISGFDTVLGECFTRGTSILLLEDENS
FT                   QIHSTILKVFLSEGASNQENMMAVMKEGRNVEIYGTGSFTEKEDEDKMVIAWRYTKLSL
FT                   ARPLFKFNLSKKRRFEGILLSGEDATLKSILDIARKEKELRIAIFSLGSPVWKLSGLGE
FT                   EEMAKFLFELKRAVRANGHVCMVSIPGFFMANTSLSLYFDTVGMFDSNMFSCFCPNYNG
FT                   VLELRKIGGYGSLRVNTLGSLKYGVKIRKENISMEKIDMPPEDIKADSRACDMDKSF"
FT   gene            <93826..>95250
FT                   /locus_tag="Eint_040790"
FT   mRNA            <93826..>95250
FT                   /locus_tag="Eint_040790"
FT                   /product="asparagine synthetase-like protein"
FT   CDS_pept        93826..95250
FT                   /codon_start=1
FT                   /gene_family="HOG000150262" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040790"
FT                   /product="asparagine synthetase-like protein"
FT                   /note="similar to ECU04_0840"
FT                   /db_xref="GOA:E0S6N4"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N4"
FT                   /protein_id="ADM11369.1"
FT                   /translation="MCGILLSEEENTAYERVASLIRNRGGDYYNKVYIDGMVAIASVLS
FT                   IRDSVCQPVEGNGYLFLYNGEIYNNERSDTLSIKNIIDKVLCESGKAVLDGRCIVDKIY
FT                   AEINRHENEMAMILMIGSHVYFFKDDIGRRSLGYTLDPFCVSSVEYDEEINPMAIYSYD
FT                   RSTRKLSEWLKDSQIVKRYMTMGDAILKRLSNEKYSKKYRYLAKHLSLQNVGNHEAKLE
FT                   DVDSAVEEFNKIFRRSIERRISGGNICVFFSGGVDSMLVAVFLHYAADLRQKIYLINTS
FT                   FGKSWDREAGKKGFESLCTMFKERSFVFVANNIGVEEVRAAKEHIYRLIHPKDGRMDFN
FT                   IGATLFFSAKESRKYSRIAYLGSGADEMFGGYHRYRGEGFREEMLFDLFTISHHNLCRD
FT                   DRAVSDCQVECRFPFLDSELVGYSLKIGNNVVAMDGEKKFILRETLRRNGLECVSGVPK
FT                   KAMQYGSGIFKMEGKI"
FT   gene            complement(<95286..>97631)
FT                   /locus_tag="Eint_040800"
FT   mRNA            complement(<95286..>97631)
FT                   /locus_tag="Eint_040800"
FT                   /product="DNA replication licensing factor Mcm2"
FT   CDS_pept        complement(95286..97631)
FT                   /codon_start=1
FT                   /gene_family="HOG000224124" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040800"
FT                   /product="DNA replication licensing factor Mcm2"
FT                   /note="similar to ECU04_0850"
FT                   /db_xref="GOA:E0S6N5"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N5"
FT                   /protein_id="ADM11370.1"
FT                   /translation="MVKRRLEEDESTSGEGREVGMRMVKELESSEIDEIKEELYESSEL
FT                   EESEVMQHSDIEDLIGQEISSMKSEENKARREGDSGNEYDAEDIFKADEITKDFFEQGF
FT                   FRVKLTRKFVRFFNEFRNKKYIGRIRKMCSENLESIEVSYLDIEEESTDLLKLLNQHAE
FT                   MTIEVMDQALSEVVRMHFPNYHLIKPKVHARVVDLPVSDSIRSLRNSHLGKLVRVNGVV
FT                   TRRSGVFPLYSIVKFSCLKCKSVFGPFVASSFKPTHCFECQSKGPFTVSTSETIYKDFQ
FT                   KLTIQEIPGSVPPGSLPRSKEVLLFYDLIDCAKPGEEVEIVGIYKNNFNVSLNIKNGFP
FT                   VFFTVIEASSVSKRVGKIEMTEDDIREIRKMGRHPEIKKIIINSIAPSVYGHEEVKRAI
FT                   ALAMLGGVPKESTSHRIRGDINVLLLGDPGMAKSQFLRYVENTSHRAVLATGQGASSVG
FT                   LTASVRKDPVVKEWTLEGGALVLADKGVCLIDEFDKMNEHDRTSIHEAMEQQSISISKA
FT                   GIVATLHARCSVIAAANPIRGRYNGSLTFSQNVNLSDPIISRFDILCVTKDNIDSGEDE
FT                   KTARFIIESHGGGEKTDGFDSKKMMMGQDLLKKYILYARTNVVPVFNDVDIEKISSLYL
FT                   ELRKESLPSGLPVTVRHVESIVRISEAFAKMRLSTAVSAEDIDEAISVVLDSFMGAQKY
FT                   SMSKSLRKKFIKYFNRSNTDVLIFLLKEMFNEKMKAFHSQSVSLDEFERRISSFGFSIP
FT                   SSFYSCGLFKNSGFKLDRGTRLISRNAC"
FT   gene            complement(<97714..>98520)
FT                   /locus_tag="Eint_040810"
FT   mRNA            complement(<97714..>98520)
FT                   /locus_tag="Eint_040810"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(97714..98520)
FT                   /codon_start=1
FT                   /gene_family="HOG000150261" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040810"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0860"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N6"
FT                   /protein_id="ADM11371.1"
FT                   /translation="MKLSLTEQEEVMKEFSDPVEFIREYVDVYEKQRNVPVKVYLEDIS
FT                   YYERFEPIFLDLVIGRALSEGSSDLNLPEVEELLHEFCKKEFYDERFYLECTLVLIKGI
FT                   AILIDRVDQEVQRQNFNNLRYLYYYTTEPIDLTRMLVDPYTRYIEDPQILVSRMAELRR
FT                   TVEFVNKQVKGVGSSFLAKDSRLKDRMNLSEGILGQKRIDDYKIEDVYGSIFDLLMVKA
FT                   TGMEVELGYVYIMGFCSEFLVSELGDEESILRLKEYANSLLSKKEA"
FT   gene            <98607..>100664
FT                   /locus_tag="Eint_040820"
FT   mRNA            <98607..>100664
FT                   /locus_tag="Eint_040820"
FT                   /product="cohesin"
FT   CDS_pept        98607..100664
FT                   /codon_start=1
FT                   /gene_family="HOG000150260" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040820"
FT                   /product="cohesin"
FT                   /note="similar to ECU04_0870"
FT                   /db_xref="GOA:E0S6N7"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020839"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N7"
FT                   /protein_id="ADM11372.1"
FT                   /translation="MEKENIPDRTTASNMGDASISPSLLEPSEPGCCPFDVFTPEALVS
FT                   RFKTYDDCTEDIIKLIRSVHVCQNKIKKLCRVFDSLSNYDTGLIVNLTRDGNRMLRYVS
FT                   TYLMLNKIKQWVIDGRGFEVVEAMYDEVFLVRFRDVDFNIRAACVEFMCEWIISAPGIF
FT                   NLPCYLKYIGWALSDKNDSVRRKGISSCTRLVRKKINVQGFVSRFKSRIIELSLYDRSP
FT                   ALRDEGKALCMELYIGGMVSKDDVYKVLRSMNEGDKKGLMSSTIRKILGTEEPSDRSLL
FT                   ENHEGLHELLSNTSLFICSCIPHSGKDVEGFIDFILDFLRTKNSCCQSKSLCYLRILGV
FT                   LSGSGVDVEKYHRIFEIVKDSRENTAQTVEAISKVDPEVFRRHPDATNRLLEAMKDLLA
FT                   QYKCEEMFSRFVHLLKKLEKDFPAFVHRVVESLKSSCVEFVHCAIKSFDISESVENNFP
FT                   SEIKCYAALWKIMSEDYERVNGYEFKKIGNLSVLCDFLLFFREKCIEFGVVNRSVERAS
FT                   DQGECFKIMYDRLSVLIHSQAEDVFTDQKGCISLFKLVDGGLFVDYSSIIFRTCNLELI
FT                   SEFLGKSKSKMNLVSGYFRYLMDVEEKDVDKKVGRLVGSRCSMAKRGLDTEKVVFRGMK
FT                   ELIELRKVFLYDTVLIYFVSSLTANECIIIEQGLEKSRLKASLLRRIREG"
FT   gene            <100690..>101259
FT                   /locus_tag="Eint_040830"
FT   mRNA            <100690..>101259
FT                   /locus_tag="Eint_040830"
FT                   /product="hypothetical protein"
FT   CDS_pept        100690..101259
FT                   /codon_start=1
FT                   /gene_family="HOG000150259" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040830"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N8"
FT                   /protein_id="ADM11373.1"
FT                   /translation="MMHGWKVFKYSRRVEGEEGEKSFCGIGLEEISRVILHSEVGRQGI
FT                   IKERWLHVFTEGSKTLGLALLPSMLEVRVYIVSAIRQELVILERIKLEEKWDIRVCVSK
FT                   RVIRCRCKQRKFQVIFFSKEDSEDFASKFGHFSKPPPSIPKYFPLIGTFEGLDGNEKKE
FT                   KKTPKYKKKKKVIEEFLSLLFEALGN"
FT   gene            complement(<101256..>102293)
FT                   /locus_tag="Eint_040840"
FT   mRNA            complement(<101256..>102293)
FT                   /locus_tag="Eint_040840"
FT                   /product="pseudouridine synthase 2"
FT   CDS_pept        complement(101256..102293)
FT                   /codon_start=1
FT                   /gene_family="HOG000149476" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040840"
FT                   /product="pseudouridine synthase 2"
FT                   /note="similar to ECU04_0890"
FT                   /db_xref="GOA:E0S6N9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6N9"
FT                   /protein_id="ADM11374.1"
FT                   /translation="MKVRAGLLVGYDGSKYHGLQFNKELDTVEKEIIGCLLEMEVISQR
FT                   NADDPKKVHIKSSSRTDKGVHAALNLVSVKIEADITPELISGLRTLLSRKEIHLYDIIR
FT                   LTKSTIPSKQAVFRAYEYIVPTFFLAKGDFDKEVEVLRQKDGECRDGRVTRDYPSDMID
FT                   SLVGYTSSEDDLRVFEAILQKYTGTKDFHNFTKLNSEKGTKRYIKSVIVSDPYVNNGIE
FT                   YVRVSITGQSFLLHQIRKMMLFGILLCRYSRDSVESKFDMVFSKENIHVPKGPSEYLLL
FT                   DKPTFHRLRRGDGTTEDIGVDDAAREEYKRNAIYPRIHQRKNLIGFFACLDSVRFHREN
FT                   MVFIG"
FT   gene            <102329..>104002
FT                   /locus_tag="Eint_040850"
FT   mRNA            <102329..>104002
FT                   /locus_tag="Eint_040850"
FT                   /product="phenylalanyl-tRNA synthetase subunit beta"
FT   CDS_pept        102329..104002
FT                   /codon_start=1
FT                   /gene_family="HOG000105095" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040850"
FT                   /product="phenylalanyl-tRNA synthetase subunit beta"
FT                   /note="similar to ECU04_0900"
FT                   /db_xref="GOA:E0S6P0"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P0"
FT                   /protein_id="ADM11375.1"
FT                   /translation="MPTLIVKKKKVQELLQREFDDHWFERTLFDFGLELDDTVEEEGEC
FT                   MYRIDIPANRYDLLCTEGLCYALRVFLSMEEYEDIEIEEGRVSVYKSGGRERPCVACAI
FT                   VRGVDFRSEETYRSFIDYQDKLHLTIGRNRTLVSMGTHDLDKIQAPIFYRSETPDRIVF
FT                   KPLSADRRMSAQELSSYFAPGSKIGKYMKLIEKNEKYPYFEDSKGTVLSLPPVINSDAT
FT                   KIDLETKNVFIDVTGTDFHRVNTALKLILGCFRGKRIESVEILDGDERIRTPIMHNHLY
FT                   TLELDEINRRLGLDLSLEVAKTYMERMMHKASIVDGKTLQVKVHDIRSDVIHKCDLIED
FT                   VAIAHGFNNFKRELPLISTIGSEDPLNRFSDKLRMELSIMGFDEALTLTLLSRQENIID
FT                   GDLAVVLMNPKSIGYEVCRTSLIPGLMKTVASNLHVKIPFKLFEVSDVVLLDKENQSGA
FT                   RNSRRLAALYCGHSPCLEEVQGSLSLLLEKCGVQPSYTPHDDPIRYLKNQGAFVVVEGI
FT                   PIGSIGVCNPEICRAFKVPYAASFFEIDAEKLFSVYKDMN"
FT   gene            complement(<104052..>106850)
FT                   /locus_tag="Eint_040860"
FT   mRNA            complement(<104052..>106850)
FT                   /locus_tag="Eint_040860"
FT                   /product="Ski2 ATP-dependent RNA helicase"
FT   CDS_pept        complement(104052..106850)
FT                   /codon_start=1
FT                   /gene_family="HOG000163047" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040860"
FT                   /product="Ski2 ATP-dependent RNA helicase"
FT                   /note="similar to ECU04_0910"
FT                   /db_xref="GOA:E0S6P1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P1"
FT                   /protein_id="ADM11376.1"
FT                   /translation="MIDDKYFDVLEDNTTPQDITIPERLERRTAVVDQIDRNGTRHEAV
FT                   IPAGVDYVPLPREFGKPIAKDYLFELDDFQKISVCSLERDESVLVSAHTSSGKTVVAEY
FT                   AIAMSLKNSQRVVYTSPIKALSNQKYRELLSEFGDVGLMTGDVTINPTATCLVMTTEIL
FT                   RNMLYKGGEVVREIHWIIFDEIHYMRDKERGVVWEETIILLPRHVRMVFLSATIPNALE
FT                   FAEWICHIQSQVVHVVYTEKRVTPLVHYFRSNKLYKIKDAKFHKSNFLSAMRSIQKRNI
FT                   GPKEVGEAISDASLPVVVFSFRRKDCERFAMKLDKSYLKDSEAEMVETIFTNAIMSLRK
FT                   EDREIPIIQNILPLLMRGIGIHHSGLLPIIKEVVEILFQEGLLKVLFATETFSIGLNMP
FT                   AKSVVFTALKKFDGESMRLVSPGEYTQMSGRAGRRGIDSMGIVISIISEPITYKEVNKL
FT                   FSTSSDNLVSAFRLTYNMLLNLMRVEGLDPLYLISRSFYHFQSYKKALAEEETLHIMHN
FT                   RLEDLSPNRIVDLYKRREEKKIERNKRLVDKFNGHLKKGRVIDLFVQRNGPSITIRNAI
FT                   VSKVKEKILCMVGTNKGVYMCSFPLDCVDNVYDSRVKLDMRVFTRSFGKIPVEDELDEE
FT                   INRIETEIISANPGWSFDVCIVCGKTSMECLSLCSKDVIGDDAVMVQVPENGRRHAENP
FT                   KAGHLHVEMGEEMSSARSYFLNEIMKQQCLEKLLELNSLKEIYHMRECKKMIKVLKKLE
FT                   YCDDTTVLIKGRMACEISSGDELVLTEMIFNGDFAGIPVEHFVPLLSCIVFEEWDSDNF
FT                   VLSEENKLYYKLLSDSVEKVCKVLKSCSIDVDPTTYLRKFSYELMDVVRMWVCGHTFIN
FT                   ICNKTSVFEGSIIRTFKRLEELLRQLSSAARVIGNTELENMFALGIVKIKRDIVFANSL
FT                   YV"
FT   gene            complement(106916..106997)
FT                   /locus_tag="Eint_040870"
FT   tRNA            complement(106916..106997)
FT                   /locus_tag="Eint_040870"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Type: Leu, Anti Codon: CAA, Cove Score: 65.49"
FT   gene            <107090..>108028
FT                   /locus_tag="Eint_040880"
FT   mRNA            <107090..>108028
FT                   /locus_tag="Eint_040880"
FT                   /product="hypothetical protein"
FT   CDS_pept        107090..108028
FT                   /codon_start=1
FT                   /gene_family="HOG000150257" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040880"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P2"
FT                   /protein_id="ADM11377.1"
FT                   /translation="MDDIDLHYSMRYIINYRNVSVMMLCHLLCLLKQHLKMTLTYPDIP
FT                   VIITDEVAQYYRSRDPRIIQEFRESTYVARKNIEKLILRVSRWIVMCEEQFDYFQGYDH
FT                   FESNVCSDFDKLLEDYFKNKSSEENKKRWDDLQEFVEICSYRYLNYDSQKANWLAGISK
FT                   TISKCDELNTLLNAKLCFVPKEALDSEDYVMGIIQSEMQNHPWTPTHYLEEAKHRYVIV
FT                   TLMNLLHMVAEVKNKENSFWILEKELKNRMPGLKKEERLLDVSYQSGTEEKKPAVGIFK
FT                   KCIILVKDARLSSVVVIVGIGMAIGIIKFLN"
FT   gene            complement(<108087..>108395)
FT                   /locus_tag="Eint_040890"
FT   mRNA            complement(<108087..>108395)
FT                   /locus_tag="Eint_040890"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(108087..108395)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040890"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P3"
FT                   /protein_id="ADM11378.1"
FT                   /translation="MLSTMVKIVITGCVAYKLYRRAEEAMKNDEEYLMKITGHADELAA
FT                   RMIDEARKHARAKEYELSAEYFYYAYKCLGSSWDHIIAQADSQEVCRLLHIKKSQEQ"
FT   gene            <108445..>111924
FT                   /locus_tag="Eint_040900"
FT   mRNA            <108445..>111924
FT                   /locus_tag="Eint_040900"
FT                   /product="chromosome segregation ATPase"
FT   CDS_pept        108445..111924
FT                   /codon_start=1
FT                   /gene_family="HOG000149475" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040900"
FT                   /product="chromosome segregation ATPase"
FT                   /note="similar to ECU04_0930"
FT                   /db_xref="GOA:E0S6P4"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P4"
FT                   /protein_id="ADM11379.1"
FT                   /translation="MGLERVEVENFKSYAGFHIIGPFDRFTCIVGPNGSGKSNIMDAVT
FT                   FCLGIGSKHLRANNIRSLINGGSSHASVALHIEGSGERRVFKRRISSEGRSQYFVDSES
FT                   VGYERFREVVEGMNLLVDARNFLVFQGDVNAIGNMMPMELTRVFEEASGSLKLKEAYEE
FT                   KQRAQAKAVSECASLFEEKKEVMSRMKEAEEVREQEGEFRKLVERKHKVQRDIVLYELM
FT                   EKRNKKKDISNEMLSLGQESRKMEELVCKKEKEVEKHRGRISEIRRRYFEADALVSKQK
FT                   EVVAERRAWKSLGESERSKRRVRIAEIEMEIRAGQEMMGGKKREIERRRRDLAGVAEGY
FT                   SELWREEEERKERLNGVKEKEEEIEKREKEFLRMCGEERERLNTLEMEEFPRQMMKDDC
FT                   IRKIGNLKERSEELESMIKEKKMIRGNTGVKIDALERSSEELGRKILHHEEKYSRLISE
FT                   EKEKNEELSWVLGEILRIKGKRRIDGRHSVIAGAVETLREMFPGVYGRVVDLIKPTRDK
FT                   YEIALSVLLGGHDQSVVVDTEVTAMSCINFIKEKKLCKMTFVPLHSIRDQGDGRDVENA
FT                   VEKYGEGVRRASDAVKYDGKYKKIVSFLFREKLIADSMEIAKDICYGRKIKVSVCTLDG
FT                   IYIYGGGYLISGGGEGRNKFQEDELDELVKKRMRILDELRRIQDGKNELSHVEICRERM
FT                   EVWKKSKELEMETLRELDSCIEDLELRIGENKRMLEETEECLKRTEEEMGQSEVYLKEL
FT                   RKKIEEVESSVFCGIFPNAYFGSFEEYKKARESEAFALKSMEYEGIKAKTELRIEMLER
FT                   EVRDLEEETERLRREVEGLSKDPCRDEIDIDALDSELMILEEGRRKNLEAFKKARDEFK
FT                   EINEEFKELVDRRNELDQQIIHSTSARERLEEEIKDTLSFAVLEEIDLPCAKRMSMGEI
FT                   SVDEIDFSGLEGSVSKLRKELEEINQKISSQAPVIRMEERDGDNARYMRISAEYEKRKA
FT                   MAIAAKNEFNEVKKRRTHLFMECFEKVNKEISRIYKLLTMTETGEGNAYLVLENTAEPF
FT                   REGIRFHLMPPNKRFREVRLLSGGEKTMAALSLLFSLHAYRPAPFYLFDEVDSALDKAN
FT                   VSKIVSFIVSCNAQFILITLKPSLFQHSDGLVGVYKDPREGVSKVLTYRLGD"
FT   gene            complement(<111993..>112499)
FT                   /locus_tag="Eint_040910"
FT   mRNA            complement(<111993..>112499)
FT                   /locus_tag="Eint_040910"
FT                   /product="endoplasmic reticulum translocation complex
FT                   subunit Sec66"
FT   CDS_pept        complement(111993..112499)
FT                   /codon_start=1
FT                   /gene_family="HOG000150256" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040910"
FT                   /product="endoplasmic reticulum translocation complex
FT                   subunit Sec66"
FT                   /note="similar to ECU04_0940"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P5"
FT                   /protein_id="ADM11380.1"
FT                   /translation="MILLLGIILSTMILTFSFVRRINKRKMPAEENPNMELEMYFLQKS
FT                   EGAASSVLLRQLVKAAACFKERVMKLEKDMEILGVLYEDRMISEEHWERVNEESKNCEV
FT                   ERICIESEANIIKPGYGEEIFKDASRISTVNAKKGKSLGDGNSLHQKKKEVLELELMRK
FT                   LGIAK"
FT   gene            complement(<112600..>112911)
FT                   /locus_tag="Eint_040920"
FT   mRNA            complement(<112600..>112911)
FT                   /locus_tag="Eint_040920"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF13"
FT   CDS_pept        complement(112600..112911)
FT                   /codon_start=1
FT                   /gene_family="HOG000237827" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040920"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TAF13"
FT                   /note="similar to ECU04_0950"
FT                   /db_xref="GOA:E0S6P6"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P6"
FT                   /protein_id="ADM11381.1"
FT                   /translation="MRETRRVNFMKDIKVMMYGYGDVIAPRYDTAEALHGYVLDYMSIL
FT                   LTNTHNMAQVKGKTKTEDLLYYLKRDRKKYSRVRHLLITNEEIKLAKKAFEPKDYEKE"
FT   gene            complement(<112936..>113238)
FT                   /locus_tag="Eint_040930"
FT   mRNA            complement(<112936..>113238)
FT                   /locus_tag="Eint_040930"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(112936..113238)
FT                   /codon_start=1
FT                   /gene_family="HOG000150255" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040930"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0960"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P7"
FT                   /protein_id="ADM11382.1"
FT                   /translation="MTRLPGDGADVLTCNGHPAIGTIFPEIGSKGKARVIKVTFTQMIV
FT                   QIFEVEGRKTAIEYRGIFRPVDFNPNEHLCDRFAKGDTVECTVLSYGDNGVFVNL"
FT   gene            <113469..>113828
FT                   /locus_tag="Eint_040940"
FT   mRNA            <113469..>113828
FT                   /locus_tag="Eint_040940"
FT                   /product="homeobox domain-containing protein"
FT   CDS_pept        113469..113828
FT                   /codon_start=1
FT                   /gene_family="HOG000112865" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040940"
FT                   /product="homeobox domain-containing protein"
FT                   /note="similar to ECU04_0970"
FT                   /db_xref="GOA:E0S6P8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P8"
FT                   /protein_id="ADM11383.1"
FT                   /translation="MKRKTVEYKLVDEENDIVRSYEPRRKPKRSRILLHEWQSMMLEHS
FT                   FRTNPYPDRIEKYNLFLKTGIPVKNIKIWFQNRRAREKSFYEEMEEIHECERMEYQGLD
FT                   TRVASFGEEFQYYKY"
FT   gene            <113919..>115319
FT                   /locus_tag="Eint_040950"
FT   mRNA            <113919..>115319
FT                   /locus_tag="Eint_040950"
FT                   /product="signal recognition particle protein Srp54"
FT   CDS_pept        113919..115319
FT                   /codon_start=1
FT                   /gene_family="HOG000036165" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040950"
FT                   /product="signal recognition particle protein Srp54"
FT                   /note="similar to ECU04_0980"
FT                   /db_xref="GOA:E0S6P9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6P9"
FT                   /protein_id="ADM11384.1"
FT                   /translation="MITELGKSITNTLSNLLRSRATDQDIEAAIKEICHSLILSNVNPR
FT                   YVSNLRNELKARLDPSGMAPGLNKARVVQNAVYEKLVDLLDPKAKGYKIEKGKTSIIVF
FT                   VGLQGSGKTTSICKYANFYKKKGFKVGIVCADTFRAGAFDQVRQNALKIKVPFFGSSEA
FT                   DPVKVAGAGVERFRRERFEVILVDTSGRHTQESELFVEMKDIMREVRPDSIVFVMDAGI
FT                   GQSAEDQAIGFKKAVNVGSIILTKIDGTNKAGGAISSVAATGCPIEFVGNGEGMEDLEV
FT                   FDARRFVSRMLGMGDVEGLMEKVESLGIDEKEVVRKLKQGKFTLGDFYDQFQKILSLGP
FT                   ISKLLEMMPGFSGLSLPDEESFKKLIYIFDSLSRGELDSTGQMFEKEPSRIMRVARGSG
FT                   TSVQGVVEILTQFKKAHAVMQKISSIPGIESMMGNPSSMSLTQKAKLKEQAKNILPKDL
FT                   LDKMASMF"
FT   gene            complement(<115401..>116093)
FT                   /locus_tag="Eint_040960"
FT   mRNA            complement(<115401..>116093)
FT                   /locus_tag="Eint_040960"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(115401..116093)
FT                   /codon_start=1
FT                   /gene_family="HOG000150254" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040960"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_0990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q0"
FT                   /protein_id="ADM11385.1"
FT                   /translation="MAVEETTNEMIEESSISISSDVVNESLGHPGADPRDSESEMDCLK
FT                   TLSRPCLPNKLWIKRDVDYDLDLSYCDRILDRFAFNISRLREGGTYERDINEDAFYYKY
FT                   KPTSPCDIETIRDSKEIKEKISCRRLREMSLEMIDYCMKLNRDGEHFIDLEAATPELSE
FT                   EVRDLIRSSALKKKRILNLLHKVRNHIGEIILMGEKCHNHIEKSNAIVFKGISSLEDRI
FT                   IGNTRTDP"
FT   gene            <116101..>121197
FT                   /locus_tag="Eint_040970"
FT   mRNA            <116101..>121197
FT                   /locus_tag="Eint_040970"
FT                   /product="myosin heavy chain"
FT   CDS_pept        116101..121197
FT                   /codon_start=1
FT                   /gene_family="HOG000149474" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040970"
FT                   /product="myosin heavy chain"
FT                   /note="similar to ECU04_1000"
FT                   /db_xref="GOA:E0S6Q1"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q1"
FT                   /protein_id="ADM11386.1"
FT                   /translation="MSGESKILKRPYFLIPAGALKMEETTNKHTSGLRLGEKASLKDEI
FT                   QRRFMEKKWVWVPSNKEAYRSGFVVKEEGDNLEVDCEGVVIKCKSCEIFRMNPPKFDMI
FT                   DDLAELSYLNEPGVLHNLKRRYQNGRIYTYSGLFLLAINPYKNLRIYGEKDARKYTLSK
FT                   KYELEPHIFAVANEAYKSMVSSRENQSILITGESGAGKTENTKRVVEFLAMVGGSKDAE
FT                   VSIDRKIIDANPILEAFGNAQTVKNDNSSRFGKFIKIKFNGGNICGAHIEKYLLEKSRV
FT                   TNQNRNERNYHIFYQLLGSEDQGLKKQLFLSGEPKDYRFLRGSKFRIPGVDDAEEFKRL
FT                   RESMDILGISRGEQNGYFGIVSAVLHLGNIEFREKDGAAEIANLDVAEKVCKLLNIPLT
FT                   EFIKGLIHPMIRAGNEYVAQSRSKEQALKIVEGLARILYDKMFDSVIGRINMSLSSPHK
FT                   GNFIGVLDIAGFEIFEKNSFEQLCINYTNEKLQQFFNHHMFILEQEVYRKENIDWDFID
FT                   FGLDLQPTIDLIEKNNPIGILSYLDEECVMPMATEKTFLGKLMKNIRDEKFEVDRIRDV
FT                   FILNHYAGDVEYTVEDWLSKNKDSHSEALTSLIRMSSDETVSKLSLEEEMIKKGFFRTV
FT                   SQKHKEQLASLMSELRGTNPHFVRCIIPNLEKSGESLDNGVVLGQLKCNGVLEGIRISR
FT                   QGFPSRMGYLEFVRRYKIMVKEEVLDGELWGDGVCMELCKEGTGKILSEIGIGGSQYRM
FT                   GRTKVFFRQGVLADIEDMRDGKISEIVKEVQALIRRRLAFRKYNLTQRRMQGILVIQRN
FT                   GRICNELQRWNWWRLYQKIKPLLDVRKKDNEMREKDAMIQEYIRMLDAEKSRREESEEM
FT                   MKMISLKKDLLEKTVEDEKRFSMEKDELLMALRYKVDSMGQELEKARKEADEAHEEKKV
FT                   CSERLAEMGKTLEGREAEICDLRKEMEEQKNTLLLQERDICTLREEIVSKLSEKDAMVE
FT                   KMLRERDKEVMMLKEKIKEKDLDGEKKAEKIKRLELSEEERRRELKKKEQEMNELRTNW
FT                   LSMKKWKEECVELRADYEAMQKKLKDEAEDALLENDRLQNEIRKMRKEMEEQELMRKKL
FT                   LDDLEFERSRGQKLEGAFQELRREHEIVEEQLQKEKQLKDSTQESLVERIKGLERKTKS
FT                   LSEKLKSEELANKQLMNEKDDMHREIHVLQQSKLDEIFDREAAFNSAKKNLQMEIQRLE
FT                   MENQKLNTEIMESKCMGEASEESVSAMEKFYVILEEERKKRKEIEHQVSEQENKNVILS
FT                   SEVEMLKEMVEIERRSKEEMMRGQEKETGLRRAISGVRKEIEDVENEMNMIVSGFNELY
FT                   FSVLNKYKGDLKECKESLELKNHTIEELNDRILDLSSLAEGRRAVEEETSGRMEEMSKQ
FT                   YSKMANDFSSLSAKCNSLEISLSEKEEEIKRYEEKCSEYDNLVRDLGCRIDEEIKNLHR
FT                   SDEERRGYIRKLEDDLNGSMAGIRKLEEKYRARMEESVQYVLDGEKRKLKALEELHGQL
FT                   AKRFDDLQGEHRILLDEKMKDSLRIEQLEGELCALRKAETQRQDMILMYESEISGLKRC
FT                   ARFQDEIQTSFGGERSPAVVHVCDKEKYQALDRKRAVIENELLRANNDKESQIAANKKL
FT                   REEVERLRGEIEGSRSKALEMKKKLGHQMLTANRLSRELEEEKEMVRFLRTLGGGRKKK
FT                   A"
FT   gene            <121499..>121912
FT                   /locus_tag="Eint_040980"
FT   mRNA            <121499..>121912
FT                   /locus_tag="Eint_040980"
FT                   /product="hypothetical protein"
FT   CDS_pept        121499..121912
FT                   /codon_start=1
FT                   /gene_family="HOG000150253" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040980"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1010"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q2"
FT                   /protein_id="ADM11387.1"
FT                   /translation="MVLIVDTFEVPSLLISQKLFRSSSVVEIEEVTKETIDEVLTADGV
FT                   YSIHKECFDYERIRWMKYYFNEVVEVFANVQYINKSKKVVRYYSIVRDAEGVATDLVEI
FT                   KEDEEKEAYDKTAFLPHVQAQEEEIVIFPDDED"
FT   gene            <121977..>122234
FT                   /locus_tag="Eint_040990"
FT   mRNA            <121977..>122234
FT                   /locus_tag="Eint_040990"
FT                   /product="40S ribosomal protein S27"
FT   CDS_pept        121977..122234
FT                   /codon_start=1
FT                   /gene_family="HOG000224977" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_040990"
FT                   /product="40S ribosomal protein S27"
FT                   /note="similar to ECU04_1015"
FT                   /db_xref="GOA:E0S6Q3"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q3"
FT                   /protein_id="ADM11388.1"
FT                   /translation="MTLDLAFPTREKVASTYKKDRLYREGNGFFMYVRCGGCRHTTCCY
FT                   SHSQTNISCPGCGDIILTSSGGRAIVSPNCEFKRIIRSID"
FT   gene            <122305..>123759
FT                   /locus_tag="Eint_041000"
FT   mRNA            <122305..>123759
FT                   /locus_tag="Eint_041000"
FT                   /product="T complex protein 1 theta subunit"
FT   CDS_pept        122305..123759
FT                   /codon_start=1
FT                   /gene_family="HOG000154531" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041000"
FT                   /product="T complex protein 1 theta subunit"
FT                   /note="similar to ECU04_1020"
FT                   /db_xref="GOA:E0S6Q4"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q4"
FT                   /protein_id="ADM11389.1"
FT                   /translation="MDIGQTHLGGLISNSQQDEKVRYHVVGSRVKMACNVIRSLYGGSH
FT                   RTKLIVNGYGQVILSSQPGVIYDNIKINHPLVKLLQDYVKKMDVVGDGATFFVTLVSEL
FT                   IQEAMDVVGKGMKGAYLGYMLREVHKEIEELASELRIKHEVDFEDRESISKVLKGVLKD
FT                   SVLEKIVVEGISLCRSFSTENIRVCKVVCGSTEDSYVVQGMVFNRSPEGEVKHVTKGKT
FT                   SIYNCPLDISRTELKGTVLMRTASELLSFSKEENKRIKETVESMNGDVVICSGKVDKIY
FT                   LDFLNKKKKLVFRITSKYDLRRIRELVGGHILAALDPQTEDSMGFVEEVETFKEGNSEY
FT                   TKFISGSKKVYTLVLKNSVQAVLDEQERMVQKALNVLSKNSKEGKIDLVDGAGRFEKKL
FT                   SKIFLERSMGCKEGKNLVYKCIGKALGTFKTSDAEVYDAYNAKVKALKYSIEFISTLFE
FT                   TGDYLIGKPEAINIAPKSNQHWDEDH"
FT   gene            <123967..>124368
FT                   /locus_tag="Eint_041010"
FT   mRNA            <123967..>124368
FT                   /locus_tag="Eint_041010"
FT                   /product="homeobox domain-containing protein"
FT   CDS_pept        123967..124368
FT                   /codon_start=1
FT                   /gene_family="HOG000112864" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041010"
FT                   /product="homeobox domain-containing protein"
FT                   /note="similar to ECU04_1030"
FT                   /db_xref="GOA:E0S6Q5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q5"
FT                   /protein_id="ADM11390.1"
FT                   /translation="MPIRSRFTKDEKKVMKFIDSTEEIIKHMNKSDSNKRSRLKLSGEQ
FT                   IDILESNFKIDSHPNSTTKSLLANALSIPFKNIQIWFQNRRAKEKMVRDSSKRRNGNTI
FT                   AEERDQERGTVNYQTMCPFDFPPQERYFL"
FT   gene            <124681..>125550
FT                   /locus_tag="Eint_041020"
FT   mRNA            <124681..>125550
FT                   /locus_tag="Eint_041020"
FT                   /product="hypothetical protein"
FT   CDS_pept        124681..125550
FT                   /codon_start=1
FT                   /gene_family="HOG000150252" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041020"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q6"
FT                   /protein_id="ADM11391.1"
FT                   /translation="MLILANTNREMSFEVSRVNGRVFLAGSLEGIEYKGSEWNSPCNYY
FT                   VVESSEGIFELNKAMEAKVIVFETIYETGLLHEKTSFEKLASTFGNRKFAEHYKRKGIE
FT                   GYSKRFFTSKFQYREQVLPPIDKEKWNPEERFPLEKMFPQDVLSSFLEIKLDTVLLHPD
FT                   LMSLKQDVNYKIHFLLADCIIKLMEKKYVTSDCLNDSGYSSFFEMIKDEVENRMLTPLC
FT                   RDKLAILCYILFLQIEGSSVRYEVLPDFKFSKEKVLAMFRVIGCSYIAKLDSFKMKEKQ
FT                   MHPSDTRN"
FT   gene            <126021..>126566
FT                   /locus_tag="Eint_041030"
FT   mRNA            <126021..>126566
FT                   /locus_tag="Eint_041030"
FT                   /product="hypothetical protein"
FT   CDS_pept        126021..126566
FT                   /codon_start=1
FT                   /gene_family="HOG000150251" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q7"
FT                   /protein_id="ADM11392.1"
FT                   /translation="MKSVDFEMKLVERYGTGVIPKEDIESVLNEAIENNVIEKDEVGRW
FT                   EKDEEYTVSRFLRTIRKWRTDFLKDSFSINDISCKDEGRCGDRYLDEGEFKGLECHEEP
FT                   NVNDSFVTTDEAFLSSLRDKTKIITSRRNNNGKKIVREVLRAWGEYEKLPTKKKSYGWY
FT                   FLVLLVVPVYFLYVQKPF"
FT   gene            <126601..>127293
FT                   /locus_tag="Eint_041040"
FT   mRNA            <126601..>127293
FT                   /locus_tag="Eint_041040"
FT                   /product="dolichol-phosphate mannosyltransferase"
FT   CDS_pept        126601..127293
FT                   /codon_start=1
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041040"
FT                   /product="dolichol-phosphate mannosyltransferase"
FT                   /note="similar to ECU04_1060"
FT                   /db_xref="GOA:E0S6Q8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q8"
FT                   /protein_id="ADM11393.1"
FT                   /translation="MYNVIIPTYNERENICVLLRMVSDVLREEGKAFKIIVVDDSSPDG
FT                   THEAVESLGLPNVCLLLRKKKLGLGSAYRAALEHCEHPFTVVMDGDLSHDPMYIKDMIR
FT                   LQKKGADIVVGSRYSKEGGVYGWSIKRKIISLGANNLARTLLNMDVSDLTGSFRLYKTE
FT                   VFKLLVKESVSTGYSFQMELMFLAKRHNLTIAECPIVFHDRRKGQSKLSAMEMVMYFKT
FT                   VVSLFFSV"
FT   gene            <127654..>129522
FT                   /locus_tag="Eint_041050"
FT   mRNA            <127654..>129522
FT                   /locus_tag="Eint_041050"
FT                   /product="DNA topoisomerase III"
FT   CDS_pept        127654..129522
FT                   /codon_start=1
FT                   /gene_family="HOG000184377" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041050"
FT                   /product="DNA topoisomerase III"
FT                   /note="similar to ECU04_1070"
FT                   /db_xref="GOA:E0S6Q9"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR010666"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Q9"
FT                   /protein_id="ADM11394.1"
FT                   /translation="MVVIWTDCDREGENIGRQIRDIVLGVKKVEVKRARFSGITLRDIE
FT                   GALGNLGEINEAEAEAVEVRMELDLRIGSAFTRLQTLSLGRTIQEKRVLSFGPCQVPTL
FT                   GFVVERARERESFVPEMFWTLMFKTKSKKLGDEFTWRRGSVFDKNCVICFHRSLSGESA
FT                   RIVLKEVRERTKYKPLPLRTVELQKKCSSYFKLSGHKVMEIAEGLYNKGYISYPRTETD
FT                   AFDRKFDFKYILGKLCKDSKVGEHAEKLIGGFDYPRNGRNNDMAHSPIYPLKEGTGLSG
FT                   KDRDIYDFICRRFLGCISKDAKGLETRYELKIGSEMFDLKGIRVVEKNYLEVYYYDKWD
FT                   DKEVSDFQMGEMVSGDLCISEGKTTPPNYLTEAELISLMDKNGIGTDATIHEHIQKIQE
FT                   RGYAIKVGEEIRPLELGAALIGGYERFGLNVGKPELRKSLEGNLKKISEGRMSGREVVK
FT                   EGIIAYRDIYALLKRNIEEFVCILRQGIENDTKRLGVEKRKKAERAEQGKTKAEGFKGL
FT                   NPKKALNKEGEKKRVECDCKDEAKVLKVKKGDNTGKEFYCCGKTAKRCYFFQWCDKEET
FT                   KRDEELKCFCGFEPQLLVANTENNKGRKFFKCKKAYKPCKFFQWEE"
FT   gene            <129621..>129962
FT                   /locus_tag="Eint_041060"
FT   mRNA            <129621..>129962
FT                   /locus_tag="Eint_041060"
FT                   /product="hypothetical protein"
FT   CDS_pept        129621..129962
FT                   /codon_start=1
FT                   /gene_family="HOG000150250" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041060"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1080"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R0"
FT                   /protein_id="ADM11395.1"
FT                   /translation="MVEESSVAEPVPQAKPQQEIERKGSFPENEVSKDMPVVKLKDIMM
FT                   YAENMEGMENKKLIPYVVYLDEQFKEIVQRRRKDAKVVLILYITIMSIFVIGLIVCGVK
FT                   LFGYLMGWE"
FT   gene            <130045..>131070
FT                   /locus_tag="Eint_041070"
FT   mRNA            <130045..>131070
FT                   /locus_tag="Eint_041070"
FT                   /product="actin-like protein"
FT   CDS_pept        130045..131070
FT                   /codon_start=1
FT                   /gene_family="HOG000149473" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041070"
FT                   /product="actin-like protein"
FT                   /note="similar to ECU04_1090"
FT                   /db_xref="GOA:E0S6R1"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R1"
FT                   /protein_id="ADM11396.1"
FT                   /translation="MYVAGDTITAVIDIGSETAKIGYSDTLLPMIFCPSISWKNEYISP
FT                   VTRSVVSDVGSYLRILCDNAPRDAQSLVISENTMEAGGTKREILGYLMERRMCESVLFV
FT                   RSGILDAFSYGKTTGVVVSLGGGSSQVCSVVDGLITCRRRLDVGGNDLTQDFRRGMEEC
FT                   GIDLRKFIGVNDGGSWCERKIEFEKNEFCRYVKEAVLSFRSEETDRRYEFPNGETVEME
FT                   DWCNRISKRLKEVVKLIVEVTELNAMEVRSTLSSNILVGGGCGEIRGMESFICEELGKE
FT                   RPRWKVKVNVERSRFSTFEGGSVIGSMGSAKSFHIGIKDYEEYGEGILDRKKCEWIVET
FT                   V"
FT   gene            <131163..>132584
FT                   /locus_tag="Eint_041080"
FT   mRNA            <131163..>132584
FT                   /locus_tag="Eint_041080"
FT                   /product="translation elongation factor EF-1 alpha"
FT   CDS_pept        131163..132584
FT                   /codon_start=1
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041080"
FT                   /product="translation elongation factor EF-1 alpha"
FT                   /note="similar to ECU04_1100"
FT                   /db_xref="GOA:E0S6R2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R2"
FT                   /protein_id="ADM11397.1"
FT                   /translation="MATKIENDVKPRLNVCFIGHVDSGKSTTVGMLAYQLGAVDKREME
FT                   KYEKEAALNNKESFYLAYLTDKTEAERKRGITITTTLIALSTEKFDINVLDCPGHKDFV
FT                   KNMVAGASQADVAVVIVPASGFESCVGVGGMLKTHIMISGILGCEKLIICVNKMDEIAE
FT                   DKRRMEKFKEVSDEMRRIVKRCHRDSNPIVLPISAYKGINLTKKGEHFNWFSGWKEKEG
FT                   SEVIHTLEEALDYQKVPERHNDKPLRMPITKVCSIAGIGKIFTGRVEYGTITPNLKITI
FT                   QPAGVVGETRSVEIHNKPRPMIPCGENCGVALKGGVVGEIDKVDAGHVISANDENKAIA
FT                   YPGAKIRTIVVARPKGLSVGYTPQINFGNCHSPGRIAKIISRVVGGKEVQENLENIGNG
FT                   QTFIGVVVFQKPLVVDRMDKFQNLAKFALMDSNGVVGIGNVMEPLTKDQLLKEYGIDIN
FT                   EDPKAAKKAAGKKKA"
FT   gene            complement(<132637..>133527)
FT                   /locus_tag="Eint_041090"
FT   mRNA            complement(<132637..>133527)
FT                   /locus_tag="Eint_041090"
FT                   /product="DNA topoisomerase VI subunit A"
FT   CDS_pept        complement(132637..133527)
FT                   /codon_start=1
FT                   /gene_family="HOG000150249" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041090"
FT                   /product="DNA topoisomerase VI subunit A"
FT                   /note="similar to ECU04_1110"
FT                   /db_xref="GOA:E0S6R3"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R3"
FT                   /protein_id="ADM11398.1"
FT                   /translation="MAFSSEISTSLKHNALKLLTELKSRTLVMRIRLHEIIMEMQELGI
FT                   TRNEREIFYMAVNIFKSQTAVKRLISTIASELRVSKSDLRIRNTLKGTFIGKLAFVKGP
FT                   DIIEMSSCRNNPQLIPDMEGIVEVFCSYERVLVVEKDTILQRIASGIERERYLEGVLLV
FT                   CGRGYPCKNTMLLLKMIEHKTAIGGLFDFDPFGIHIFCVYKYGSREAPETRVETIVRIG
FT                   VCAEDILDKRIHQDGLAGLNKYDLKMVDRLMEFECFTNDPLLLKKTGKKVEMEAFLSKG
FT                   RREMNHFLTKALKRI"
FT   gene            <133576..>134082
FT                   /locus_tag="Eint_041100"
FT   mRNA            <133576..>134082
FT                   /locus_tag="Eint_041100"
FT                   /product="putative UDP-Gal beta GlcNAC beta 1,4
FT                   galactosyltransferase-like protein"
FT   CDS_pept        133576..134082
FT                   /codon_start=1
FT                   /gene_family="HOG000150248" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041100"
FT                   /product="putative UDP-Gal beta GlcNAC beta 1,4
FT                   galactosyltransferase-like protein"
FT                   /note="similar to ECU04_1120"
FT                   /db_xref="GOA:E0S6R4"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R4"
FT                   /protein_id="ADM11399.1"
FT                   /translation="MIYTAEIYERVRKLLGDLCMVQTGDNPVAYKVSKYKSKKPVYLVE
FT                   GNGGEMYLMGDHVFELERSGFDVGVSKEKEVLVMLFKFSTRSLEGGRRVARESPEEGQF
FT                   IEVDVGPVTCDGRRMGTLIASSIPQGLCALSSVLKRFIRIDTNGYSEGGFEKLLVRVLS
FT                   SNRVL"
FT   gene            <134255..>135223
FT                   /locus_tag="Eint_041110"
FT   mRNA            <134255..>135223
FT                   /locus_tag="Eint_041110"
FT                   /product="KTR mannosyltransferase"
FT   CDS_pept        134255..135223
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041110"
FT                   /product="KTR mannosyltransferase"
FT                   /note="similar to ECU04_1130"
FT                   /db_xref="GOA:E0S6R5"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R5"
FT                   /protein_id="ADM11400.1"
FT                   /translation="MLLLLTIVGIVVCRENAVILILCRNSDKNGITETIKNFEEVFNRN
FT                   FGYPYVFLNDEEFTEDFKKAIKDVTSNSVEFGRLEPEEWEIPKWIDMEKAKEEMKKMED
FT                   RKIIYGGSLSYRKMCRFFSGFFYRNKLVQKYDYYWRIEPDVKFLCQIEYDPFTYLRENN
FT                   KQYGFVISLVEFMETIPSLFGEVIKFATHNLNLIKKANGNRFILNKDGSYNGCHFWSNF
FT                   EIANFGFFRNETYQKYFDWLDKAGGFFYERWGDAPVHSIAASLFLDKDQIHFFSDIGYE
FT                   HPPFQHCPREASMRSKCKCSISNSLDFSPNSCLGLYIKSLL"
FT   gene            <135304..>138078
FT                   /locus_tag="Eint_041120"
FT   mRNA            <135304..>138078
FT                   /locus_tag="Eint_041120"
FT                   /product="valyl-tRNA synthetase"
FT   CDS_pept        135304..138078
FT                   /codon_start=1
FT                   /gene_family="HOG000020094" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041120"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="similar to ECU04_1140"
FT                   /db_xref="GOA:E0S6R6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R6"
FT                   /protein_id="ADM11401.1"
FT                   /translation="MDSEKEALKERKKMEKEEKKRQKLEKFLAKKTQEMNVSKPRKEYK
FT                   GDGYDPLGIEGKWYEFWENNELFKPIEGKEKYVIPIPPPNVTGNLHIGHAMMVSIQDTL
FT                   CRYKRMCGYEVLYIPGTDHAGIATQNVVLKQLEREGVVSDREGFLKKAWEWKDKHGSRI
FT                   YEQFKRLGTSVDFSRERFTLDPGMNEAVVDAFVKLYERGLIYRELKIVNWCAKLSTTIS
FT                   DLEVNHEEVMASTDLQVDGGKYEFGVIYHFKYPMTIDKEFSGDYLSLPAIEVATTRPET
FT                   ILGDTAICVNGKDERFGARGIKETFGDVPEGSKLYCVNPLTSEVIPVVFDDYADMSFGT
FT                   GVVKITPAHDANDFDVSRRHGLPCKIVFDEENRVIIEGEFKGLKRFEARKAVISKLTDI
FT                   GLFVGKKEYPQVIPRCSRSNDIIEPIVKSQWWMDCKEMANKAIEAVKEGRIRILPEGAE
FT                   RRWYKWLENIRDWCLSRQLWWGHRIPAYRMPSGKWYVGRSKEEAFLKMKNECPEDGCSI
FT                   DEFEQDEDVLDTWFSSGLWPFAILGWPKETEDLQKYYPSTLLETGSDILFFWVARMVML
FT                   GIELTGKEPFSQVFLHGIVRDAHGRKMSKSLGNVIDPIFVIDGCPLSKLISTMRSGNLD
FT                   EREMKRAEEVLRKDFPNGIPRCGADALRFTLLSYTSGMKDINLDVLRVEGYRRFCNKIW
FT                   NAHRFVKAAVDEAIEESLRGSTCKKKYEKYILPADKLQIRSGEGPVEWILKKRNELIEI
FT                   SQRMIDSFNFMGATQAIHQFFIYDLCDVFIEVVKKNKSERYIGVLLSVFIDSMKILHPF
FT                   MPFITEEVFSDYFDSSISTSPYPRTDGSNHENKFSGTLQIIRHVRAKAESKGWPRVAVG
FT                   IAPGEDVDLADLEFVRLLCKKIIEFKVVEHSESSESHLYEKVGDSGVFVSQAD"
FT   gene            complement(<138104..>138754)
FT                   /locus_tag="Eint_041130"
FT   mRNA            complement(<138104..>138754)
FT                   /locus_tag="Eint_041130"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(138104..138754)
FT                   /codon_start=1
FT                   /gene_family="HOG000150246" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1150"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R7"
FT                   /protein_id="ADM11402.1"
FT                   /translation="MLEINSTKKTWMLLNTLFAVNYTLYIVLHLIRIPIYPLPNFVNIL
FT                   CLISSYSISLLPHLSSMKEILSQPNIYCITVFFTFPHEALLLPFYLLSIYHLSSFVLSN
FT                   KKTFERTSIYPICVSLSAYHVTLGRLALFTEVLAVPLSFLMIFLRKSSLVTFTTFIAMV
FT                   RQQYFNNPSMRSVFGEIRVSLDKWVLSCPRDVQEYYRRGRDFLVSTHSAKKLN"
FT   gene            <139139..>139900
FT                   /locus_tag="Eint_041140"
FT   mRNA            <139139..>139900
FT                   /locus_tag="Eint_041140"
FT                   /product="pyruvate dehydrogenase subunit beta"
FT   CDS_pept        139139..139900
FT                   /codon_start=1
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041140"
FT                   /product="pyruvate dehydrogenase subunit beta"
FT                   /note="similar to ECU04_1160"
FT                   /db_xref="GOA:E0S6R8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R8"
FT                   /protein_id="ADM11403.1"
FT                   /translation="MTWNFALQSIDHIINSCAKTLYMSGGKVSCPIVFRGPNGFNPGYA
FT                   AQHTQDFCSYYGAVPGLKVVAPFTAKDHKGLLKSAIRDNNPVVFLENETLYDDTYKDIE
FT                   QGYMQSLDKAVIEVEGCDVTLVGISLSVKTCLEAAKALKDLGISCEVINLVSIKPIDKQ
FT                   TLLTSAKKTKHVFVIDFAWPSFSVASEISAIIHENCFKDLMASVQRINAKDIPTPYSEK
FT                   IEAMAFPTCTDVIDSVVEVYKSTSKDNKLGL"
FT   gene            complement(<139909..>140268)
FT                   /locus_tag="Eint_041150"
FT   mRNA            complement(<139909..>140268)
FT                   /locus_tag="Eint_041150"
FT                   /product="eukaryotic translation initiation factor IF1A"
FT   CDS_pept        complement(139909..140268)
FT                   /codon_start=1
FT                   /gene_family="HOG000149472" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041150"
FT                   /product="eukaryotic translation initiation factor IF1A"
FT                   /note="similar to ECU04_1170"
FT                   /db_xref="GOA:E0S6R9"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6R9"
FT                   /protein_id="ADM11404.1"
FT                   /translation="MKGRKGRFTNDRALVFAEEEGTVYGQIICPLGQGQFKVSCSDGVY
FT                   RTAKVRGRDYRRVRMIPGDIVLLRVRDGDEKRADIDRKYMPKEIKILKEDGEINDDTFA
FT                   VNDKNSGLVEFEELL"
FT   gene            complement(<140333..>140917)
FT                   /locus_tag="Eint_041160"
FT   mRNA            complement(<140333..>140917)
FT                   /locus_tag="Eint_041160"
FT                   /product="Ham1 nucleoside triphosphatase"
FT   CDS_pept        complement(140333..140917)
FT                   /codon_start=1
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041160"
FT                   /product="Ham1 nucleoside triphosphatase"
FT                   /note="similar to ECU04_1180"
FT                   /db_xref="GOA:E0S6S0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S0"
FT                   /protein_id="ADM11405.1"
FT                   /translation="MTTGKIYFATTNLKKLNEVKEFLKTDIDHMRISMTEIQGPSEKIV
FT                   EHKLDQAAPFINPKDAVIVDDTSFSLEALGGFPGVYVKDFLEIGTRKIWEIVEKIGNKS
FT                   ATAVCSLGIAHYENGEIVKKVFSGKLKGSITEPEKDCKTEFGYIFIPDGFNGVLKNMPT
FT                   DEKNRISHRGIASRSLAAYMASKGIIKTHGP"
FT   gene            <141133..>142344
FT                   /locus_tag="Eint_041170"
FT   mRNA            <141133..>142344
FT                   /locus_tag="Eint_041170"
FT                   /product="amino acid permease"
FT   CDS_pept        141133..142344
FT                   /codon_start=1
FT                   /gene_family="HOG000149463" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041170"
FT                   /product="amino acid permease"
FT                   /note="similar to ECU04_1190"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S1"
FT                   /protein_id="ADM11406.1"
FT                   /translation="MKGGLSVTSAIVTMVTSMMGTGINYMPYAFKSVGYIRGILLINGV
FT                   GILTFFSLYAISIAANRSKEQNPTYSSLSTHISKALKILVDMSIFSSCFGVNIVFYRYL
FT                   AELITIMVPIGKYVDPEIGRKIVIGALSIPFLLLSLQKNLSNLKVTSYITVASVSYLAV
FT                   LMGIYCLFIGGKSAEEPMQRFGSNFSGGISCFMFALSCQANMVKTYTEMEHKSPSNIIK
FT                   VAMGASLIGTLIYGSVGLCGYAVFGDTIKGSIIDILISPESSINLYLMRNTIDKYALSS
FT                   KMACIGAMLVLFGAFPVQMNPLVGIPLSYFAREGSNEDAVRRKVVSVLMILFLSLSLLE
FT                   DLNIDTILQMVGATAVNLVSFTYPFIYYLYFRSKVDFMSGLALFGIIGSIASMIYMSYN
FT                   IMLS"
FT   gene            complement(<142452..>143501)
FT                   /locus_tag="Eint_041180"
FT   mRNA            complement(<142452..>143501)
FT                   /locus_tag="Eint_041180"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(142452..143501)
FT                   /codon_start=1
FT                   /gene_family="HOG000150245" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041180"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1200"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S2"
FT                   /protein_id="ADM11407.1"
FT                   /translation="MTVLYDKLQNIEAEIDRLCLEKKLNMEAEYLKRIKCKKSLRCYVK
FT                   VAMKKGIFIRLDSRVINDYKNGGQMKFSDVVKRFCVIFDSSIPTTADIHFGPSSGSDES
FT                   DRGMEEDMTGDQEGQLGQMKCKNMSMENFFEWTKCNGDAEAFEVNSDKSPKTIRLMFDL
FT                   ENPREIFRLSPKLSNILGRYTDTKPNVITHLWRYINKSGLMSIDSDIVECNPLLKDILG
FT                   VDRFSFPELPGLVAPHLCALDYLIVDIPPVDEYTEIFDIPFEWDDLHQYPTLYTKKIHA
FT                   LDRKIESLRQLLKRCEERERVLNEFERDPTAFINRWICIDMNDACHRTPLFCNKDVQER
FT                   VFELLKRLE"
FT   gene            <143673..>146087
FT                   /locus_tag="Eint_041190"
FT   mRNA            <143673..>146087
FT                   /locus_tag="Eint_041190"
FT                   /product="ubiquitin fusion degradation protein 2"
FT   CDS_pept        143673..146087
FT                   /codon_start=1
FT                   /gene_family="HOG000149470" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041190"
FT                   /product="ubiquitin fusion degradation protein 2"
FT                   /note="similar to ECU04_1210"
FT                   /db_xref="GOA:E0S6S3"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019474"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S3"
FT                   /protein_id="ADM11408.1"
FT                   /translation="MNRKELYEMFNHGEPADTGSVDMDEAEYIRLSYITNFSRDDILLD
FT                   LIPRYKSSYSPEGTRFFVETIAMIVDNPRMAGCVFSPISLTTLVVNSFGTSYFDVMDCF
FT                   ERLSEVEGMPKKVFLPMIYGLSFRCSKMDATSNIASYSSALETLAGLPSVLEELKNEVY
FT                   WGLCDLRPGRDVVLDFPVYSGFACAFPCFLDGFFEPFIYKKCDYATPAHDYLGISMREV
FT                   VEKSRRSYHSLCDHSYKMHQIIYSIIRSSKELRINFMKYVCKVISVSKERNKTVFNWRE
FT                   NISDGFAYNMSMVMSRFNGKIIDRNMTDKINPESVEEISVDSFPTFCYFSKIHLQFTSC
FT                   VKFGEYIRSLAYEYRLLDGDGGERIEAYRKGIDSKMSALNGLLFMTDLFSDEKAFTDFM
FT                   TEYTAETEYPWPDYYYRTLLWMQEMTIDIMKSATISSSLNKVMENIMDWKSPLFKKEVV
FT                   KILSHRSNSIKFTMLNRVIDYYNSLGRDEMRMEPRSIIHSIFKEGRVFAKMNVCRRNIT
FT                   FINCMMKDFEYSLSEGLSSIKDIKEDMKTVEELSRELEEVKKKNSEIKKAESINERIIS
FT                   MKKSIRFSKSKARNSFLYVDGCFDLFMHILDEKPDLFLVEEMISNFVRVLNCNLKVIAG
FT                   PRCTDLVIKSPEQYGFDAKNLLRRMVMIYIKIRSSKFVEMVANDKMYFDIEFFRTALRI
FT                   CENKYLINESQLEELRSLISDLEKVEVVEKIESVPDEFIDPLTFNPIRNPVKLLTSRIT
FT                   VDKSTYDMLMMNGGMDPFNRMPLTEDMVVEDSELKEKIDRYYSYSSKGKEI"
FT   gene            <146173..>146748
FT                   /locus_tag="Eint_041200"
FT   mRNA            <146173..>146748
FT                   /locus_tag="Eint_041200"
FT                   /product="thymidylate kinase"
FT   CDS_pept        146173..146748
FT                   /codon_start=1
FT                   /gene_family="HOG000229079" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041200"
FT                   /product="thymidylate kinase"
FT                   /note="similar to ECU04_1220"
FT                   /db_xref="GOA:E0S6S4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S4"
FT                   /protein_id="ADM11409.1"
FT                   /translation="MTQGKFIVFEGLDRSGKTTIVDSLYDSLSSMGDVRKMRFPNRSGN
FT                   IGKVIDAYLRKEINLENETIHLLFSGDRYEQKSTIEELRKSSILLCDRYSLSGASYSVA
FT                   KGLDLDWCVMVDSGLPKPDMTIFIDIPLDEISRRKGFGNEVHDHLPFLEKVLSAYKVLL
FT                   KREKNVLIVDGTFPISSIVEIVKRKILE"
FT   gene            complement(<146825..>147817)
FT                   /locus_tag="Eint_041210"
FT   mRNA            complement(<146825..>147817)
FT                   /locus_tag="Eint_041210"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(146825..147817)
FT                   /codon_start=1
FT                   /gene_family="HOG000149547" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041210"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1230"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S5"
FT                   /protein_id="ADM11410.1"
FT                   /translation="MNFEKEITVQVSVMESKEIDLLKKEKPRKRRQRADEYDYNDPFIE
FT                   PFEGETQMVMIECKLEDFFVYKGRLPYSAKKVLSVHKARERSKLLKSGTGSLDKGNDVK
FT                   KERSKGKLSNTKTLASKRKYGKIPKNDTKICDCLASLIKSGIEKLERPIQPGDCKTEYY
FT                   VSLMVLEIFQKERELDWGLPGLDSAEKPSDEEANKYVKDCENKMEGVFSAIAEDIRSYH
FT                   LYSEDLSLFKGFQKEGFLFNVSEYFLLFIKTSLMNQKSISFNKARKEAYNNILDLFPNT
FT                   CKNSTQTKYYLTKYILQTHGGKDLIGDSDREHGEKDEKCITPSDLERVE"
FT   gene            complement(<147894..>148619)
FT                   /locus_tag="Eint_041220"
FT   mRNA            complement(<147894..>148619)
FT                   /locus_tag="Eint_041220"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(147894..148619)
FT                   /codon_start=1
FT                   /gene_family="HOG000150244" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041220"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1240"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S6"
FT                   /protein_id="ADM11411.1"
FT                   /translation="MRVKRPRERKILLSVICSSEGEKIQREIGAIRGDTIHIQEKISAF
FT                   DCVEQVEKLMKKKKSGIFISVTKENLLVIGRTFNDEIIDMVEFKINKYQPVSDFECVSP
FT                   ELHMKYFVVLENINNPRLESLVIDLFNMRSSKVCLEGIRYSWVFARTESGYVLKYVRVL
FT                   KDLSVEDCGPLFEMELARSYHCSDELYKKALDEPSKPRRNTTKNLFNDRIGTIYIDKQD
FT                   LRDIKLKKTKRSGGVQERT"
FT   gene            <148776..>149864
FT                   /locus_tag="Eint_041230"
FT   mRNA            <148776..>149864
FT                   /locus_tag="Eint_041230"
FT                   /product="WD40 domain-containing protein"
FT   CDS_pept        148776..149864
FT                   /codon_start=1
FT                   /gene_family="HOG000195514" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041230"
FT                   /product="WD40 domain-containing protein"
FT                   /note="similar to ECU04_1250"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S7"
FT                   /protein_id="ADM11412.1"
FT                   /translation="MSINLGDIFTISGRRQSQKEDRYTKSTMGIHTNVLASIRLMTSSR
FT                   STRIENRHIDTSPHRILDAPGMLDDYYLNLLDWSTTNLLVIGLGESVYGYNAVDKSVVD
FT                   IHSGENYVSSVKSNGNILCIGTSDGAMRLVDTSVNKEINTIRNHQARVSSLSWNGNIIS
FT                   SGDKAGKLCNFDTRCGKISMVGAHSQEICGLAWSADMKYLASGGNDNVIRIWQLGNNNS
FT                   QTLLGHKSAVKALAWCPWRSGILTSGGGAKDMTIKFWDVAENRLERSISTQSQVCTLTY
FT                   LPKYKEIISSHGYSENDIRIWKTSTMNLISSFGKHGSRVLHVALSPDGSELASVSADEN
FT                   LKFWKIFNTEKASVRRDSLSFR"
FT   gene            complement(<149954..>151726)
FT                   /locus_tag="Eint_041240"
FT   mRNA            complement(<149954..>151726)
FT                   /locus_tag="Eint_041240"
FT                   /product="nuclear protein export factor"
FT   CDS_pept        complement(149954..151726)
FT                   /codon_start=1
FT                   /gene_family="HOG000150243" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041240"
FT                   /product="nuclear protein export factor"
FT                   /note="similar to ECU04_1260"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S8"
FT                   /protein_id="ADM11413.1"
FT                   /translation="MEDLRVRYKRLQEKRRNTKKGKVVIGECITFCPEFEGLERVLNNE
FT                   VSPYETEVMVKKYRKSFPDSGGVLAEDIRPIEVLWRVINHVIRLCADDQSIQIYKFVEN
FT                   RIRAVLLDMKVQEERGREAIEILEKVVRFYIVFRYQLYDHPQFNKDLNLSQLRMAMETL
FT                   MRLYSLESRGYENRNKEEFYCYHILASMCEKYVLDSGEQDDGPRIRLSMEITKKYMQGN
FT                   GAGFFRLLRKLDYISFCLAQSFIGEVRGKCVQLFKKSLVEKVKIGFFGDVLLTSEAEAE
FT                   DLFRDKGIPIRGGKVDFEEKGCGEEYDKVVPKSRKIETNVKKPVVFMLHGAVDYQILSY
FT                   ILSAVLWKKLNISKESLCNKFPKDKERLGSVERKTVVRKICVSILEEIIRKTTIEVFSR
FT                   IMFLNALREYLVKWRNQAIARNKDVLAKNKYILLVVLDREVSSVSLVGNINSSILNILA
FT                   PTITYIEKITVDEMLMYNLCIFSTSRNRRERLYNKYRMVNLIVDTPQGLSKRVDEIYER
FT                   AVNSPKIRKSTLLTLIGEMSKVEAIETIVKLIDNGRNEDSLENNLSLLYDDKPLTECDV
FT                   YYEEGSMGHTGLCL"
FT   gene            complement(<151796..>152476)
FT                   /locus_tag="Eint_041250"
FT   mRNA            complement(<151796..>152476)
FT                   /locus_tag="Eint_041250"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(151796..152476)
FT                   /codon_start=1
FT                   /gene_family="HOG000150242" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041250"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1270"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6S9"
FT                   /protein_id="ADM11414.1"
FT                   /translation="MEPGSTYPANFESLRAFFEVVGNERYFKIQIVTLESLDTFEAALR
FT                   ERKVVYKKCFSSMIEESEDLVLILEDSKIYLPSPGKYVLFGNRRHRDFVQIVFSPTLEE
FT                   KLAAVGDKYTVQAYSYKNINELRRISQGEEWTIESYFGSGLDYFESVIMLVVKNRNKFK
FT                   DILSGCKEIESKLGNGFFLQMKLNGLVGKLLVVRNGDSYRLNVSKSVLGSIGKRIGFNA
FT                   DSIA"
FT   gene            <152524..>153363
FT                   /locus_tag="Eint_041260"
FT   mRNA            <152524..>153363
FT                   /locus_tag="Eint_041260"
FT                   /product="acylglycerol-3-phosphate acyltransferase-like
FT                   protein"
FT   CDS_pept        152524..153363
FT                   /codon_start=1
FT                   /gene_family="HOG000149469" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041260"
FT                   /product="acylglycerol-3-phosphate acyltransferase-like
FT                   protein"
FT                   /note="similar to ECU04_1280"
FT                   /db_xref="GOA:E0S6T0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T0"
FT                   /protein_id="ADM11415.1"
FT                   /translation="MKKVPKILLKLVIFQGIIVLFLLGIPFSIFAYPLYIFNRPLCIQL
FT                   SSFFAYTLWTLTSWMFNLSSTVNGAVSLGNESYLVISNHLGSVDFILINEITRKSGMMA
FT                   HAKYAIKDGLRIFPIFYQIVVYLGFLVLKRSFEKDKKKIIEYLRFFDVSNLPIWFVLYP
FT                   EGSRFTEKLKLESWRYSDKKGMIRLNNVLFPRYKGFKLICEQLRNSRIKKIVDITFSYS
FT                   EGEVPPLWKFLFWDTKGSFNCDIRTVLINEIDDYEEFLYKSFERKDLLIEKWNSTGK"
FT   gene            complement(<153390..>155996)
FT                   /locus_tag="Eint_041270"
FT   mRNA            complement(<153390..>155996)
FT                   /locus_tag="Eint_041270"
FT                   /product="Ski2 ATP-dependent RNA helicase"
FT   CDS_pept        complement(153390..155996)
FT                   /codon_start=1
FT                   /gene_family="HOG000163048" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041270"
FT                   /product="Ski2 ATP-dependent RNA helicase"
FT                   /note="similar to ECU04_1290"
FT                   /db_xref="GOA:E0S6T1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T1"
FT                   /protein_id="ADM11416.1"
FT                   /translation="MNQNGEEVECRNVSGAEAKGTEKKYSVMVKQNWIPSDYSQYVDER
FT                   ILNIDFETDTFQKQAFYFLSRNSSVFVSAHTSSGKTLVAEYAISLSQKHGTRTIYTSPI
FT                   KALSNQKYHDFKQKYDDVGIITGDVQVNPTAKCLVMTTEILRNLVYRNGDLLRDTEFVV
FT                   FDEVHYINDSERGVVWEECIIMIPRNINFIMLSATIPNGLEFSEWVGRTKDRTIYVIST
FT                   GKRAVPLEHVIYCDWNVYTINEGGKTENASNFKGDLVPFSKKNRPTGKFKILDLANFVV
FT                   KKKLTPAIFFCFSKRRCEDYAEILRTLNLNDAKSREEVKMFLNEATKCLSSEDKNLPQV
FT                   LNMSSMVLNGVAVHHGSLLPFVKECVELLFSMNLVKLLIATETFAMGVNMPAKCCVFLS
FT                   LSKIDNGTFRYVSSGEYIQMSGRAGRRGMDAVGTVMIADPKMPPLSTIQGIIQGAPFSL
FT                   SSQFKLSFGLILISLRSNIRVEDLMRRSYGEHRSQRNYEKDMKKLSELERYQGKECSVC
FT                   GDLAKYINAVEEICAKNWKLIGKYNVLGEGRQILLKNNSVGTVEKVLGTSVLLKQEGEF
FT                   QSSSPISTRFLAHPLNIRKPLDRSKVDLADVFCVLEDGRAFWNYNTTNVMDVLEIRKLK
FT                   SWYDYLISEEKDCKEFDLHYLSALDMLHRRKEIEKISTKYNACSLGMIDEYNNRMEFLR
FT                   RKGFVDGTITMKGRAGAEIHTVNEVLVVEMIFSNEFKEMCGRKIISLMSSMIHEEGGEE
FT                   EPGESLRSECEIMKEYFARLSKDLDELSIPPFPPLNFSLVDAVYDWCNGSSLVKIVSKY
FT                   DVLEGTFVRLILRLEECCRELISISAMIGDKDLEKKIEDASASMKRDIIFLPSLYL"
FT   gene            complement(<156077..>156961)
FT                   /locus_tag="Eint_041280"
FT   mRNA            complement(<156077..>156961)
FT                   /locus_tag="Eint_041280"
FT                   /product="RNA-binding domain-containing protein"
FT   CDS_pept        complement(156077..156961)
FT                   /codon_start=1
FT                   /gene_family="HOG000150241" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041280"
FT                   /product="RNA-binding domain-containing protein"
FT                   /note="similar to ECU04_1300"
FT                   /db_xref="GOA:E0S6T2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T2"
FT                   /protein_id="ADM11417.1"
FT                   /translation="MNGMKKEGRGKSKLECKEGNKKRLKGEDIPRSCKEKKESSKGKKE
FT                   KDEISREKKKNIEAIKFDEATCSLVIKGSLTLKDIKEAFKNFKSIENGKGHFILKYPSK
FT                   EHALVDMKANRKQGKEKKESSGRYLDNKYILTNLSYKENEESISKVFEKYGEIERIRIK
FT                   KNKDNISTGKAIITFKKKAVIKEEIVMNNKPVYIERMKKPWENKTRFFLGKLNKAHSIV
FT                   EIRKILADVECKPKEIRVIYGENKRNRGYGFIEYANEEDANAFTEKFEEIKDRLGAGCY
FT                   YEYSNEKASSRRR"
FT   gene            <157120..>157539
FT                   /locus_tag="Eint_041290"
FT   mRNA            <157120..>157539
FT                   /locus_tag="Eint_041290"
FT                   /product="60S ribosomal protein L32"
FT   CDS_pept        157120..157539
FT                   /codon_start=1
FT                   /gene_family="HOG000231288" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041290"
FT                   /product="60S ribosomal protein L32"
FT                   /note="similar to ECU04_1310"
FT                   /db_xref="GOA:E0S6T3"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T3"
FT                   /protein_id="ADM11418.1"
FT                   /translation="MSKELLEANPLVEIKEAYQKKKKFIRHHSDRYKRVKPSWRKPHGI
FT                   DSRVRKRCRGEREMPSIKYKKPKEIRHLLPNGLRKVRIFNINDLTPLASLNRFYCGEIA
FT                   HAVGARKRIAIVNRAKELGICLLNGNARLVQEIEE"
FT   gene            <157617..>158378
FT                   /locus_tag="Eint_041300"
FT   mRNA            <157617..>158378
FT                   /locus_tag="Eint_041300"
FT                   /product="hypothetical protein"
FT   CDS_pept        157617..158378
FT                   /codon_start=1
FT                   /gene_family="HOG000150240" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041300"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1320"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T4"
FT                   /protein_id="ADM11419.1"
FT                   /translation="MNLISASDRDIIVRMDETLIVRDVFSGTTRKMTAPPLISFMSGKY
FT                   LVDKEKNLHVVDGPVLRNASKLNRNIFCLVEHEGTAYVADRFGDVYRIENEGCKYVLGT
FT                   LSYLTGMAIYNGRILLSDKYGRIRISEMNGRILDYRFGCDSIESLECVNGLLISISNKN
FT                   MVLYDEECFPRCTFKLPEGIRVMKTITKGKNELVVICLNSYFLFKIEKNSIGLVSHVKE
FT                   SIVDGACIGDLFYKVLPDLTVVDCQGRIFYE"
FT   gene            <158445..>159164
FT                   /locus_tag="Eint_041310"
FT   mRNA            <158445..>159164
FT                   /locus_tag="Eint_041310"
FT                   /product="hypothetical protein"
FT   CDS_pept        158445..159164
FT                   /codon_start=1
FT                   /gene_family="HOG000150239" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041310"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1330"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T5"
FT                   /protein_id="ADM11420.1"
FT                   /translation="MGNSKRHKTESSPNIVESTESGTYSESVSLESSSDEIVYEVADLS
FT                   VSNWTDVSILMDQSRMFPSSEEFLSLFVNSKVLVSGDLILSFCGFLEVPKVLEMIHKKL
FT                   REALSSLISTAEKNKIKSSEVYIFYMERAANLPLEMILSLYRSLSLGRFKYMIFVSRVK
FT                   PCGKREVKNLMEDFKEYNPVDLSHIPVRGEEILLLSSHIAKKQIGMNNNIFRLFLMDRK
FT                   MFESFIKLFEKEISKSI"
FT   gene            <159226..>160029
FT                   /locus_tag="Eint_041320"
FT   mRNA            <159226..>160029
FT                   /locus_tag="Eint_041320"
FT                   /product="hypothetical protein"
FT   CDS_pept        159226..160029
FT                   /codon_start=1
FT                   /gene_family="HOG000150238" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041320"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1340"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T6"
FT                   /protein_id="ADM11421.1"
FT                   /translation="MDEAVEKLELVLESKVENLPEKIMDALEDLVQASLECSSEEMVEY
FT                   ELDEILINAFDKTSHKDHKRLMEMLLDLMSCMRDPRNIYPAVEKYFSPECNFSMDAAKV
FT                   IFVMKRDFGFEFDGFLSTLLDCIRPENIENDTERRLFFILMVLDNGSVPLVVTKAFVKK
FT                   LCNVSLQVKSSCCHKILWGVLWIMRFHPMAYAMAKRESFEKDLEWNVSVTINQFQPYLF
FT                   ELDILSESLKGIQKVVSLIKREAMDAKNRPKLLSLDNVIFPKLEI"
FT   gene            complement(<160057..>160830)
FT                   /locus_tag="Eint_041330"
FT   mRNA            complement(<160057..>160830)
FT                   /locus_tag="Eint_041330"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(160057..160830)
FT                   /codon_start=1
FT                   /gene_family="HOG000150237" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041330"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1350"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T7"
FT                   /protein_id="ADM11422.1"
FT                   /translation="MEGCSHPWIDNGACTSCGLCLESDCDNYMASYTFHRPVIPRRMKY
FT                   FVVDKAERYSRNVESLLGILNVSGYSEEVKLLLRTKDFEHRIGANDKILAITYNVLRRH
FT                   QYPISYSDLKPLTERTGLGLKRILLREFEYVELSSEYLSRIFSRVRDFCLSQGLKGNHL
FT                   LEEFLSISKSNKCTSSYCLCIAYFIRDENLPDSHRRLNLGEIISVSSLKRIVKKIQGDL
FT                   QRNGDRPSETKKKLRIKDRARKYIMRKLQEQPQKD"
FT   gene            complement(<160907..>161197)
FT                   /locus_tag="Eint_041340"
FT   mRNA            complement(<160907..>161197)
FT                   /locus_tag="Eint_041340"
FT                   /product="40S ribosomal protein S10"
FT   CDS_pept        complement(160907..161197)
FT                   /codon_start=1
FT                   /gene_family="HOG000149468" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041340"
FT                   /product="40S ribosomal protein S10"
FT                   /note="similar to ECU04_1355"
FT                   /db_xref="GOA:E0S6T8"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T8"
FT                   /protein_id="ADM11423.1"
FT                   /translation="MLVPTVNKYKIKRRLLEKKALLLEDTVLGNHKDLEIPNLQLKAFM
FT                   KTMISYGYVQKIHVWRHSYFLLTPLGESRLREELVFTDESINSQEAPTVAV"
FT   gene            complement(<161574..>161918)
FT                   /locus_tag="Eint_041350"
FT   mRNA            complement(<161574..>161918)
FT                   /locus_tag="Eint_041350"
FT                   /product="CutA-like periplasmic divalent cation tolerance
FT                   protein"
FT   CDS_pept        complement(161574..161918)
FT                   /codon_start=1
FT                   /gene_family="HOG000222826" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041350"
FT                   /product="CutA-like periplasmic divalent cation tolerance
FT                   protein"
FT                   /note="similar to ECU04_1360"
FT                   /db_xref="GOA:E0S6T9"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6T9"
FT                   /protein_id="ADM11424.1"
FT                   /translation="MHHPDNIPQRKPFVVFTTYPTRESAEKASYELVNRRLAACCQISK
FT                   ITSVYSWDGSVKRETEYKLAAKTFSSLFVKIQEFMAEDHPYEAPQVVGIEIHSMSEQYL
FT                   RWMNLNTDAI"
FT   gene            <161910..>162983
FT                   /locus_tag="Eint_041360"
FT   mRNA            <161910..>162983
FT                   /locus_tag="Eint_041360"
FT                   /product="hypothetical protein"
FT   CDS_pept        161910..162983
FT                   /codon_start=1
FT                   /gene_family="HOG000150235" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041360"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1370"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U0"
FT                   /protein_id="ADM11425.1"
FT                   /translation="MVHGSLQKVLNICLPRIFEMARTRGILGLVNPQDLLFKAVFIEKR
FT                   LPKHHLKEISISAIVLKVMSQDISIREGGLVVIGLSRILVRKLKYLQDECSDVVHKIWR
FT                   KKGEKGKGLRSVSSKGITLGLDLERLYIDDQMISPEEFVILPEEENIDGIQEIEDLSFG
FT                   GFNDISYVEEGRFGTEDSTRASTATEITQIPLEERREKRRKIIEDLELEFDAREFRENL
FT                   RNTGDIVFREKSLDIRDELVSKLSIAPEILSKICRREMYQRESIEGVRDTVIMESYGDI
FT                   SFGDNINESQVSSEVVEEDCLDIEKLPERFVFNEMADGHSRYERSRMFLSLLNLLGSGM
FT                   AMANQRAAYSNIECNLL"
FT   gene            <163036..>163632
FT                   /locus_tag="Eint_041370"
FT   mRNA            <163036..>163632
FT                   /locus_tag="Eint_041370"
FT                   /product="60S ribosomal protein L13A"
FT   CDS_pept        163036..163632
FT                   /codon_start=1
FT                   /gene_family="HOG000225289" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041370"
FT                   /product="60S ribosomal protein L13A"
FT                   /note="similar to ECU04_1380"
FT                   /db_xref="GOA:E0S6U1"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U1"
FT                   /protein_id="ADM11426.1"
FT                   /translation="MEKKEHFIIDATGQVAGKLASKVAKLLLEGVRVTVVCCEEAVFVG
FT                   SLEKAVNKFKAYLNKRCIVNPRRGPFHFREPRMHLAKIIKRMISYKKPRGKVAMSRLTT
FT                   YEGIPRELEGQPRHKVTCALVKYTSNPNRYVTLGKLLSMFGWKHAEAAKSLTDELKERE
FT                   KLESLKREEMNRKIEELRRNKSFEDEVNKKLEMLA"
FT   gene            <163690..>164010
FT                   /locus_tag="Eint_041380"
FT   mRNA            <163690..>164010
FT                   /locus_tag="Eint_041380"
FT                   /product="hypothetical protein"
FT   CDS_pept        163690..164010
FT                   /codon_start=1
FT                   /gene_family="HOG000150234" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041380"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1390"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U2"
FT                   /protein_id="ADM11427.1"
FT                   /translation="MKKQKLCYKKNTYINKNIKFRTLKQLIPELIEKDHRYIQISNRVS
FT                   VRPGMKLCDLTGLPAPYTCPNTRLFYYDSSVYKRICELPSDRIQKLFQLREFGKTLVSL
FT                   RR"
FT   gene            complement(<164044..>168225)
FT                   /locus_tag="Eint_041390"
FT   mRNA            complement(<164044..>168225)
FT                   /locus_tag="Eint_041390"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT   CDS_pept        complement(164044..168225)
FT                   /codon_start=1
FT                   /gene_family="HOG000205401" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041390"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /note="similar to ECU04_1400"
FT                   /db_xref="GOA:E0S6U3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015699"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U3"
FT                   /protein_id="ADM11428.1"
FT                   /translation="MVMKFHPKKISFGVYSEKEIEQASCMDVTEPSTFDKFGHPVRGGL
FT                   YDLRMGPLDFSSNCKTCNLSLLNCPGHFGRIKLFKPVFNPIFFDSLLSLVRCCCFQCRH
FT                   FRITNYDRLIMFCKFSLLRNGEEIDGLDELYATSEEEELYSVVSKRVESSRKNRPGPPT
FT                   DKYQEMVRHFFSSINSKKKCVRCGHANPKIYKGTNIKILKSLQRDDENSENEKDSELLF
FT                   PDFIRELVEDLFSNEADLIGSIFSTKDPNMFFLTSIPVTPNRFRPVSFLNEKKAPNPQT
FT                   FSFNDILTINELVKKDLSYWPELQGAVLSSFDNSNLRKRNIGLITPPGHKQILEKKEGL
FT                   FRKNIMGKRVNFAARTVISPDPNLETREIGVPFVFAEVLTFPERVTSFNVSKLKKAIVN
FT                   GSTYPGSLYLQDGDVMLSLSHMPDEKRFALANQLLDGKKVVWRHLVDGDVVLVNRQPTL
FT                   HRPSIMAHKCKVLKGERTLRMHYANCKSYNADFDGDEMNIHFPQSYVAEAEARHIVMND
FT                   FNYLVPTDGKPIRGLTQDHIVAAAILTMKNSFFSEEDYFTLVNSGLDGRRITIDKPCIL
FT                   KPVRLYSGKQVLSAIIKNLGLGLNIEIETKVPKDAWREHSEESVLRISEGNIITGILDK
FT                   NSIGPTFKSLAHACGEIRGFAASNDLLTYIGRVCNKYLQMYGFTIGADDLILSNDANAK
FT                   RKKVMETKDKKVRELQKEYMEANPDFYLCDDKKAYLDSIMRREMNKITSEIVNASVPSG
FT                   LKKGFPDNGMELIVSIGSKGSIVNLSQISGALGQQELEGRRVPVMASGKTLPCFKPLDP
FT                   DPSSGGYIYQGFLDGINPSQYFFHCMAGREGLIDTAIKTANSGYLQRCLVKHMEGIKVE
FT                   YDRSARIGKKIVQFVYGEDGLDCTKSSYLDDPEFFRRNAFLFKELSLSSFKLSNRYEDF
FT                   LSPRFKKEIEFFDEELKRFLESRYVCSLADPGESVGIIAAQSIGEPSTQMTLNTFHLAG
FT                   VGEKNVTLGVPRLREILLVASKSIKTPLVTIPIRKKLNFDIGTCLKKITLKDCVRKFRV
FT                   SEEIVMIDGVFQKKIRMVFDLDNFVDLASEALDRKFLKILGSKLKMLSKVKYKLGMEEG
FT                   NKDSSKELDENKENEEEDESDSDEESNSKSDYICVDTSENENTEKDSDDTTHPETIDEI
FT                   DHTDNSSSTEEENLINFTRKSKNILSFEMLYPSGFNEVISSIIESILPTVVVRETKGIK
FT                   KASISGNTLFVESPSISSLTGRIEVAPGVYEDLLDLLDIYNSESNDIYNVYLTLGIEAA
FT                   RHAIINEVVKVFDVYGISIDARHLLLVADYMTRKGDYSPFSRHGLGIGDSLIQKMSFES
FT                   CYSNFKTAAAFHLEDQLSNPSASITVGNPVKCGTNSFDLIYNVDFFNNKV"
FT   gene            168307..168379
FT                   /locus_tag="Eint_041400"
FT   tRNA            168307..168379
FT                   /locus_tag="Eint_041400"
FT                   /product="tRNA-Met"
FT                   /note="tRNA Type: Met, Anti Codon: CAT, Cove Score: 62.58"
FT   gene            complement(<168450..>170252)
FT                   /locus_tag="Eint_041410"
FT   mRNA            complement(<168450..>170252)
FT                   /locus_tag="Eint_041410"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(168450..170252)
FT                   /codon_start=1
FT                   /gene_family="HOG000150233" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041410"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1410"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U4"
FT                   /protein_id="ADM11429.1"
FT                   /translation="MIILMIMGCYAIQDELTSRCQRYGISLNDCLNSVYLPKREYDEYL
FT                   QSFNLPIVRDSSCNKGRCMAVVYKDVNKCMNCRKEDCRDECKELEWMREGPSNGPMDSY
FT                   RRNSEPPIPFIHVIHHKDTNKSNSAPATKTEEVPLVSYKSITVIETKTETVSEHPATIS
FT                   RDEQKKDTHVTEDGKTCETKKEDTKTIFKTVEIPVISEKVSQLTRSERPEKQRKYDDNI
FT                   RKTPVKEGEGSTLISSSVKRSKLKDSSLDDDKIDEVSEAEKGFEDDEKEKGEPTVVTVT
FT                   RVFYKTVSVEKPITLYREVTTTVKSEVPIINYKLTTVKEISTSTKTESSVKTETVVQTQ
FT                   YSTIISTKAPHGQEIPKVPEESISMRAPIISGETSKRNEETQKSTKTIDSSSSDPSTSE
FT                   FPSVVYRTITKPTVSVLTVTKTEEVTTQTASRSDPSQNPGSQKGEGVSASISLPASISL
FT                   ICTEKCLTVSVPETSEKKEVFSSVAASLSDTQGFMNTGRQDIIAELLPLVRKVLIEDLE
FT                   ETKCTKTPKQSSHLEMASDLVKTVTKTVVKTVERETKNKGGHKTVYNTVYSYKKKPNCR
FT                   KGVEGKKRKVCKESEEQFVTTVYV"
FT   gene            170364..170435
FT                   /locus_tag="Eint_041420"
FT   tRNA            170364..170435
FT                   /locus_tag="Eint_041420"
FT                   /product="tRNA-Pro"
FT                   /note="tRNA Type: Pro, Anti Codon: TGG, Cove Score: 46.16"
FT   gene            <170525..>171562
FT                   /locus_tag="Eint_041430"
FT   mRNA            <170525..>171562
FT                   /locus_tag="Eint_041430"
FT                   /product="hypothetical protein"
FT   CDS_pept        170525..171562
FT                   /codon_start=1
FT                   /gene_family="HOG000150232" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041430"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1420"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U5"
FT                   /protein_id="ADM11430.1"
FT                   /translation="MEEYTLCSSSTEQGEIPVIHIKRFKEAPPLFPRNKSQLQYMYLPN
FT                   KSLFIGPNTIPRSSDYQVNVLTTKLKKRLKHDLSHPFLCLSMNSDRSFFEGRFTFVSTV
FT                   QIPESVEEMCFVKGKERIVHVKEKTDVNTDVRKEIKFDHIKDKQNDSYKDVCQDFLLGK
FT                   LLEGIGDKKINIIIRDSTINNILSKEAYIHFYVKKKDEKLYIVFDEVYTREVKYYDYLS
FT                   KYGEEVVRSLKSSETRMYSSSEAVVVVYSSTLFYDSSGLHRLFSGIDVEKSIDMVVNIE
FT                   DVRAVKSSGSLGDELKVLFGIKFEEGEYVLNDKKIYVLEPSGEKFKFNGVVFTDFMDSQ
FT                   EPISD"
FT   gene            complement(<172167..>173177)
FT                   /locus_tag="Eint_041440"
FT   mRNA            complement(<172167..>173177)
FT                   /locus_tag="Eint_041440"
FT                   /product="RING zinc finger-containing protein"
FT   CDS_pept        complement(172167..173177)
FT                   /codon_start=1
FT                   /gene_family="HOG000150231" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041440"
FT                   /product="RING zinc finger-containing protein"
FT                   /note="similar to ECU04_1430"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U6"
FT                   /protein_id="ADM11431.1"
FT                   /translation="MIGDRHGIDYQHLRDKSIHIISEIQATLSRENNLEINNLPNIEAS
FT                   LVKLWKNLLPSDTKPTESDIQVGNQMYPNSMQTVTCLIVYYLLENDCGDIVDKLISEIK
FT                   DGKEEVMKVRDDYVRFKRTVSEVLGNSTGLLEEFLESHPSKELELYLVSHEFLLLINGG
FT                   RYDEALKLCFGKLKSFVPTYIQDVKPLLKFLVNPGNIQESLERSRERLIENFKSKYLEV
FT                   SGMPNGCYLQELFEAGTSAFLQLSSSGNLLFDKDDPALPIEIKMEKGRNYHSLFICPVL
FT                   KTLCIDGNIPVMLECGHVISLEAASVLSQEGVLNSFKCPYCPEMSKYENILRLRI"
FT   gene            <173562..>174158
FT                   /locus_tag="Eint_041450"
FT   mRNA            <173562..>174158
FT                   /locus_tag="Eint_041450"
FT                   /product="eukaryotic TATA box binding transcription
FT                   initiation factor TFIID-1"
FT   CDS_pept        173562..174158
FT                   /codon_start=1
FT                   /gene_family="HOG000105162" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041450"
FT                   /product="eukaryotic TATA box binding transcription
FT                   initiation factor TFIID-1"
FT                   /note="similar to ECU04_1440"
FT                   /db_xref="GOA:E0S6U7"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012294"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U7"
FT                   /protein_id="ADM11432.1"
FT                   /translation="MDVPDISCEHQDTSIPNSSGIIPTLQNVVATVNLNCKLDLKNIAL
FT                   RARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKL
FT                   GFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLL
FT                   IFVSGKIVLTGAKVRDDIYRAFNNIYPVLIQHRKT"
FT   gene            complement(<174230..>174625)
FT                   /locus_tag="Eint_041460"
FT   mRNA            complement(<174230..>174625)
FT                   /locus_tag="Eint_041460"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(174230..174625)
FT                   /codon_start=1
FT                   /gene_family="HOG000150230" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041460"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1450"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U8"
FT                   /protein_id="ADM11433.1"
FT                   /translation="MVKFKLVKAKMSVEIGPEFLENPMKAVSKCMASKLLIYSHKLGGI
FT                   PLSFAIKDIEHSGTVICETGSVEVTASSEYVVLTLPVGGVMSSFEGRTLGIFNTDVDGS
FT                   KEYTGDFIVKGIKLEARSFFTIVGTHS"
FT   gene            <174681..>176738
FT                   /locus_tag="Eint_041470"
FT   mRNA            <174681..>176738
FT                   /locus_tag="Eint_041470"
FT                   /product="cyclin B-like guanine nucleotide binding protein"
FT   CDS_pept        174681..176738
FT                   /codon_start=1
FT                   /gene_family="HOG000149467" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041470"
FT                   /product="cyclin B-like guanine nucleotide binding protein"
FT                   /note="similar to ECU04_1460"
FT                   /db_xref="InterPro:IPR001194"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6U9"
FT                   /protein_id="ADM11434.1"
FT                   /translation="MNLITGYFKHTRKVQAVEYGEISEVYISSLLEHNGPEEYLVSDGN
FT                   GRIPVFKCIRNADKAEFDGYLKYKLGKKSRRFRLAEGQEGEVSILIDGKYSYILMEESS
FT                   VPTKYLIFSEGSLKEREIIFSPSTEDIEEEIGKCDSKAQNQVVLCFLKSVKVQYHSQFL
FT                   YFYVSNVETIYGQVLVSWIDGTMVFHTLTSLLFLNFNELFSSFSLLSTVYGIPYLPHTN
FT                   FTISYKWQKIYESNLYEFSWNYPSKFLMEVITLILLEERIVFCSRKDSSLRVLQIIELI
FT                   RPFRWPHIVCLPLLPGMEEILESPLPFITCLNKKPNTEDLVIIDLDGLRVYRPRKCALL
FT                   PNKKTKVGAPKDHQKEIRDSIELIATEILLWREYLIKKWGSKVITRIPNNPLEFIGKVH
FT                   GFYADFFRTRMFLAFITEERDYLCRYLIEIGDDYSVILLPYAQLDGSMYTKALRLWIEL
FT                   FEGDIEPVIEHLIRDELLSDVADMVFRRLSYREDYRKIDMVLSHILSPTHEMYMNINIV
FT                   SKMSKVVFKDLYSYDVYHLRACDCRTLDLGRLRCREDSAWRKEEKAMENARRKVRELIG
FT                   GMKQDLFDPLKERCECKSKKSVVLVSGPGYVFLCFLLVPENISLMLKYYGSENLFEKNP
FT                   QVYWSIVMYFLYFSLPLGGHSRLDKEIDVIIDEPVLPLRIDGKPRLYLDF"
FT   gene            complement(<176793..>178037)
FT                   /locus_tag="Eint_041480"
FT   mRNA            complement(<176793..>178037)
FT                   /locus_tag="Eint_041480"
FT                   /product="Na+/H+ antiporter"
FT   CDS_pept        complement(176793..178037)
FT                   /codon_start=1
FT                   /gene_family="HOG000149466" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041480"
FT                   /product="Na+/H+ antiporter"
FT                   /note="similar to ECU04_1470"
FT                   /db_xref="GOA:E0S6V0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V0"
FT                   /protein_id="ADM11435.1"
FT                   /translation="MDDIFVLLLASSSFVLLFGLVSKHVKNNLLLSESLISVLVGIILG
FT                   HHALNVFNTNYVYSKVIMYNFSRMVLCIQTMTVAMSLPKNYILEKWQSIFVLVGVVGII
FT                   KCSFSFGLVYLFTNYNMPISWSLASSLTPTDPILSSSIIHGKLAMKMVPERIRLLLAAE
FT                   SGINDGMGIFLLFLGLDLLSLGPEKGIYPFVVNNLLIRVFLSALIGLSAGILSRQSLKY
FT                   CYTKRLVGVESFLAHSVILTVFSIALMEFIGGSELICIFFAGIMFSFDEWFVLETKNSN
FT                   LQEITDTVLSTSFFLFFGSRIDFRRFTLSNVIVSLVILFVRRPIICYLIYRQIPELRSR
FT                   REALFVGWFGPVGVGALYYALLTDKIQETLTIDFVSCTVFLSVVIHGLTVPIYTYMKRE
FT                   RLDSDYEGQARSEIF"
FT   gene            complement(<178212..>178859)
FT                   /locus_tag="Eint_041490"
FT   mRNA            complement(<178212..>178859)
FT                   /locus_tag="Eint_041490"
FT                   /product="zinc finger domain-containing protein"
FT   CDS_pept        complement(178212..178859)
FT                   /codon_start=1
FT                   /gene_family="HOG000150229" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041490"
FT                   /product="zinc finger domain-containing protein"
FT                   /note="similar to ECU04_1480"
FT                   /db_xref="GOA:E0S6V1"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V1"
FT                   /protein_id="ADM11436.1"
FT                   /translation="MEDKEGYERVVKDNTKETDMKCASCGWPGKMNIVDLDDTTENVIC
FT                   AFVCEKCGDRSVKFLEKTYDKRGSVRIECFFDRKEDLTREINLSQMASVEIISENLSFK
FT                   ISSTYPSIQNVESFLIQGKDQIKNLCGKGNITTGPGGEVLRNPDVSKETCEKKLEDFRD
FT                   LMSNPKFKLIIEDDFGLSRVAPVGKNVLELRNADVSELNDDKVKHIFKKKSE"
FT   gene            complement(<179055..>180593)
FT                   /locus_tag="Eint_041500"
FT   mRNA            complement(<179055..>180593)
FT                   /locus_tag="Eint_041500"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(179055..180593)
FT                   /codon_start=1
FT                   /gene_family="HOG000150228" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041500"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1490"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V2"
FT                   /protein_id="ADM11437.1"
FT                   /translation="MGDYTYKKKDSGIYDTLNMLVYDYLLKMKYEGSAKLFINEAGIGD
FT                   FKPGDGMPVLAQWYAAFHDISAVRSGLSSNLQDLSRIEGIMMKLENEKRRYQHIGRMDP
FT                   TAMGYGGGMDPYKQYPMYYQHQQFDQRKMYEMYGQASPTADGGPRFYDPRKGGASGPGY
FT                   RASQGYSRYPRFEEQNVPSGKVPPRNFRDEGRNGNAVSPSLAPSQGDSSPLFESGVGVG
FT                   DKVFGLKEAMSFVPNEHVTVCSAVAKDHKLLFVASSNKTITAVNLLSGKKELGVETDGK
FT                   QVVEMKIKEHSNDILIVCGTGGNELLLVRCIVKEGMSLEVSGTLRGHAAPIVSYEVLDS
FT                   IHSLDSGGMMRKWNLEGMFEREEVLSGEILHICCISEDNFMFADRQRVYVYDFELNIEM
FT                   MEILKGQALGIKRVKEGFIVVFRNQVIWLDKRIQKVKVLNVNENIRTATLIDENLLAAS
FT                   SHSVWFDSGKSLTKMKLHESNIIGLDSVNIFRKSSIVSCSASGECKVWIRHIGD"
FT   gene            complement(<180775..>181854)
FT                   /locus_tag="Eint_041510"
FT   mRNA            complement(<180775..>181854)
FT                   /locus_tag="Eint_041510"
FT                   /product="alpha-tubulin suppressor-like protein"
FT   CDS_pept        complement(180775..181854)
FT                   /codon_start=1
FT                   /gene_family="HOG000149465" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041510"
FT                   /product="alpha-tubulin suppressor-like protein"
FT                   /note="similar to ECU04_1500"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V3"
FT                   /protein_id="ADM11438.1"
FT                   /translation="MSVFVFGSNAISQLGLGEDEGSTHVPTRLSFFDGMSLSKVRCGSL
FT                   HTLVLDTSGTLYSWGCNDEGALGRGGDESTPEKVCLQEKVVDMDCGASISAALTSSGHV
FT                   YVWGTFRSTNGTFGLTPSEGISFEPVKVPLKNIRALSAGQSFIAALDSKDVIYTFGSNE
FT                   FGELGRRTSERNKLRALIPDAVTTPRKRLQNHRFKSIASGLNHLIALNTDGEAYCWGSN
FT                   LYGQLGHDKAESTFNKYKVPLDGISQAVGGENHSLFVTKDGSLYGSGRNKEGQLGIQNV
FT                   ENLKSPTKLGLSGVEAVRSYNSFSIGKVGNELYSWGTGFNGALGHEEETLFEPKKIPYE
FT                   FPEVIDFDVGNDFSVVVTK"
FT   gene            <181924..>182781
FT                   /locus_tag="Eint_041520"
FT   mRNA            <181924..>182781
FT                   /locus_tag="Eint_041520"
FT                   /product="methionyl-tRNA synthetase-like protein"
FT   CDS_pept        181924..182781
FT                   /codon_start=1
FT                   /gene_family="HOG000150227" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041520"
FT                   /product="methionyl-tRNA synthetase-like protein"
FT                   /note="similar to ECU04_1510"
FT                   /db_xref="GOA:E0S6V4"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V4"
FT                   /protein_id="ADM11439.1"
FT                   /translation="MKLEFSNGFEDLAFVLKYFNADSSLEKVESGLRLTDGGEEYVGLD
FT                   NVLAFLYRTYEPGHNNKSIKETKKLRESPEVRKVEESISSLVSFYGLYRQMITQGILKN
FT                   KVFIDQMVEHIRPRMSLDSDFQLLDIQVGEIVDIGDVQGLDKLYSERVVAKEEIRVLSG
FT                   LKGYVEKEHLLGNKFLFVTNMKPAKFKGETSEGMILCGKDKDGKIEPILIPKEIQNGAR
FT                   LGLEGFEMLLNDFSSGKVDMRKSGYAHALESFKIIDHFLTFKGIKVTCEGKFIKTHTSD
FT                   GLVS"
FT   gene            <182867..>183613
FT                   /locus_tag="Eint_041530"
FT   mRNA            <182867..>183613
FT                   /locus_tag="Eint_041530"
FT                   /product="hypothetical protein"
FT   CDS_pept        182867..183613
FT                   /codon_start=1
FT                   /gene_family="HOG000150226" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041530"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1520"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V5"
FT                   /protein_id="ADM11440.1"
FT                   /translation="MEVKNGIDYVFRGSRDEVKQTFKFQGSAIVLTPYRSKCSGLAYLE
FT                   DSEEIVMTPKMALERSFDKMKGGHVIVEDCELMDGFGYMEDLICLKRKGISFILLNAQK
FT                   VPKFAENPVFISSNRYFIKATKDERYAAIFALCKIYKNVCIICKDVERMKMFSEIFKLN
FT                   LDVVGHGDAVDGRSVVIVMDGLVNIKCEKLFYVGDKCKGMKTMVLDTSKIGKFLYRVRD
FT                   VCNMLSPGVVRGKKELNINRFRGIEK"
FT   gene            <183661..>184653
FT                   /locus_tag="Eint_041540"
FT   mRNA            <183661..>184653
FT                   /locus_tag="Eint_041540"
FT                   /product="hypothetical protein"
FT   CDS_pept        183661..184653
FT                   /codon_start=1
FT                   /gene_family="HOG000150222" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041540"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1530"
FT                   /db_xref="GOA:E0S6V6"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V6"
FT                   /protein_id="ADM11441.1"
FT                   /translation="MVSSPDSKVFGENVIDEKLVRKLCFGGVRNKYRGVAWRILFQVVG
FT                   LKKQFHREEVEVGHAKYAEMVARMGCSCQMGEYFYGGRDLNIDKSSLENLNKTKHHALK
FT                   LPEKIVHQIDLDIKRIDLRYRTYLGVDISYMYYRVLWLIAYKRPLLGYIQGMADILVPF
FT                   VFVFSHEDVERAESNAYFCYARLLDETQHNIMDLQTGMIKSLDFVLQMVDPDLHKFLKD
FT                   IGLEIHMFAFRWFNCFFTREFKIPILLKVLDTIFSSDSINESLLYFGVALLMKFKPVLI
FT                   ENDFSHNILFLQSIYEQTWEEAEIELVLSSAKFYRKVTSKQLLWSRFWG"
FT   gene            <184743..>185318
FT                   /locus_tag="Eint_041550"
FT   mRNA            <184743..>185318
FT                   /locus_tag="Eint_041550"
FT                   /product="hypothetical protein"
FT   CDS_pept        184743..185318
FT                   /codon_start=1
FT                   /gene_family="HOG000150221" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041550"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1540"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V7"
FT                   /protein_id="ADM11442.1"
FT                   /translation="MNIVFLLLGKVISDAFSQLPVLRKEDISLDDAFLVYIYYSRPNVH
FT                   CPACESFNQSISDLQKYIPVKKINFFEDPKIASRFYTFLFPSFVVRDKGRSYHLDVDSF
FT                   EELEEIIRDRKWTQFKPIRLWMDVDSYFINMYSLANCIFFKAMQRLYVVFDTVPEWAIN
FT                   FGFSAIIGYMVYSICLVFMVPPSDKKKE"
FT   gene            <185385..>186041
FT                   /locus_tag="Eint_041560"
FT   mRNA            <185385..>186041
FT                   /locus_tag="Eint_041560"
FT                   /product="mRNA capping enzyme subunit beta"
FT   CDS_pept        185385..186041
FT                   /codon_start=1
FT                   /gene_family="HOG000150220" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041560"
FT                   /product="mRNA capping enzyme subunit beta"
FT                   /note="similar to ECU04_1550"
FT                   /db_xref="GOA:E0S6V8"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V8"
FT                   /protein_id="ADM11443.1"
FT                   /translation="MEDLTKILKEAVKDHTEYLRKFILAFKNDRKELEIRLGRIVSKED
FT                   GNRMKLDTVAPVVFKNIPAEYRFESAVDLADFNSLKRLLSSFKSETKNDVVIINEDGRE
FT                   TYENGELKKVEKKTRSEKLDIYIPGKKYDVRLVLNEEKEVFKRASKKKAIMKRTRRRET
FT                   YFIEPYGFDFTEAILSGEREEKRKFEVEVEVFSSEKLVSSDFVSLIYNFNVDSLV"
FT   gene            <186194..>186838
FT                   /locus_tag="Eint_041570"
FT   mRNA            <186194..>186838
FT                   /locus_tag="Eint_041570"
FT                   /product="GTP-binding nuclear protein"
FT   CDS_pept        186194..186838
FT                   /codon_start=1
FT                   /gene_family="HOG000216664" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041570"
FT                   /product="GTP-binding nuclear protein"
FT                   /note="similar to ECU04_1560"
FT                   /db_xref="GOA:E0S6V9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002041"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6V9"
FT                   /protein_id="ADM11444.1"
FT                   /translation="MERRELTYKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNH
FT                   PVTFLDDQGNVIKFNVWDTAGQEKKAVLKDVYYIGASGAIFFFDVTSRITCQNLARWVK
FT                   EFQAVVGNEAPIVVCANKIDIKNRQKISKKLVMEVLKGKNYEYFEISAKTAHNFGLPFL
FT                   HLARTFTGRPDLIFVSNVNLEPTEVNYDYHSPEETKYIDYMEQAAKMAPEE"
FT   gene            <186925..>187284
FT                   /locus_tag="Eint_041580"
FT   mRNA            <186925..>187284
FT                   /locus_tag="Eint_041580"
FT                   /product="hypothetical protein"
FT   CDS_pept        186925..187284
FT                   /codon_start=1
FT                   /gene_family="HOG000150219" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041580"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1570"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W0"
FT                   /protein_id="ADM11445.1"
FT                   /translation="MEKKFPTVVTIGGRRYVKNNINKSSVDGRMKLREAIKSLGRKVQK
FT                   SKISHCTIESKTSLHAYKLDDSKVLFNKNNKPIGFIVTGKSETIEKAIGKEISRKIDGE
FT                   DVPKESENIEREEKP"
FT   gene            complement(<187322..>188206)
FT                   /locus_tag="Eint_041590"
FT   mRNA            complement(<187322..>188206)
FT                   /locus_tag="Eint_041590"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(187322..188206)
FT                   /codon_start=1
FT                   /gene_family="HOG000150218" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041590"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1580"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W1"
FT                   /protein_id="ADM11446.1"
FT                   /translation="MILTDEAFSEFRQSKSLGPDTSPEEVEYSTDGLLLSTTQNNILRL
FT                   YSSVSGNVQNIIHVPSIQKYKFLYPNALVHAASNSLHLLSVFDNKYVRTFIGHKSQINS
FT                   LSVCPMEDAILSSSFDSTSYWDIRKKNPVYRINVTNSISSLSLSNDYATLINDTLLKVY
FT                   DKRNPKGPKNTSSLPERRYKEIFYSTDGNFIIASDEKGHLFLGPDGAIKSSISLEKGSN
FT                   GCVTPDSKFFLCCENSSIFVYHLKTKRRLHTYKAHGFDNAKVRFNPCYAQFVSSSSLLN
FT                   IWAIEEHTESFQD"
FT   gene            complement(<188321..>188905)
FT                   /locus_tag="Eint_041600"
FT   mRNA            complement(<188321..>188905)
FT                   /locus_tag="Eint_041600"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(188321..188905)
FT                   /codon_start=1
FT                   /gene_family="HOG000150217" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041600"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1590"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W2"
FT                   /protein_id="ADM11447.1"
FT                   /translation="MGLCLEKIEKSISYMDDTYDANFGEWIRNEDNARIVAYNMKKYVD
FT                   NYKTSDFIIVVKWIVKDWTLKSIIIFSKKMLVEDIKVLSFRRTEEDKEKYNKRVRIISG
FT                   LIFTWNPVFITEFMVSITRSFAANEKSRLLISLLEAFEPRKLSEILSQLETKIDQKAWN
FT                   ELFKTFNEEASKKSRPRSKRTASILRAYNLS"
FT   gene            complement(<189254..>190105)
FT                   /locus_tag="Eint_041610"
FT   mRNA            complement(<189254..>190105)
FT                   /locus_tag="Eint_041610"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(189254..190105)
FT                   /codon_start=1
FT                   /gene_family="HOG000150216" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041610"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1600"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W3"
FT                   /protein_id="ADM11448.1"
FT                   /translation="MFCFQLNIIIISKMDDMIRKASFNGGILHMEFSESDLLMCIGNTL
FT                   HILNMNGLIREDVLLPSNEVKEILKFKDIVFLEIETYGHYYFKIDNPILVKIECRIEKI
FT                   HVGNNVIFSHGCGISFLDIQTFQPWHIVTMPSKIVDFAEVGSDIYVLVEDHLCLVQYLA
FT                   RNRKEVSIKSIGFLSHLKFVSATSNKLDLLILESNYELILYRGETLKSIRKGKNYRGFK
FT                   IFNTILIFLLSDGIEMYSLNSHRTLVKLYFPPKAIAYDSHRKILWLYSDFLYEVDVSKL
FT                   AI"
FT   gene            <190590..>192425
FT                   /locus_tag="Eint_041620"
FT   mRNA            <190590..>192425
FT                   /locus_tag="Eint_041620"
FT                   /product="transcription initiation factor 4F subunit-like
FT                   protein"
FT   CDS_pept        190590..192425
FT                   /codon_start=1
FT                   /gene_family="HOG000150215" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041620"
FT                   /product="transcription initiation factor 4F subunit-like
FT                   protein"
FT                   /note="similar to ECU04_1610"
FT                   /db_xref="GOA:E0S6W4"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W4"
FT                   /protein_id="ADM11449.1"
FT                   /translation="MIKKIIHRPKKPLFVFRREESLLYGPRVKSAPPIEINFETPTRVE
FT                   PKPAARFTRPDGTPIREEDLIDSTDSDASSESSVEAENKIEDVPPETNANAEIHEEEEV
FT                   ECKEEKPIQKDDRPSLEDRALMLNNLLKRFSEQRITERRGPCYKIDEILNTKERTAIPL
FT                   ELKIRIRRELKGVYRPDSSRKDTCIEQARLEFNRLTAKNIGLVIKNLKSIRVGTIEEMK
FT                   EVSNILFDKAISEPTFVKYYALVVLDLKKEWQSEEEKSRDVSQTVFFGTLLTLTLKTLE
FT                   NKERWGDEYKKKKDMTFEERIAYEEKLEEAETERYIKKRRTLGTIDFLSSLYSLNVISY
FT                   VHMNACINTLMKSDDPENIEVLCYLIDNIGEKLVVSGKEHIISMICSSLVQKKSNYTNR
FT                   IRYMIESLLDKKNSWKSKELKAVNVFSCLEVENDYGNTQDPESQEPHKEDVLPFLASLS
FT                   EELSMAYEDDDKELLSDNLQSGETKFGVVPFYLSYFQEAISNHKISDLFFDFFISFRNT
FT                   ASITEGQLKEVLLSLKNELEILKIDFPISPKKYAELITKLRVSKIISQSLLEELKTPDY
FT                   DARIGDLILKWYRSDKDREKALTIFPRETIENLTK"
FT   gene            complement(<192485..>193072)
FT                   /locus_tag="Eint_041630"
FT   mRNA            complement(<192485..>193072)
FT                   /locus_tag="Eint_041630"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(192485..193072)
FT                   /codon_start=1
FT                   /gene_family="HOG000150214" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041630"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU04_1620"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W5"
FT                   /protein_id="ADM11450.1"
FT                   /translation="MAKNDLERSREDLESLAKRIIADHMRFVCADKALMLWNKRFPRHN
FT                   ESTNDGEFYSSIATRKRILSFIEKEKTDEAFRVCESLKLFDLGTESVALVKEALSKLVF
FT                   VDLLRAERHTEAIKFARTFINDENENDKLFTLIGYKDVSDRRFLEIANIVRRESVVEAL
FT                   NKHLFKKEVGRELSLLSLALNHYNSILKYQRK"
FT   gene            <193380..>193640
FT                   /locus_tag="Eint_041640"
FT   mRNA            <193380..>193640
FT                   /locus_tag="Eint_041640"
FT                   /product="hypothetical protein"
FT   CDS_pept        193380..193640
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_041640"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W6"
FT                   /protein_id="ADM11451.1"
FT                   /translation="MILSNVLFECWYSAETLEAPIIMATNINCKKKWHPSRYETQIRVK
FT                   EAEQAIEKNKTQENTRKELGRRETLEFEVQKEKAERMQWML"
XX
SQ   Sequence 193740 BP; 56972 A; 39662 C; 40637 G; 56469 T; 0 other;
     ttcaatcctc ttcccctctc cccacatcga ggaaaaaatg cacagcctca aaatgtcgga        60
     ttactcctcc attcgcacag cttgcatcca taacggtcgt cttccgtcca catcacagcg       120
     cagtcagtct tcaggcttag aggccttcag ccattatact cccgacgtag ctccgcaaca       180
     gccagcaggc ttgccgctcc accagaggtc gcaatcaaga gttcctctcg tactatcaag       240
     atttactgcc cagtcaatca cagtagggta aaactaacct gtctcacgac ggtctaaacc       300
     cagctcacgt tccctgttgg tgggtgaaca atccaacact tcgcaatttc tgcttcacga       360
     tgataggaag agccgacatc gaagaatcaa aaagcagcgt cgctatgatc gctcggctgc       420
     tacaagccag ttatccctgt ggtaactttt ctgtcaccca tgtcccaagc cttataggac       480
     atgggatctc taggccaggg tttcccccaa acaatcccgc aataggaata gtctcaagca       540
     ggcttatgcc cttgtgctcc acgcgtggtt tccttccccg ctgagcccgc cttaggacgt       600
     ctgcgttagt ctttagcagt cgtgccgccc cagccaaact ccccacatcc ataaataaac       660
     cgctgaggct cagtcatagt ggtctcgcac atctcccccc acctctcttc ataaccaccc       720
     tcagcacttc tcacatgcta gagtcaagct caacagggtc ttctttcccc gctgatcagc       780
     ccaagcccgt tcccttggct gtaggttcac aatacaggtc gtagggacag tgggaatctc       840
     gttgctccat tcatgcgcgt cactaattac atgacgaggc atttggctac cttaagagag       900
     tcatagttac tcccgccgtt tacactcgct taagctcaaa aagccgtaac taaaagtgca       960
     ctgggcagaa ttcaccttgc gttcttccgc aaggctatgt ttttaataaa cagtcagatt      1020
     ccccacaaca aacagttcta gcacgctaga gccaatcctt ctcccaaagt tacacatcca      1080
     tcttgccgac ttcccttaca acccttctca aattcgcttc cgcgtcaaac agtggacacc      1140
     tgttgcggtc taggtacgac atgcatgctt ctttttcatc ggaacaggtc atctcctcag      1200
     cgctgcttcg tctcttaaca atccacaccg ctacttcccc tagttctgct ctcctaggat      1260
     caaaaatccc ccatccgtca tcatcaagtc gcctcaaagc atccatacac tcaatcttca      1320
     atcagtctcc gtttcaacag tcgattcacc cccatcaaat ggggaaccct cgtccacagc      1380
     gcaaatcctt tcttgttact actaccaaga tctgctcata tcacccctcc acccccgctc      1440
     acgcaggacc ttcgtcagaa tgatatcgcc ctcttactca gctccgccgc taaggcctcg      1500
     gatacctgca attcaatccc ttccattttc tccagcgccc aattcggtag gtacgttgca      1560
     acacgtttct tagcggatgc caacctccat ggccaccgtc caactgtcaa aatcaaaccg      1620
     ccagattctc ttcccttgca tacggctcct tatcctaaaa aaggttcatc ccttctcgca      1680
     catcatgctt accacaatat gcccactggc taccccctta caagacatct tcaaagttta      1740
     acgctatcgc attagtgctt tacaacatct tacatcaagt cgccgctgtc ctgagagaca      1800
     tttcagaggg aaccagctac cagatggttc gtttggtctt tcgcccctat gcccatctca      1860
     tgccatcgag ttgcacgtca gaacggctta gatcctccag aacactttcg catcccttca      1920
     atcaacacag gcatagttca ccatctttcg ggtcggatca ctgcatccac tagctctcgc      1980
     taaaacaatc cagccatcct ctccttggtc cgtgtttcaa gacgggcggg tctcatcccc      2040
     ttcaaagcat tcactttcat ttttcatctt gtctttttca catttcaatc actctacttc      2100
     ttcgctatcg gtcattagct tatatttagc tttcggtgaa aaaaaacacc acccaattca      2160
     ggctgcacta ccaaacaacc ctactcttct ctcaagtccg gatacttaca ggccattccc      2220
     cctctaagat cagggacttc aatccctagc tcagtctcct cctactcaaa acaacccgcc      2280
     aaacgcagtt accattcgag ctcctgtcct ttcactcgcc gctactccga caatcccttt      2340
     tggtttcttc tcctcccttt attgatatgc ttaagtcaaa ggggtcccca agcgcttccg      2400
     cttcattcag acatcctcaa aaaggcatat cgtcctccta cacgtccttc ctcgctgcta      2460
     atgcctatca atcccgtgaa tcctcaaatc aaaaaaattc cccccaatct ctcaaatact      2520
     gatcctgctg ctggttctcc aacagcagcc atgttacgac ttatatctta tctaacacga      2580
     aggactcaga ccttccaatc ttcgtccact gcgtcatctt agatagcgac gggcggtgtg      2640
     tacaaaggac agggacccat tcaaaacaac ttgttcaatc gttattacta ggaattccac      2700
     gttcagaagc ccattacaca gcttcatccc tcacagcagg ctccctcgcc atctatcgta      2760
     gtgcgcgtgc cgcccgcttc atctcagggc ataacggacc tgttctgttc cattcctccc      2820
     ttgccccaaa gagcactgtc aaagggtctc acatcttacg caacttaatc caaagctcac      2880
     gccatccatt tcaaacggcc atgcaccacc gccgcgcgca tcccgtcctc gttctcctgc      2940
     ccgcttcaga accggtaagt tgccccgcgt tgagtcaaat taagccgcac actccactcc      3000
     ttgtggtgtc cttccgtcaa tctcttcaag tttcactctt gcgagcatac tatccccaga      3060
     acccacatac tcaagatttc tcatgcacaa cactatatag tcccgtccag tcggcatcgt      3120
     ttactgctag aactaaaacg gtatctaatc gatttcgatc ctctagcctt cgtccttcat      3180
     cgtcacataa gtccaagagc acagccttcg cttctgtccg tccagtcagg gtcttcgtat      3240
     ttcacccctc gcccaactat ccggtgcccc tcgtcctctg ccaaacctct tacatccaca      3300
     tcaggacata atcccccaaa caaagacata caaaagacta cggacttttt aactgcagca      3360
     ttcaccatag acactattgg agcaggtatt accgcggctg ctggcacccg acttgccctc      3420
     caatcaatct cgactccttt acactcgaaa aaaactcact tctcataacc gcctccccaa      3480
     aggattaggc aagtttcgcg cctgctgcca tccttggacg tagtagccat ctctcaggct      3540
     ccctctccgg aatcaaaccc cgatcccccg tctcccgtct ccgcctagtt aggccattac      3600
     cctaactacc agctgatagg cctacaactt acttggctcg tgtcaaaaac actcctagcc      3660
     ccctacctgc agtttcccgc agttacagct ctcccgccaa ccaaatcatc gtactatcac      3720
     tgagccgtcc gtcaatcccc cacaaggttc atcaacatgc atggcttagt accagagaat      3780
     agcaaccacg tcaggcagaa tcaacctggt gctacccccc atcaaaaatc tctcagatcc      3840
     ctcatcaaca aacccctggc cacagccaca tcaaatccca aaaaatcctc catccccacc      3900
     gtcgaacaca aatctctctc agaggagacc aaaactaatc caaaaccact ctcttttccc      3960
     ctacttcttc tcttttcctc ttcctcttct cttataagct cctcggaata cctttcagat      4020
     tctgctttcc tttctatttc ttctattctt cttctctttt cctctctttc tatgattcta      4080
     tcagcacaaa attccgaatc atctttatgt tccaagaata cctctttaac tagttctgct      4140
     gctacttcta ttccatattt gttgtataca tatatcagag aatcatgact taaatagcca      4200
     agtaacacaa tatcactccc ttcacgtttt ttcatgggac catcccctaa actaaattct      4260
     attttgtcag agtataatct gtttaagcgc atcttcagaa tgaaatgttc tctattctct      4320
     tttttttccc aaagatacac acatgcatca tgtactatat taaatgccga aatcattaaa      4380
     ttctgttgct ctttagtgag aataagtttg gcatacttct tgactatctc taattttttc      4440
     ttttcctttt ctttttcttc ttccgaagaa gaaggatcct tatttaattt tttcgtttct      4500
     gtttctactt tatcgataag acgatttcca aattcattaa gtaaatggat gttctcccat      4560
     gttattttct ttaatatgaa tcctagggta actcctttgg atttctcttt tttcttctta      4620
     taaatatcaa tcgaattaaa atatcgggtc ttatcgcttt caatcaaaac ttctttagct      4680
     atctcgctgt aaacccattt tttataagga gaaatagcta caggtcccat acaatcgaat      4740
     atcaatgaac aaaatcccat aataacatct tctacatatt ctttttctgt ttcctttatt      4800
     tcgtcgtacc ttgttgaagg agatgctata actaagccat tacgaaacac gaatggataa      4860
     aatattaatt tgcgatagtt accctcgcat aagaaactct tcactggatt tctttttctc      4920
     tctatgtctg ttgacggccc actttccgaa ccacgtaaca catttagcag agcaagaaac      4980
     tttattagca acatccttgc catcaaaagg aaacttccaa tctgaactta taatgtcatc      5040
     atccctttta cctttataag gattcaatca ttaataaaaa tatcgattct gataagttcc      5100
     tgaaaccact gttggtcaga taaggaatat ctcttgtcag tcacaggtaa ttacttccgc      5160
     ttactaattc ttctcactat cccaaaaaat aaaataagaa tctttagtgt tgtttgttat      5220
     ccattccatc tcatatccca taaacagatg tcccgaaccc aaatccaggc acggtacgag      5280
     atggaacaag gcgattcctt cctctgaatt atgattcgag gtctttaccc attacctaat      5340
     cacaaaaaat tagaatttat taggaaccat cagaaataaa agtatgtagt tgtggttctt      5400
     ctccctcttc tttcttgggg aaagccaaaa cctgcaaagt ctccaaatcc tcggaagatt      5460
     tcctggaatg gatcttcccc gaaccctcct gtctgctgtg gattgtctgg atctattccc      5520
     ccgtcgtaca tctctcgctt ctttttatct gtaagcaccc cgaaggcttt attgagtttc      5580
     ttaaaattct cttcccattc tttttcttct ccctcagttt ttttcctctt cttatttgca      5640
     acaaccatct ttcgatatgc cttttttatc tctttttctg aaggcttttg gttttctttg      5700
     aatccaagta ttttataata tcctaggaaa tctcctttgt ttctggacat cctttggctg      5760
     ccatccatgt atcttcgttt tttatatctt ctttcttcct tcgctttcct ttccctctcc      5820
     ttttccgctt ttgccgtctc tatctgattc caaatgtggt tcttgagctt tgtgtttcga      5880
     aacttaaatt cctgaagctt ttcctcggct tcgcttattt ttccatcaaa aactagtgcc      5940
     ataatgtaca aatacattgc atcctcgctc tttctcttcg agtaaagata ctgcgctcgg      6000
     tttgtaagcc ctttctctcc gctttcgatc ccatttttgc ataactccaa gattacattc      6060
     agcttcaacg tagaaaagat acttggaaaa aagttgctat cactctctat gagtgaaata      6120
     cttcgtgcca gaacatctag ctttctatac ttatctttac tacttaaatt actcttcttc      6180
     actctttcat aggagtccaa gatgctctta aacgaagaag ctattccttt atatcccaag      6240
     ctttctaact ccttgatacc cgccgaaaac attcccgtta agaaatatag ttgcatctcc      6300
     tgatggataa actctggttc gcttggaaac ataactcttg actttttgat gaacttagct      6360
     gcttcttcta gtttctcatc tattaggcat acttgaatgt atgccctcaa aacaggcccc      6420
     gaatatgggc tttctttcac taatgtggag ataagacgga cgttgctact aagcaatatg      6480
     gacaaacatt cgctggctct tgtggtcttt cctttcattt cttggtcctc tccaaatctt      6540
     tttattattt catcatactc tcccctggac ataagaaatt ctgcatactt ttctcggaaa      6600
     acaccgctgt tcccaaagta ctgtgaaatc tctttgtata tggattctgc ctttttaaga      6660
     tctccgctct tcatgctcag atcagctttg aatatttctc ctgctaggtc tagttgtgac      6720
     tttacaattc ctagaaacag tcctaatgct gcgctaagga gcgttttatt tccttttttt      6780
     accattccaa ggaagcccaa gggcttatcg tttcttttct tttggtcttg aaccatcatt      6840
     taaggatatc gtctttgcaa cttttattac taaccaagcc ctctttattt atttcccctc      6900
     taccaagcca ccacttttta tatttctctt tacccacttc ctcatctctc gataggaata      6960
     ggttatgagc aatactataa aaaggatccc taggtattta actacaccgt ctgggttcat      7020
     gatttccatc tctcttctgg ggaacaagct cattttgttt actgatgtat catcaattta      7080
     atcggatctt taaaacaaat cagcaactgc gatggtacag ttcttttctc cttggatcta      7140
     taacctctgg atctagagac aaatcgggga aaaaatttac ccctgatgac ctttgaagtt      7200
     cttttcgaca tacctgtgaa gaagaacgaa cagagcggac ctcactcgca cagaaagcct      7260
     tttgggaaag gatcgagaag ttgtgtgtcc tgttacacgt tccgtggcat aataagaaag      7320
     ctaatgatgt gtaggcgatg tttcagagaa tacgccaagg atataggatt cgtaattctc      7380
     gattaggata ttaaagacct ttatttcatc ttgcccgttt tgagtgtgtc ttgggctttt      7440
     tgagccgccc ttcgctttgg aagtttgatt cttggatatt tggctctctc cttcttctgc      7500
     ttcttctgag aaaagggagg cagagaaagt atatactgga caaaaggccc aagggcaatg      7560
     agaaaaacca ccaccatcat ggtgtagtct ggaagacgat acagcctccc taagcccaag      7620
     cccaaaatca agatgaatat ttcccccacc ttgtctcctg taaccttcat tttcttgtta      7680
     aaaagcagct tctgcacgag aactccggac atctccaaag ccatcaacca tcccacaatc      7740
     aaatggaaag gtttgttgtt atttttaaga gaaatgagca taaagccctt acccatcaca      7800
     gggaatatgg cacttgatat ccacagaaat cttgtctggg agagtattga aaagataatc      7860
     atcccgacaa aatacgatat gagcgactcc tttgacagtt ctgcctgctt atagactatg      7920
     tttgcacata atcccgggcc aaagaagttc acaaatccag gaagaatgag atctgacagc      7980
     gttgcatcta ttccgttttc cactaattca tagctcgact gaatgacaca tcctgctgtg      8040
     accacgggct gtagatcttc tagtttttgc gtgaggattt tgcttgacat tgtcatgtta      8100
     gggttgtttt ggataaaaca aaggtatatt gataaaacta acctgaaacc ctattattta      8160
     tagaaagtaa ataacaaagc tttgtaaggc ttctaggcca taaaataaat aaaatgcttt      8220
     aacgattgga ttgggctatt ctttcgatct ccttcttttt gttgactgca taggagttct      8280
     gtgaacctgt agaggccgca attagttcat tggcaattgc ttctgccagt gttattctgt      8340
     ttctgaacga tgcacttcta attccagcag agatattaga tattgctatg cttattcgct      8400
     tcaggggaga aacatctacg gatgtccttc tcatagaccc tgctctgcca attcttgctg      8460
     tgtcctctcg gggtccggcg ttgattatgg catccaccag aacctgaagg gggtttttct      8520
     ttgtcatgga atgaattatg aaacaagcat cctcaaatat attgattgca agtctcttct      8580
     tcccgctgtt tcttccatgt ctcataagag agcatacaaa tctctctgca atgggaattc      8640
     ttgccttccc catcgtcccc tttgtgatag ttgtagttgc atgtggaact attccgtggc      8700
     gagacaagtt tatataaggc tttagagaca aattctctac cttgacctca tcgtagctat      8760
     acttttcaaa tagctttatc tctgacattc cctgagggta aaatttttta tgatttttat      8820
     aggacattcc ttcgatttcg aatttacaac gaagacttct aatccaataa gatgtgcatt      8880
     tggaaagcaa ttcttcatgc ttctattttc agataacact ggaatgtaca aaggatcgac      8940
     ccatcacgta tgcttcgtcg tcccagtgca ctacccgtca tttgtcaggt cgttgttgaa      9000
     acccaaacac ttgtccctga aggaaagtgt agattatctg ttcaagttca aaactccaga      9060
     agatagaaat agatttactc tttatgttgg tagcatatcc aacacttgtt ttgagattat      9120
     aaaggaacta ggccctgcca gaaaagtctc aaagaagtaa aataccatag tgctcttagt      9180
     ttacaaaaaa acttccctgc tctgcctttg tatccaattc taatcctttt tgagctcttc      9240
     gagattttga aatattccat tataggatag aataaactct tctatcggct ttatttcagg      9300
     tatcttatgg ttgttcattg ccagtttaat atctgcttcc atttcggcct cgtttatctt      9360
     atcaaacaaa ctttcgtctt cttccatgga ttgtttgaac gaaaaatatt tgggttcccc      9420
     gcttgactca tccaacaaaa cgaccccctt ccgatggagg tcttgaagat tacgtccaca      9480
     tgcctttttg ttgtaggtct tggtgttcca aaatacttta gaaacaaagc cttagtactg      9540
     tttgtatcca cctttatggc cgtggctcta ttttacattg gatttggaaa agaaattctt      9600
     aatttcatca tcaatagaaa tattggggtc ctcagtatag gatttgcttg cttcaatttg      9660
     gctgcactct ttatgggatg ctggctctca tgtataatcc acgaaaccat ctcggctttg      9720
     tgttccttct agaaagatat catttaagtt acgaaaatac tttgcctcca gaaacaattg      9780
     ccgttatccc tatgcacggc aaaaataaag gaatcgcaat atcaaatata catccaagaa      9840
     taaggctgaa ggacataata gatatattct ccgtctttgg aaatgtaatt ggattccaag      9900
     tactcaagga aggatttgct ttgaagtttg aatcgtttcc cgagaaatct ttatccatgg      9960
     acaattttcc tttggtgcac aaaagaatga aggttaggct tattgaattg gctgatgact     10020
     acgatacctt ccaaaggggg accgttgtta tgtttaaccc ttctttagat gtagacgaaa     10080
     taagagatga gtgctgtatg tttggttgtg taaccgaggt gataagaaag cagaatggaa     10140
     tatatgttat ttgtagttcg gaagctgatg gggagagtat atttatgaac atgtatggaa     10200
     gatactacaa caaagaaaga ataagatgct ggataactga cgaaaaaagc ctattgggag     10260
     aataaatgtc gtttcttata aacttgattt cttctctcaa cactgaggcg ggaattgagg     10320
     gccgcttcct cttgtcccat tatttctata attgatggag aggaaaaaag tacccagcgt     10380
     gggactcgaa cccacaacct atagattaag agtctatcgc tctatcctgt tgagctagcc     10440
     aggcttgcca tgtcccctct atcgtttcat ctattcttaa acatctacgc aattgccttt     10500
     gtttgtcatt atatccaaat ttccaactat tcctttcttg tataataaat taaaacaatt     10560
     actttataaa agctttgata ctcgtcctca tgaaaataat gttatggaca ttgggaacac     10620
     ttctgattac tatcgctgca ttaaacccag accaaatcga tctatccatc tccagggtta     10680
     acaacacaac atacaggact cttgaaaagc ttgtttcgaa agactcgtac tctcttgtca     10740
     aaaccaaaga tcttggtgag ttttcttctc catcaaaatg caccctactt tcctgcctca     10800
     taaagaaaag ttccatcttt aacgaagagt acataaacct tctggaagtt aaggaggcat     10860
     atacaggtta caagacaaat gacggatctg cagaaacatg gaggaaaata tgggaaatct     10920
     ctggggaaga ctccttgctt ccaaccttgg taagcgggct tcaattttcg atattcactc     10980
     acctgtcttc tttccacaag aagttcttta cagtctattt tccaaatccc gctctcttcc     11040
     ataaaaagtt ccaggacaaa catcgtctaa acttctatct gacctatctt cttctaagga     11100
     attgtgtcgg aggcatagat atggactgcc cggaaatgga taaagatctc ttggatgtag     11160
     tccaaaccat aagagctcag ggctctacaa attgggttag gcagactttg gatttggaga     11220
     aaacaataca aagagttgac aaaatgatcg accttttgaa gaacataaac tgtgaaaaat     11280
     gccagctgtg gggtacaatc caactcaaag gtcttagggc ggcactgaag gtgttttccg     11340
     gatccagcaa cctggataac cttgaaagat tcttccttgc caatctcttt atgaggctct     11400
     ctgtttctgt tagggagaac attaagctta gaagatataa gtttcctctt cttgtatcag     11460
     tctctcttta ctggatggaa attctttcct ttgcaacttc ttttttaatc atccttctgg     11520
     tatcaagagt tagaaacaag ttcaagagta aaattgctct caagagctgt atgtaaattg     11580
     aacattaaac tgtccatcac ttggtaaaca cacaagacag taacgactca aaatataaaa     11640
     aaccggttta atccaaccct tatggaccaa ataactaatc tagaggaaat caaaaggctt     11700
     ataaagtgta aagatctaaa ggccctcgat tcagctctat ctggttccca aaacataagc     11760
     gcttcgaaac tcaaggaact tatcagcctt tccgactcca agaaagttca gacccttata     11820
     gagagcaagt atgcagaaat tgcatcccag atgaaggaag aaggtaatag caaacagaga     11880
     aaaaatgaag aaggattcat cgtgcaggaa gccgatatag actcttcttc agccctcgac     11940
     gaagtggcaa caggggattc acaaaaggat aggtctatta aaatgttctt cgatgctttt     12000
     aaaacaaata tttcagattg ctgcaataga tctgcagctc tgcttgcaaa gcagataact     12060
     gttgaaatat ttgggcgaag cccgtcggac attgcaaagc ttgtaagaag caaatgcttg     12120
     aacttaaagg ataagaacaa tccggttctt tgcagaagag tttatgatgg agatatttct     12180
     ccttcaaggt atgtagacat gacgtcggaa gaaatgaaga gcgaaaatct gaagaatgag     12240
     gaagttaaga tgatagagga cagtctctat gaatgccaga ttcctaccca gaaggcagaa     12300
     accgacatgt tcaagtgcag caagtgcggg gagagaaagt gctcctatag acagttgcag     12360
     acgaggtctg gggatgagcc catgaccacc tttgtcactt gcgaatgcgg aaacaaatgg     12420
     agattttgct aacagacatt caactccact tgggtttata tagttttcac cttcttgttc     12480
     ttatgggttt ctttagctat ttaaaataaa atgttcaatt gaaatctctg taaatcaaat     12540
     ctatgacata gttacatgct tcttgcaccc gatccttatc atttcccgag attaaaagag     12600
     ccttcagccc actgttcgct ccatcaatca ctcttgcaat aactttaaaa tctttctgaa     12660
     gcttgtatac attcactcca tttttcccta ttaccaagtc ttctcggcca gaaggaatgt     12720
     ccaaaacttt agcttctcca tcaacataga tgtctccagg aagcttattg tggatttgct     12780
     ccatccttat cttaaaggat tttatggcgg taagtgttcc ctcgaccaaa agcactatta     12840
     tccccgggtc cctgttaagt ttatctactt ttatagagac atttgcctcc tgggctaggc     12900
     tggccagttc atttccattc attttgggaa taacaatttc ttcttgggtt tcattgtctt     12960
     tttctagata ctcgttaagt cccatttttc tgtatttctg aggattttca ccgaagatgg     13020
     ttcggttgtg ttctcttgcg acttcctttt tatacctgcc tctaagttcg tctaggaatt     13080
     ccctagaggt caggcttatg ttttctggct cgggaatctc tccattcata agggcagcag     13140
     atgattcatt ttacagaata gatttccttc tcgaacagat tgcagttctg gtagctcagt     13200
     cggttagagc gtcgtgctaa taacgcgaag gcccagggtt cgagtccctg tcggaacact     13260
     ttttggagaa aaatagacgt ttcgctagtc ttccatccat ttgtttttcc atcttctcat     13320
     attgtatgac ttcaagcatt cttcaaataa tctatggtct atttcaagaa tggcataaag     13380
     gcttcttaat gttttgttta ttccttccat cctccaaaac cttttggatg tcctgtagat     13440
     aggcccaaag atttttggaa tcgaggctct tcgatgtctg gataaaatgc gatgattctc     13500
     taaaagcatt tctgcagctc cctcaactac caaatggtga taggatccaa gggaaatagc     13560
     tgttaatttg caaaaatcat cctccaggtt ccgatacgtt tcatcgctta tagtcttaag     13620
     aatctctttt acaatgtata aaatcgtgga tttggtgatg gaacacgccc ctccaaatat     13680
     ctttatgaga tgttttatgg tcagagatgc catcctggga tagtttctac agatcgctct     13740
     aaccactcca ggtatttctt tactttctcc ccagaatctt gttccggcca tccttaaaat     13800
     tatctgatga tgaaacacgg ccatgtcttc atttgcaatt gcttttctcc tggaaagttc     13860
     ccccacaatc ttcaaagctt cttccattcc aacgtgagtc ctgctgtttt ctataaagtt     13920
     tataaactcg ttgcataatc caaggaaaac cgcttccaag cacttagaga aacctgatat     13980
     cttaatcaaa aattctgaga taagagccct ttcttccatg tcatcagact ttaacatttc     14040
     cactagagac aagataattc tctgtgtaag agtctcctcg gcaatttctc tatctagatt     14100
     ttttaatatg caaactagca atttcaggat ccttttgata ttttgatttt ccagacgttt     14160
     taggcttatg tcgtccgttg cggaatatat ttgtcctgtg gggttaacag atttaggaag     14220
     agttcttatc acatatctcc aggtaacttt aagtatgttt gagaaaatct tctttgtaat     14280
     cttcaatctc ttataacctt tttctaactc tttcagaaag tcttccgaag acttcgaatt     14340
     aatgaacaca atcacgtcat cctcatcaag aaaagataag tttttccttt tttgcttggc     14400
     ccttttctcc acagcataaa aaacgaattt ctatatgttc tccaaaaatt aactaaagac     14460
     agcacgtaaa atcaatcaga tcaaattaat aaaatcaata ataaaaaact attttaaaag     14520
     gcaaatagac aaacagatcc aacttttaaa tggatgtgga aaaatcttcg ccagtgcaaa     14580
     agtcggtttt ctattccgca ctgatgtcct ctgcatcatc tttactgttt ggaatgtctc     14640
     ttacagtaat aggatgtatg tatccacatg tttcaaaaag atgggaagaa accatgaaca     14700
     agacagaggt gaataatctc tggggaatca cctcaagcaa tatattcctt gggtgtctga     14760
     tctcaaatgt cttggtaaat gctattaggc caaacatgaa aaaagctttg ttacttaaca     14820
     acattttcca tgttacagga tatatcatct ttctccttga tcaaaatttc aaatctatct     14880
     tttccggaag attgatcata ggacttggct caggaataac atgtgcaata gtacctatat     14940
     acacctcact ggtatcatca aaagagtccc gaggttttct gttatccttt catccccttg     15000
     gaatatgtat tggaataacc atcggtaata ccctttcttc ccttaattcc gactccacct     15060
     ggaggattcc attgtttata gctttgttat tggtagcatt gaattttcta agcttactgg     15120
     gaataatcga tccctcccat caagaggctt cttcggaggt atcctttccc agtctattta     15180
     aaaatcccag agcaagaaag tccatctttc ttgcagtgct ggttcacatc tcccagcatc     15240
     tttgcggggt ggattatata actcttttcc taaaagatct ttttcctgta gacatgtatt     15300
     ctccagaagt aatgactgtt gccatctcct cgttttcggt tcttgtaaca gggctttttg     15360
     cacgatatgt tgacttcatt gggaggaagc ctttaatcat cgctagctcc ctaatttctg     15420
     gtactgcaac agcaatgctt accttcaata tatatcctgc ttttgcaacg cttctgttta     15480
     tattgggata caacatcggt ctcggcccca tcccatggtt tataacagcg gaaatctttc     15540
     cgcccgagta tacgaatcca gcctgtctcc ttggtgtttc tttgaactgg ttatcagctt     15600
     atggtgtttt ggctgctctt tatccatttc atttaaggta cggaagattt gtgttctctt     15660
     tctatacgtt ttgcactatt ctctttgcag ggctaatggc cttatttttc acagaaacta     15720
     agaacaaggc accagatttt cagtaaacaa gatatgtatg tttaatcctt ctcctcctct     15780
     ttccgaatcc atccattctc cagaaaaaag ctgtacaatt cgtctgtttc ctttaaaaac     15840
     ccgaaaagcc tatcgaagtc ctcctttaca aattcctttt tcttgataag gcaggaaatt     15900
     acttcctttc ttaattcaag gtatacattt atggacaagc cataggcttc acataacttt     15960
     ctttcccgtt cactgcagaa attctttata tacccaattt cttcttcata ggtgctattc     16020
     tccttcctag aatatccttt taataagtca taaagcttct tttcaatata caacccacga     16080
     aaaaaaacat tgaagtcctg ctttgtcaag tacggggtaa tccacttaat tgtatctcca     16140
     atcccggact tttcattctt ggtttttaga ctttccatat ccactaagtt tctatccagt     16200
     gtaatatgct ttctcctgtt tcgaaacata attatcctta tgtacgagtc gagcactgct     16260
     tctactaatc tccctttcaa ttctccttct ccttcctcga agttaacgtc ttttatgagg     16320
     gcttcgtgat cattcatata ctcgacgtca aagtcttctc ggaagggcat gtatgaaccg     16380
     attaatccac gatacggatt actaacgctt ttactcatac gaagtggttt acatgtgttt     16440
     ctttggaagc caaaaatctt gtagaaatgg ctctcaacat cctttttccc accaacatat     16500
     ttggaaatct ctggccaatt tcctattcca cataccccaa gtccctctac aaacaaaatc     16560
     tcttccatca gggtccactc tctgccatgg atcttggtgt tcatccccga gactatccta     16620
     tattcatggc atttgctgtg caaagatgtc tctatctgat ttacaaagca caacaagcat     16680
     aaatctattc cgcactccga acactttaca tacacaagac tttccattcc aataaagcag     16740
     ttatcgcaga gtactgagac ttttctcagc tcattggagc atgaaatggc catgggaatc     16800
     ttttattctt attttttgaa ggatatccat ggcctagagg atacaaccaa ggcctttcat     16860
     ggtagtgtcc agaagaaaat agaatatatc tgtgcgtctt aaaagccctt gtggaagggt     16920
     ctatggtagc ctttggagac atatgcgaag acgaaataga ggcttttcta cttagccaca     16980
     tagacattcc ttatttcagg aacaatccgt cgtatatatc tctttggcaa agatattatt     17040
     acaaaacaaa ggagcctggg gtgctcttct tgatgaaata caaaaaggta tcccagtatt     17100
     atcattggat atatgtggag ttgtcaaggc tctttatgaa aaatggccat tacggaatat     17160
     ccagagcaat tcttgatatg gggatagcat gcaatgcata tgacaagaaa gttctgaagg     17220
     acgagataga gaagatccct ttatcaacca cggtgttctc tgaccacgag actagtgcat     17280
     tgataaatcc aaagggattt gttgctctgg ggaaggtttg gaactcctac cgggagactc     17340
     tattttacaa tagagagttg tttatccttg atggagaaga gatatcattt gaagaatata     17400
     ggagtagaat atggagtaag aagacggccc tttcatgtcc ccgagtatcg catagagtag     17460
     aaacggacgt cccatcccgg gaggagcatt ctttgaataa caaaaccagg atactttctc     17520
     gtggtagttg cagaattcac aaccaagatg gacgtaaaag ggaaaataac tccgcagaag     17580
     tcactgagaa tattctggcc tccggacaag aaataataat tgatgatctt atttattata     17640
     taaaagaggt gatagatgaa aagagatata ggatgatatg tatatccaat gaggtatcca     17700
     aagatctaat gaacagagga gatcttttac tccatgaagt atcgaaaaca actatagatt     17760
     taattcaaaa gttagactca aactatgttc ctccatttaa tgtaaagaag ctaggctcaa     17820
     ggatgttttt actctatgat ttctattact ttggatccct aaaaagttgt ttggatgttc     17880
     ctacaagtat caggtctaat attgctttgt attttatggc ccaactggct gacatattca     17940
     atgaaatgaa aaaggtggga ttgggattta cttccttctc attggaaagt ttgtgtgttt     18000
     ccgaagactg cagacttaag atagttgact ttgattggtc tctagaaagt cctgaaatca     18060
     actacgggga gattatgaga gatttcctac agcagtatac caactttcct accgatgcac     18120
     cggatatcac ggagaaaatc aggagtgagc ttgagaagat caagctgaaa gaactcatcg     18180
     taaaatacaa aatacatatt tatgagaaga tatgcaaata tccatgaaga tgtgattctg     18240
     gagttcaaga cttctcttgt ccttgggaaa ttgttcatta tataaaatct gcttcaaacc     18300
     ctctatatca atttgtctat tctgtaaacc ctaagagatg tctccttacc tctatagatt     18360
     accgatagaa gtccataaag acaaaatact agacacagta ggaaagttta aagtgtgtgt     18420
     aatcaagggc ccgaccgggt gtggtaagtc aacatatatt ccatacttgc tatcgtcttt     18480
     cttcccttcc tctagaatag caattgtgga accacgtaga atagcagtca tgtcgcttta     18540
     caagacactc tccagcgtaa ttggcagagt tggatacaag atgagattca acaaaagcat     18600
     tggaaaagac tctaaaacaa ttgtgtacac agacgggagc tttctgaacg acatggatga     18660
     agggaggttt gactatatta ttatagacga ggtacacgaa agatccatta gaacagacat     18720
     tatccttggg ctgcttagaa gaaacattag ggatatcagg ggaaaggtga tcttgatgag     18780
     tgcgacagta gacacagaaa aaatatcccg gtactttggg gccggtgtac tggagattcc     18840
     tggagattct tatcctgtaa ggatagaata tcttccagaa tgtacaagtg attatatagt     18900
     ggagtcctat tgcataatca agaaaatagc actttcaaag gaatccactt gggatgggtt     18960
     tgaaagcaag aacagagata ttctggtatt tctgcctgga gaggaggata tcaatgacct     19020
     ctatgtctta ttaagaaaac ttccggtggt aaaggtttac aaggtatttt cggcactaac     19080
     cgataaggat caaagcaaaa tctatgagcc ttgtaaatta aggaaagtta ttctctcaac     19140
     caatatatgt gagacttcct tgaccatacc cggaatcgga tatgttatag actctggact     19200
     tcataaggta aagatatatg atcaaatgaa ttacctaggg atccaggcca tatctaaaga     19260
     atctgcagac caacgactag gaagatgcaa tagaacagga ccagggacat gctaccggct     19320
     gtacacagag gatatctaca atgaactatc tccacaaaag agtcccgaaa tctgtaggtc     19380
     cgacttgtcc caagcctttc tacagcttct gaaacataga agaaatccac ttaaatttga     19440
     gtttttggac tatccaaccc gtacaaatgc cattgctact ctagatttcc tcatggaaaa     19500
     gggatgtatc aacattattg acacaagaaa gcaaagcagt gatagaaggt tggatgcaat     19560
     ttcaatgcac caggagtgca atgcagactc gaaaaaaatg agccttgaag atcttcaact     19620
     caagataaca agctatggaa aggttgtgct taggcatcca tttgacatcc atctctccca     19680
     cttctatcaa cagtccttag acaaaggagt tggataccta gcttcgatcc tagtgtctct     19740
     ggtgagtcag gataactgta gcttcctaaa atataaaagt aagagccaaa agacagacat     19800
     tgagtttctt atatctcttt ttgagggata tctggagtcc gaggataaaa aacaatactg     19860
     cataaaacac gagatcggta taaaatatat ggagattgca aaaaggattt tctctgctct     19920
     taacaggaaa aaagacggag atattgaaat gatagaaaaa gtctttagtt ttgcatatca     19980
     gcacaatctt tgtgaaagaa tgaaggatgg aagctatcga cacctgaagg ggggaagtgt     20040
     agtgtggata catcctacca gctgcttttt caaacggaaa gatcggtttg ttgtttttgt     20100
     tgatgttttc tacacaacca aggcgtatgc aaatatagta ggaagatact tcaagacatt     20160
     ttaaacagaa gtaaggaaga gccaaaaaat agaaaactcc cctttgaaaa cctgaagatt     20220
     tattactgtt tctagattat atcatactcg tcgtagtttt tggggaatga tattccattt     20280
     cctactgtag aatagctagg tgtcacccaa tccaaagggt ctgttccaaa aacttgtttc     20340
     caattttgct tccatccaag attgtaagga ttcagagttc ttcggtctat agaatctgtt     20400
     aatgttgtca ttgggccttc ttgaaatata tggctcagag agtgatctcc agtgacgtaa     20460
     tcattgaggg catagtgttc tattgttgtt tcattcattc ctataagcca tgtgtggaat     20520
     atcagaaggg acaaattaaa gacaaactcg attcccatca atgacatcga cactatgtag     20580
     ttcacccaat gacccttggt ctttgggatc cctagcgtca tataaataaa aatggtcaca     20640
     atgaaaaaaa taacagaaac caggtttaga atcatgaact gataaaagaa cttatagtta     20700
     tggaacccaa tacaagtgtt tagtagtgca caatggtgat catacttgag ataacatctt     20760
     ttacatgttc cacagtggtg agacctggga ggcttgtatg tcttacactt gctgcatagt     20820
     ttaatttttg caatggtttg cttcatcatt tcttcctcta caaacttgtt cattcctttg     20880
     agcttcatgt catacccgtc ttgagggata tccggaaata tctctagagt acttgttcct     20940
     tcatttatga agagcttcat gtaaaacatt gccttgtatg ttactattac gtgataagca     21000
     acaaatagga caaagatcat ccaggaatca aattctgtat cttccaggca caggatccca     21060
     acgaaaacaa aatatacata gagctccagt gtgggatata tagtaaaagc tgcaaccctt     21120
     agcacttcat ttcggaattc tttccatccc atctttattg ttttatgggt tcctggtaca     21180
     ggaatagcta tttaatctaa actaaatcaa caataaaaag cgagactgac agtagaaatc     21240
     atttgtaatt tagttatcgt aatatattta tttttctgat aaagtaagga attagtaact     21300
     ttatttgaat tataaatcaa gcatggaaaa agataaagaa acactgatgt agtagcctat     21360
     acagccgata cctgcttccg gctatggttc tcctatcttc tttcccataa cccttggatt     21420
     ttgtgccgag agctttgcca ttgctattgt tttatagtcg aatgtacagc catgttggtc     21480
     atgaaatctg tgcatgatac aatatgtgtt tccacatcta cagttgtagt tatttgttaa     21540
     ttttagcttt ttcccacact ttctgcaaga cataaaagtg gactcctttt tctctatagt     21600
     actattctcg gcaacacact ttctcctctg caaattgcat ggagaaatca ccatctttct     21660
     tttcttatgg aggggtgtat tgctgatagg ctcgggacag cttagttctt ctttcttgac     21720
     gtcgtcctcg cctcggatct cttcttccat tctcctcacg aagttctcca ttttcatcgg     21780
     ccccaaataa tccatttttt aagtttattc attagcttca gagtaaaaag ctggtcccaa     21840
     taaaatcgtt tctttgtaag aatgctagag gctatggcct tcatggccaa acagttttcc     21900
     tgggaacagg agtataagag aacatgggaa gacagaagtg acagaaaggt aaatgaattc     21960
     aacacagaga caggaatttt ctacagtaac aatagaaagg gaatagtaag acatctacat     22020
     gtaataatag atgtctccga ggcgatagac aaatcggatt tccttcccac attcaggaca     22080
     aacgtggcaa agattcttga ggggtttatt ccttcgttct acagcgagaa tcctttgtcc     22140
     accctatcgt tcctcagcgt tagagatgtg tgtgtgaaat atataagtag tatggacatg     22200
     gatatacatg ctttcctagg ccagacagga tctaagtggt tttccttgct taacgggctc     22260
     gagggatcgg tggaaatcat taagaatact acacatgtta aagaaatcct agtcattgtt     22320
     gcaagcacat cgacccgaga tcctcatgga tataccgaag tgcttaccaa gctcaaagta     22380
     cacaacataa aggtccactt tatcagcctc tgtggagagg tcaccttata caagtcaata     22440
     tccaaggcta ccgaggggag attttatgtt ccagtcgatg taggccactt atctattata     22500
     atgaaagaat tatcccatcc cacagatttc aacgggacaa ctctcagcct agttaagatt     22560
     ggatttcctt taccggtaat agagccatct gtatgtgctt gccacttaga aatgaagagt     22620
     gctggatatg aatgcccagt gtgtaagact atggtttgtt cccttccagt ctcatgtcca     22680
     atatgcaaca ctcaacttgt gtctaccctg aatctttcaa agtcattgcg atttctctat     22740
     ccactaaagc cattcatcga aaaggagggg aagatgtgcc gaatatgcca aagcaaggga     22800
     ggataccaat gcgagctctg taaaagtatt ttttgcaaca gttgcaacgg atttgttcat     22860
     aacaccttga gcttctgcat ttactgtgaa ttaccgtaca actagaatat atgacacctt     22920
     accaatagtc tgataataaa atgtcgctgg aaacatctct aatctcatcc tcagggcttt     22980
     caggatcctg ttcgtaattc caattaattc ttttccaaag atttatttgg tttacaactt     23040
     cctttcctaa cactctcaca gacgatctca taatggtgtc tctgtttgaa tacaaataac     23100
     tctggaaatt gattcttctt ataaatccaa catcgaaaac acttgggatc agcttcttca     23160
     gcactgcata tccattggaa ggccgagaga ttcttttaat cttaataagc ctgagctctc     23220
     cgtacgatcc tctggtcttt actttacaga atatcttgct cccttttaga acaaactctt     23280
     taggaaagtt tatataaaca ggagacacca gttctataca gtctccgctg gtcaaaatac     23340
     cctgggagac agttgtatag gcaaacacat cgtattcggt tgtttcaaat cttttttcgt     23400
     acactggcat gaataagctt ctcataaaat attcctaagt accccaatga ctgtgaataa     23460
     agaactaagg gatattctat ctggttacca tgataggata aagtcgaaga tatgcgaaaa     23520
     caagctcgac gaagccatct atctggtcga ctcgttgtgt gcaacattta agtctccatc     23580
     cagcccctat gaccgatcgt cttgcactcc atacagtaac gaggtttccg aaaaatacgg     23640
     aattggagaa tatataaatg catctttcgt cccagcgctc gggacactgt tcatagcagc     23700
     ccaaaatcca aaagacgaaa agaaagatgt cttcattgat cttctggtta agtcaaacac     23760
     aagtctaatc gtttcactca taaacgatcc aaagtatttt gaagaggagt ggcttaagga     23820
     cagaaaaatc ataaagtata tggggaagga tttgtttatc gatgagacat atgatgtcca     23880
     aggaagggac ataaggagac ttcgatatat caactgggtg gacttctcag taatcactcg     23940
     tgaagaaatg gagcagttcc attctcactt caataaggtg cgtacagaca cagtggttgt     24000
     acactgcatt gctggggttg ggagaacggg cacattcatt atgtatgata ttctcaagaa     24060
     aatggaaaat gttacattgg atatgtttgt agacgtcttt ttaaacctta gaagtaagag     24120
     agcacatctt gtaacaaaca aagttcagct tgaattctta aaaagcattt ttctaggaaa     24180
     ctagaaatac aataaagaag aacggtggct tggtcttagt actcttttta attctttttg     24240
     aggatcagca cgtcttcgat atacgaagaa caaacgttct catctgtctc tgctcttgtc     24300
     ttttcgctca aaacaaccgg agacgtatgc atctgaacag aagaaagttt ctttggctct     24360
     ccaaccattc caaccgtatt tatcggatgt cctactctta tatttatctt ttccgaacat     24420
     gtaacatact ttggagtaca tgcttggcag agcaaaaaga acatgtatga atgagaggtg     24480
     atcagaggac tgatggagga gtctagcaac atgaacaccg tagagaaaag acctatggtg     24540
     ttttttggca taaatgttgt cttgtcaaaa cacaagggcg agatgctcag caatcccttt     24600
     cctagagaca caagcccttg tgcaatcttg agtacgggaa ggacctttaa atccttgtaa     24660
     tagtaggagt attgctggtc caagatcttg gttatacggg aattcaatgt accggctcca     24720
     atgaatccta atgacacaat tgtggatatg atacagtttg tttctccgat atttaaggac     24780
     ttttccaaaa tatctagaac atttacttgt ggattcgacg ggtacagtat actgtagcat     24840
     agaggcaata cacttcttag atgcgaggaa tccagtagca atgaggagga gacaattctt     24900
     ccaaccatct ggcttgatgt ttcgtcaccc attgacacca gggcacagct gagaagtcca     24960
     agagattcca gaagtgcatc ggtgtctcct gtgaacgaat cagttaaaat agattcaatg     25020
     atattggaat ctccacttcc ggcgtgctgg aaccctttta tcaatatgtt ttgatgcttc     25080
     ccaagggagc ctccaatctc cattatccca cactcaacat ccttcctgcg gtaaaacaga     25140
     ctagctaatc ctagcatcaa aaacctgaag aactgggttt cagactcctt ctccttttct     25200
     agaaatgttt gaagcataag agatgtgaga tcttcgtctg cacttccaca aaatacgctt     25260
     cccaatgtaa aagcagtgaa gaatacaact tcattgcagt cggaaaacat cagtggctga     25320
     agaagctccc gaacctcctc cgattgagtt cccgaaaaca tggcctcgat tcctaggaga     25380
     gttcctataa catggatgct gttgtttgat tgcaaattgt tcgatagaag cgccagaata     25440
     gctggtcttt cttcaaagtt cctcaaccca gataatgcaa ggcctagcaa gcttcctgtt     25500
     tttctatgtg aagaatctga aaatatgtgc tcctgaagag tttccatcac cttttccgaa     25560
     ttccatgatt caatcactcc aattgaccca aagactgaaa taaggtccgg cacatcacat     25620
     ccaagaatgg cctcataatc cagcggaact ctagaatctc cctcttgtgg cacaaatatc     25680
     gggtcccgtc cataccccat gtggacaaat ccattagcga ttgcaacaga tgcaagctgc     25740
     tttgtatcct tgtcgtactt aaatcctcgg aaaattccat ccatcttact cggcttatct     25800
     atctcaagtt ccgttccaac acttctatag acttccttaa tataactatt agacagaatg     25860
     tacttttctt caggatcaga gacctcataa tacagattgc accttgcaag tatatacaaa     25920
     cattgcttct tgtagtccct gtcttctatt tttttcacat attcgatggc ttctttggtt     25980
     ttctgtctct ttataagccc tacaacatat ctcgagtgat cattcatttt aagatagatt     26040
     ccaagaatca cttccgaaag ctcaacaaac gaattcatgt cctccaaata taacactatt     26100
     ctgttgtagt tgtgagtgtc aacatattcc aaaatacttt ctattcccct aatttctagt     26160
     aagaagtcta ttgcttcaaa ttcggcatta tgcttgaata aaaagtcaat acattttctt     26220
     gaaacctctc tggttctctc aaatggaaga tccatcttgc cgttcttaac atcggcaata     26280
     catcccgtca gcttcttgac atacagatgt ccccactcct tgaggtcaat cacgtttcct     26340
     tcaatcctat attccaaaag cttcttctca tcatcaataa cacatattgc acttattatg     26400
     tcgcatagcc attttctttt gtcttccgac agatccttac acacctcttc cagcatcgga     26460
     aggttgtctg caagatattg gaaattgatt gtatcaatgg attttgaatg cgacgacttt     26520
     gttatgttaa acagcatatt cagtgcattg ttttggatat cggcatcggg atctcttatc     26580
     ctctcaacta ttattttcag ctcgtcttcc tccattaagg gggtttgttt ttcccaaatt     26640
     aaacctgaag acttaacacg ttcctcctaa aaaagcttca aaccacagga cagaactctc     26700
     tcttccttgc aatccggttg taaatttaca gaagatattt taatattcct acacccagtt     26760
     actgtttata tattctctct tctcgagcat tgaaatccca tggtcaataa cagatgctat     26820
     gtgccccacc atgtgatgct ttggtgcatg ttttacaaga ataatctgct caaaaaacct     26880
     cctctccaca agcttaaagg taaccatggg attctcattc ttattaagag agcaccgtat     26940
     tcttttcata tgcactagtt ctccaggtag gtaaagcttt ggatacagat ttgtgcgcct     27000
     aagatgggtc aaaattagat ccatgtcctt ttccatctct ccacacgagt ccattggccc     27060
     atgtttctcc ccaatcgagc aacacaggaa tttaaggtcc agcacactcc cataactcat     27120
     tcttggtatt atatcgtttc catagattat cacagttatc cctttggcaa atctagatgc     27180
     tatttcttcg gagactactg gcggacttga gaaaacaatt gcttctacat ctacattttc     27240
     tagcaacccc atctcctcca ccattatctt aaccaagata gaaatcgccc ctccaagaga     27300
     atgccccaga agtagaagct tcttggatcc aatatctcct aagatctttt caacagaatt     27360
     tatgtgatta tttataaaat gagttgacag ccttttgaat ccgttatgca caaatccatt     27420
     gctaaattca gcatattcac agtttatgtc ctgaattgtt tcttcggagt ttgtggttcc     27480
     cttaaatgaa attacaaccc tttcattttc tctatcgtgg aagattatgt gctgaacaac     27540
     ctctgagggc tctaaatgca tgcaaagtag gtctttgttt tctatcccta ggagcttgag     27600
     tactgctctc ctttcatctg agaccgattc accaacagaa gcctgaggcc taagaaacat     27660
     actaggccag ctgtttgcat acgatcccat agcaaagtaa aataatctct ttatcttccg     27720
     aagcatttcc aaattgcaca acaaatatcc attgcttgat agtatacttg ggatgcatat     27780
     tgaactctca tctctaccat ccttttcaca taaagaacag tgagtaggaa gtttcaacct     27840
     aaacagcctt ttttcattct ctttatcttc ttttatgccc ccctcggatg gagaaaagct     27900
     ccttctgccg tttgcttcat caaaaaccct tggaagttcc tcatggctta cttccaagac     27960
     caagtctatg tttttggtga accgggcatt gatctccgct atggtctttt cgaccagaag     28020
     acctccaaac agtatgttca gtctgcatcc gtggcttccg cgattaacgt aatccactag     28080
     cttctttatg cttagaatgg tccctgcttt ttcattgcta aagaagaacc caaaaacctt     28140
     ctgaacaaat ccacttatct catcctcctc tcgcatatct ctttcatcat atatctttct     28200
     tccaaacgta taatggagct tccctataac ttcctttggc tcgaagtcgt agctactcgc     28260
     cttatcgcga tatcttccgt gataaatgtc cagagtatgc tcttgctttt catctccgtt     28320
     tctaaaaaag caatggttta agagtacaaa gcccatgcat aaatcccaag ggaatgagtt     28380
     tttcattaga agaatcctgc tgtcgcctat aaccgtatgg tggaatgtct tgaaggtcat     28440
     gacagctctg tccttaaaga taacttcttc tccgtcgtag cacagaacta gggtatcata     28500
     agtattctca ggaacttcaa cctttctaat ctttatatca acttccattc ttaccccggg     28560
     cgagataggg tagtattgac ttttggattt ctccttctgc cttatggaat ataaacatcc     28620
     ccttctgcaa atggattggc aaactcgata gaaaacagtc gcctctcctc gcaaagtaaa     28680
     acagctcaga acatccaatg atgcaagcaa tatcataaaa ttttaatgat caaaagctaa     28740
     gagaagaaaa aaggaatttt gccttgcctt ccttccacgt tttcatcatg gcgtctttgg     28800
     tcttatctgt aagcactttc ttagtttcgg cattctcctc aattccgttg tagtcgattg     28860
     cagccaatcc cagatctgcc ttgtatcttg tggcgatgag atggctgatg ttatacttct     28920
     tgagtatgat gtagaacttg gcatttctac gttggatcca cttaggctgg tggtcctctg     28980
     attccttagg aacccggaca acacacgcag tcagaacaca tctctcatcg agctgtttta     29040
     tcacaacggc tttcttacct gcattctttc cattggtcac aacaacgatc atattcggta     29100
     caaaaagcat ttcccagggc aaatttttta cgccaacaaa tcttgcaggc cattatggag     29160
     aagatcgagc ttataaaggg catagaagca aatgccgaaa ggattctaga ggactttata     29220
     gaaatcctcc agtatctgag atctgagggc tccgataagt gcgacgaggt ccagaatcta     29280
     ctctttgcaa gccgaagaac agtggatctt atcgactctt ccttggaaat atatcattat     29340
     ctcataaggt taaaatacct tacgtccgat gtctcgagac tggtaccact gaagaaagaa     29400
     gacgaaagcg ggatccttga ggaccttttt gaagatttga atacccgtct gggaatttaa     29460
     cttctgttga ataaaagctc ctttgtagga aacagccgaa atatttcttt tctacaaatg     29520
     ccaccttcta cggagatcta ttttatatcc caaaaagtta aaaaatagat ccttcgatat     29580
     cctttgataa atgaagacta ttgaagagac ataccaaaaa aagacacctg tggagcatat     29640
     tcttcttaga cctgactcct atataggatc tgtagagaaa gaaatgcaac agatgtatgt     29700
     atgggatgag gataatagca aaatggtgtt caaaaatata gaatatgtgc ctggattgta     29760
     caagatattt gacgagataa ttgtaaatgc ggcagacaat aagatacggg atcctaagat     29820
     gaatgtcatc aaagtttcca tcgaccccga gaaaaatgag atatctgtgt acaacaatgg     29880
     gagggggatt cctgtcagaa tccataaaga ggaaaacgtg tatgttcccg aacttatttt     29940
     tggaaatcta ttgacatcgt cgaactacaa tgacgacgag aagaaagtca caggaggaag     30000
     aaatggatat ggagccaaat tatgtaatat attcagcaag gaatttatag tggagacagc     30060
     ggattgcgag gtcaagaaat actacaaaca gagatataga gacaatatgg gaatcaaaga     30120
     agagcctgaa attagtagat ataccaagga ggactttaca agaataacat ttaaacccga     30180
     cctccggagg ttcaaaatga acaagctgga cgatgacacg gtatcgttgt tgaagaagag     30240
     ggtttatgac cttggaggaa ttgtcaagga tgtaaagata tttctgaacg agaagaaaat     30300
     tcctgtcaag ggcttcaagg aatatgtaaa gttgtacatt ccatccgggg ttaatattgt     30360
     gcatcaggtt attaatgaca gatgggaact ggctcttact acgagtgaag agcaattcca     30420
     gcaagtatca tttgtcaatg caatctgtac ctcgaaagga ggaagccatg tcaaccatgt     30480
     tgttgagcgt attgtggatc cgttgttgga agcaatacag aaaaaagaaa aaggactttc     30540
     tgtaaggcca ttccagatca agtcgtgcat gtttatattt gtaaattgtc tcattgagaa     30600
     cccagcattt gattcacaga cgaaggaaaa ccttaccttg agagtatcag cttttggctc     30660
     gaaatgtgaa ccgatatcgg actttgtgaa aaatgttata aagaacacat cactggttca     30720
     aaaggtgact tcgtttgcaa aggctaggca aagccagcag ctaaagaaga cggatggagc     30780
     taaaacaagt aggctttctg gaattcccaa gcttgaagat gccaactttg caggaacaag     30840
     caagtcgaag gattgcactc tgatattaac cgagggggat tctgccaaga cattagctgt     30900
     ttcgggactc agtgtggttg gaagagacat ctatggggtc ttccctcttc gaggaaagct     30960
     gctgaatgtt cgagaggcat ctcacaagca gataatggac aatgcagaga tttcaaacat     31020
     aaagaagatc ctgggcttgc agcacaacaa gatctatgaa gatgtgtcaa gccttaggta     31080
     tgggcatatt atgataatga ccgatcaaga tcacgacggt agtcacataa aaggccttat     31140
     aatcaatttt ctggatcact tctatccttc tttgctgaag ataccgggtt tccttcagga     31200
     gtttatcacg ccaattgtaa gagcctcaaa gaagggcgag gtcaaagact tcttcacatt     31260
     accggagtac gaggaattca agaagaattc cgatggatgg aatatcaagt actacaaggg     31320
     attgggaaca tctacaagtg cagatgctaa gcaatatttt agcaatcttc cgatccatgt     31380
     aaagtacttt accccattga ttgaagagga caaggagctt attgaccttg cgttcaacaa     31440
     aaagaaggca gatgcaagaa agacatggct tctaaacttt gagcccggaa catttttaga     31500
     tcagtcgcag ccacagatat cgatctcaga ctttgttaat aaagagttga tcttgttctc     31560
     catggcagac aacattcgct ctattccgag cttggtggac ggactcaagc cgggacaaag     31620
     gaaggtgatg ttcagctgct tcaaaaggaa ccttaggtct gagataaagg tggcacaact     31680
     ggtagggtat gtatccgagc aatctgcgta tcatcatgga gaacaatctc tttgttccac     31740
     aattgtgaac ttggcacagg actttgttgg gtcgaataac ataaatcttc tgctcccgat     31800
     tgggcaattt gggagtaggc ttcaaggagg aaaggatgca gcaagtcctc gttatatctt     31860
     cacatctcta tctcctttaa caaggcttat attcaatgag aatgatgacg caatcctcag     31920
     ctatctcaac gatgacaatc tctcaataga gccggagttc tatgttccca ttattcctat     31980
     ggtattagtt aatggagccg aggggatagg gactggatgg agcacctcta ttccgaactt     32040
     caatccagtg gatgtggtag agaatatccg gaggttgatc agaggcgaag atcctgtgga     32100
     gatgattccc tattacagga attttagagg gacgattgaa aaggtgggag aaggaaaata     32160
     ccaggtttca ggaatatatg agggagacat ggaccttgaa atctccgaac ttcctgttgg     32220
     gacatggact ctaaattaca aggagttttt ggagtctctt gtgcaggctg gagttgtaaa     32280
     ggacttcaag gaataccata cagaaaagac agtaagcttt tcggtcaagc tttcaaagag     32340
     catcagcaac ctaaagctaa gcacaaccat caccatcaac aacatggttt gctttgatga     32400
     aaaccttgga attaagaagt attcgacgcc tcaggagatt ctgaaggaat tctatgatgt     32460
     tagacttaga tattattcaa taaggaagga aaacatgttg aaggtaatga aagaagagtt     32520
     ggtgaagttg gaaaataagg ttaggtttat aaaagaggtt tcaacgggtg agcttgtaat     32580
     tagcagaagg agaaaagggg aagttatatt tgatcttgag tcgagaagat atgcaagagt     32640
     tgacgattat gaatatcttc tgagcatgtc aatattaagt cttactgtag agaggattga     32700
     gaaattaaac aacgaacatg caaagaagct tgaggaatat aacaaactgg aaagtaaaac     32760
     tcccaaagaa ctgtggttgg atgacttaga ggtctttgaa agagagtatc tgaagattgt     32820
     tgagagagaa actaaagaat atgatgacga gctaaatgga tgtgttcgaa agaaagggaa     32880
     aaagccaaag tctcgaaaag aaaccactta caggccaaag aaggcaaaaa agcccaaatc     32940
     cccccaagta acggagaact ccagtgacga caattcctta gaggaaaaac cttggaagaa     33000
     gtacagcctc atataaattc tgaatgaatc acatcttaag tctcatcttc tgtggtagtt     33060
     tactgtgact cttaagaaaa ttgagatcga gtaaatttta ttattctttg cgtgcctttc     33120
     tatacattgc atctatcttc ttttggtact caatagaggc cgatttctct ttcataacct     33180
     tgtggtacgc ggacatcttg ctttccttac gaattgtctt tctcaaagtc tttgatttcc     33240
     tcttggcaaa atcagctaat tttggcttta gactcttgaa taccaccggc tcgtcttggg     33300
     gtagaggcag tactctttct tctccttgaa ttccaaatgc ttcaaaaact ccagggttcc     33360
     tttcaaacat cccagcataa cgtctataaa gatccttgtc attttcaaac agatagtttt     33420
     ttacttcgtt caagtaaatc ggtttggtct tggccgaaac aaatatctct attagttcta     33480
     tgatcttggg atgaggagct ttttctaaag ttccacctac tagagttccg actatgtcct     33540
     tgtactcctt ctctcttatt tggaggcctt tgtatcgtct tataattgca tctatgtcgt     33600
     tctgtaggat actcatataa acccctccaa tccgaacttt tattattccc cttccgaacc     33660
     aaagccctga gcacagatat ggttgataaa atggataaga gatcgatcag aaagctatac     33720
     ttaaggaaag acccaaaaga tccctatttt cgttcttctc tcactagact tgtggccata     33780
     ggaaacccat acctaacctt catactccat gctatgttcc gagatgttct tccaggaata     33840
     ccatgcccgg cgccgtttgg tattctcatg aagagcggaa agacaatcag ctatatagtc     33900
     aggcgtctta tgggaaggaa ggtggtattg gaggccaaga gcgagtcgga ggaactttac     33960
     agcaacaaat ggaacgaaag tgactatgcc gatattatga aatttctttt gaatatcgaa     34020
     aggacaaata agaggttgct gtttgttgat cagcctttta tccggaacgt gatatcgaaa     34080
     atatcggaag cagaaaaggc aagaatcatt agattcctag aggtctctcc tctttctata     34140
     tcaataatga gaacaataag aactgagaat ctaacagaca cccatctggc agtcatcaac     34200
     cttctgaagg ccaagaccat gccatatgaa gaaggattta gatatgttca tgaatccaac     34260
     gtggatttta agcttttgaa gagaacattc ttgaagtcca ccttttcaca gatacagaaa     34320
     tactttcaca ttctggtgga ctttttccca gaaatgatgt ttggaataag aaagccttac     34380
     agtaatagaa tgcaaatatt tgcagaccct ctttcgatac cgctcaagcc gaggttatta     34440
     tgtgtttata tccctgcatg catatacttt ataagaagga aatccaaatc tctaagcctt     34500
     gtaaagaacc tggatgtcct gattaagact atttacatcg aaaagatcct ttctgtttcc     34560
     cctaggaggt accttttaaa gaaagtgata catcagctga ttcttgacac acctattctt     34620
     gtaaaagtta ttgtaatgag gagatttccc ccaaacctca ttaagaagat ggtcgagtat     34680
     atcccatcct ttcaccttgc atacgagttg tctctcaaga ttctttccaa tgatccttcg     34740
     gatagcttct atgaggagct ggttgaagaa ttacttaaaa agtatccgac caagagtaat     34800
     gtcaaaagat tccaagcctg ctctcattta tttagcaact ctcttctgga gagactaaag     34860
     tatcttaccg agacagtcta aaaagtgaga ttggtagaat ctccagtgtt ttatttgtta     34920
     tcccaggtat aaagcttgta atttccgtca gaatccccag agaagcctga ataccattct     34980
     agatgtttta actttctgtt tttatgaatg aaagagacct gtattttaca ttagtctctt     35040
     aagaagaaat tgtccccact agctgctttt ccatatctcc aagtagttgt actttactta     35100
     gagaaaagaa ttacatggaa aatataatta aaaaccattc tttatatcaa acaggtctag     35160
     aataacacat atagttataa ggaatcccgt agaaagaaga tcagaaatcg atgaaataag     35220
     tggaagtgcc aagactcctg tgtcttcttc tttcttatct aaatactcaa caaggaggga     35280
     aatcccactc agcaaaattg taacctggaa aacaaaagat attataaaca atacacagaa     35340
     ctcacgtgag tatagaatcc ccattagtgc tgccattcca agatagcata gagacatgag     35400
     tatggaagct aataccaatg ttatatatga ctttctactg ttatgaattg tccgattatt     35460
     gatcgatgta aatatcctgt gaagataaat gaatgctatt gatacagaca ttccaccaaa     35520
     cacaggaaac gacggcgcaa gaactgggaa tctagtggaa aatgtctcaa gtacgtatcc     35580
     actagcagta ctaattccat atgttgcaag aagaacctcc accggctgaa gaggaattct     35640
     ctttttactg actagtacaa agcagagaca caaaggcatc aaggagattg agaggaaaat     35700
     gtatgaaaga caggatgacg gggaggagtc cctaaaccat ttggtaaagt ataccaaaga     35760
     ccttacattc gtgtaatctc caaaagatga tatggtaggg agaatgatat tgtctggatt     35820
     gatgtccata aattttgaca gctctataga tattacaagc agtataatga acaagatcga     35880
     agtcaatatg cacgatacaa gtgcacctgc aagtatggaa agtcctagtc cttcgctcaa     35940
     tcctcctgat aaaatgcctc ctgccatccc tattagtcct attacaagtc ctattgctac     36000
     agactgtgcc aaaaccatgc tagagttgtc aaagacatat ctgaagtacc tcctatatat     36060
     gaacaaagga gattgactca tcgacgaaag atacatcgca aatgttagtt ctatgttgcc     36120
     cttgaatgcc aaaatgcagt ttgcttcgag aatcacaggg acgcctgcta agcggggatc     36180
     atcggtggca tctatcagta cggatcccat gaggatcaag ccactcagcg atataagtaa     36240
     tcctggaatt gattgtatta gcagggagga atcatacagt gacatattga acaagtcccc     36300
     aaacatcaat tcgggcctct gagtttgtta agaagaaaaa gtttcgcaag caccaataat     36360
     gctttatgga agggtccaac gctccattcc atggggtttc aaatgctttg aaatcattga     36420
     tggacgtgat gaaagaaagt aggagaatcc tatgaagagt ggagaggaaa cccttgtttc     36480
     attttcaaac ataaggaggc cttgtgttcg taggacctgg aatttcaaca ggcttgtgga     36540
     atttctttta ggttgaaacc ttttgaaaac aacacccata taatcaatcc agagcatgga     36600
     aaaatcaaat gcgagcttta atttcgacaa aataccgaag ttcataatga agctctataa     36660
     ggccaccaat aacgagaagt acaaaggaat ctcctggaca cccgatgggc ttaagattca     36720
     catatatgac cgagacgtgt ttgttaagga gacacttccc ctcatatcga agacaaggga     36780
     gtttggaacg tttgtccgga tgttgaacag ttacgggttt gttaagtcca aggacattga     36840
     agaggaggac atatattaca ataagaactt cagaaaggga agagaggacc tgctggggtt     36900
     tgatgataca ctccgaatga ttaaaaggaa gaagtccaat gatattcgaa tgagaattgg     36960
     agatggatct ttgaaggacg tagtggagta tttatacgta caaaaccagg agttatatac     37020
     agaattgtct gcttgcaagg agcgcataga gaggcaggag agagccctca atggtcttat     37080
     agaaattctt tcaagggtct ttagaacaaa ttcccaggac ttcggggctc ggattaaacc     37140
     caatgctcat aatctccacg acgaaatgga cctttttctt ggagagcttt cagggcctct     37200
     caaagaaggg tatgagccgc cttctcctga tgtgcaaggg aaaggcatcc ctgaactgtc     37260
     ctttaagcca ggagaaaatt ttcaagtaga ttccgactct aagaacgaca ggtatgatgc     37320
     tttcttctag acatttgttt cgagtaggtt atagcctttc tcatagatgg ctatgggtgg     37380
     agagaacata ttagaaataa agatgatgtg taatcaacct gtcaattttc ttcattttgc     37440
     actgaaacga ttatccttaa tggagattag aaagagaagt aggattgttc gtgcgctggt     37500
     agccttgctt gccttgacat ctggagctgt tactatcatt gcctctatag ctaagctgca     37560
     aaactacatc aagttctcgc ctgaaaacga cggtcggttg gatgaatttg gtttccaccg     37620
     atcatctctt gaggtctcag tcgaagaatt tggatgtatc tctctcagat tttcagacat     37680
     aaaggaagac tattttagca taggcgagaa agagggacga gaagagaaag agagactgta     37740
     tcttgagttt attataaaca ctctaggcca aatctctctt caaaaagacg atgaaggaat     37800
     atctgagaaa aaagatctat ctagagagaa agagaacttg cggatcttag tttgtgagat     37860
     cagatacaat atctgtaaaa actcgaagct tgcaggtatc aagggaaaga caagctcgga     37920
     tccctcttca gtagcgctaa ggaggttttt gggacttgat aggaacttcc ttagccactg     37980
     tgatcttgag acagaggaga cgaaaaagat gttaaaggtt attcagggac actggccttt     38040
     ccgtttagaa gatgtggaat gcaaggtttt tggaaagact cttccattga aaggctatgt     38100
     ggcatctatc cttgctaact atctccttga gtgcaaaata gaaaagcaga agaggatggc     38160
     aagagatgca aacattctca tgagaattga aaccagtgga gaggtggaaa acactaagcc     38220
     aagcgaattt gtgatactga atgatgggga gtgtatgagc ccggaaacat acatgaatat     38280
     tgtacgagaa attctctttc ttgccaaata caaaaatatc atttctagcc tgagtgaagc     38340
     aaaagagaat cccctgtgtg ctgacgagtt atggtttctt ctacagaaat gtaagaacag     38400
     ctttaatagg aatttgtctt ataagttcga ccgaattctt gatagtaagc ctcggggtaa     38460
     tctggaggct gaaaacggcc agaattgtaa ggttgataat tccctagcag gttttcttgg     38520
     ggtatctgag gactttcgag atggggaact aagacagata aaggaaaaag acatatctat     38580
     tcttgaacac taccagaatt ttctctccga gatggttgat gagaaggtct attatcacat     38640
     tctagacgca aaaaaagcca ttaaagtaaa ggattatatg gcagtcctac tactcaggaa     38700
     ctataaggac aaaatataca agctggctgg ggaaattgag aaaaagaatg tttctttggt     38760
     gaagataaac ggcagatcta ttgagatgag gcgctatctg tggtttttgg ttagacttat     38820
     gcacagagcc gaatctttaa gtaacagtgc ttccaacaaa gaactcagca atggattaag     38880
     aaagttaaga gagaacttta tactttacat cgaactgttg atacacggta gaaggataga     38940
     tcatctcgac cctccttccc gagcagtgct taggcttttg ggaaaaggag agatagaaag     39000
     cattaataca gaagatatag agcctgagca cagttatata tttgaaaatg aggaactatg     39060
     tatttctagc agaaataatg tcttttctac aaagtgtaat ttgaatggaa ctgaggtatc     39120
     tcttgggagt tatgccgtga gtgtgatttc gaaatatctc aaggagtatg gtaaatacaa     39180
     caaagaaaaa gaggattcag actctaatgt tttcaggaat gtgaatgaag cactctccat     39240
     aagatacgag gacggtagac ctgtgggaac ggaatacttt gttatggtaa gaagtatgtt     39300
     tagaaaggcg ttttgctatg agttggaaca tcttttgaga aaggcaatat ttgacgatga     39360
     gcctggatct agtataatca agtactatct ggattggaag ataagaaata ttgatgagtt     39420
     tttcctgaag gcctttcgaa tcacaatgaa catctttgac caaggtggaa agagagttcc     39480
     ctctcatgct gccagcatga tcgaaaggat tttggggaat gatgttttct ttatgggaaa     39540
     tattcgtcca aagccgaaag atgagaaatt attcaagtcg attttgttcc gatttcctcg     39600
     aaagtacaag aaaattgaat gttattttgg gaataagaaa ttccgactag ttaatcttgt     39660
     tggcaaggcg attgtggagt atcttcgatc cgatcccgat ggacatgagg gcctctctct     39720
     tgagcttgag aggagcttgg tgccggagac ggcatcctat gaagaatgac aaggtactca     39780
     tgcaggctca tatgcataaa aacctcaacc ccaaagtttt tatggggatt gaaagaagaa     39840
     ggttctatca gaaactcacg gtgtttatag tccttatgtt tgtatcgccg atagcagtcc     39900
     atgtgattgg aaaatggttt gaatccaatc ctccggcgat ctcgtttata tcattattct     39960
     tagtcttggg atcgatgggg gcaatatgca agctcgtgat cgacagggag caagagaaaa     40020
     ggaatagaag agaaagaaaa attaaagtca aataaattct accaggagtc ttgtttccat     40080
     gactataggg ttttaagcca tacacctagg ttttcgattt aaatttgttt atttctgtct     40140
     tttttagatc tgcaagaaca ccccaaatga gtgaggcctc agtgatagtt cacccattgg     40200
     tgctactttc tgcagtcgac cactacaaaa gaaaagggac caagagagtc gttgggatac     40260
     tacttgggag tgacgatgga gaagttcaca ttacggaaag ctttgcttgc atatttgagg     40320
     aggacgagga tggatggttt atagacactt catacataag aagtatgttt gatctgttct     40380
     acaaagttaa ccacaagctc aaaataatag gatggtacca cacaggacca aagatgtatg     40440
     gggatgacct ggacataaca aggtctctgt caaactttgt cgaaaatcca tttcttgcca     40500
     tcatcaatgt ccatcttgga gaaaatgatc ttccagtcca gacattcagg ttagacgaac     40560
     aggacgaatt tgtacatgtc ggatgcagca tagaagccga agaggctgaa gaggtgggag     40620
     ttgagcatct gatcagggac atcagagagg aggcaagtgg gtcgattgca tccaggatca     40680
     atggaataaa ggagtcgcta ttggtttaca agggggttct ttcggagata agatcctatc     40740
     ttgaagacgt gataagcaag gacatccatc caaatcagga aataattgat ctctgccagg     40800
     agatcatcaa ctcaattccg aagctggaga agcctcttga tgagaacctt tccgactgct     40860
     atgtttctgt gcttgcaaag actgtgattg cattgaatga tttgagaagg aatagacttg     40920
     agaatggaat cgagatgggt acgccataac tttaataaaa cgtgtcacat ttctggcaga     40980
     aatgtcttca aatcgggcta ggtttttttg taaatttttc tttggggtat gcagcatgga     41040
     gattagccac attgtttttc tggataatgg ggatacaagc aaagttaacc aacaggtggt     41100
     gtgtggtaag tatcttgtat tcaactctcc ttgggatgat tctcaagcag acactaaaat     41160
     aaaaagagat ggaagaacat tggacataga gtctaaagag ataatcctca aggttgccag     41220
     tggaaaaatt gtttacttgg agactgttta tcctgtaagt accggtgttg agtttgtgga     41280
     gcttatatcc ccacccaatc catatgattt ctttctcctg agaaagcact ttctttccaa     41340
     gctaacagga gtatgtccca gaccaatgga gaaggaagta acatatccaa agaagaggag     41400
     aataggatgt tttatcatgc cggtaattct gtgtatacta agaaagcctt tggagtattt     41460
     ccttgtcaat attcctagtc gcatcgtcga ctatataatg aactcctcag tcgaggaaaa     41520
     gcaaatcata acgataaaga caaccttggg cgcctatgta aaattcttca ccaccatcca     41580
     gagtctattt ttgaggttgg ggtttccagt agtatttatt gatggaattt atatgattcc     41640
     aacagcagct tgtttatcaa tattttctcg cctaggtctc ttcttagcaa agctgctggt     41700
     agagtccatt catctactaa acaacagtag ctacaatccc ttaaaaaagc ggagagactc     41760
     agttgtcctt aacacagacc aaatattcat gtctgtactg attttctcat ttcttctttt     41820
     gatcacattc aatgttgtgc atttctatgt tctttatatc tttatgaacc tatgtctaat     41880
     agccttgaca acttttagcg attttataga tttcgtgcta atagacatct cgaaattcca     41940
     tacatacact ctttcaacag atcacaccaa acaccgccaa atcaagctca aatacaccaa     42000
     ggtctctatc taccacaaaa tcaaatttgc aattcaagca agtcttctct cttcaaagac     42060
     gctcaaagac actgttctag ctaaatatct gcttgaaata aagtagtcct ttttcatatt     42120
     tctccattcc aagatatccg aaatcaaaaa taaagctttt attatggaac aaatattctt     42180
     tgttgcatct tctccccatc tttcctgcag tgtattgcct ttaagatttc gtcgtccgat     42240
     acttttcccg ctagagaggc atagaacgac tcaaaatctc cttctgaaat cgatatcaaa     42300
     aggcccagat tcaggaggtg agtaagcttc tggaccgcct ctgcgctccc aaagttcttg     42360
     gcaaattcca ggaccctaga aacatactct accatgtttc ttgactgttg ctcatcaaat     42420
     gtaaggtgca atattctact gtataaagca gaatagagat cacaaagaat tctgtttatc     42480
     aggatcttgg agttttctcc tcttatcgac atttcagatg cctcactaat ttccttctct     42540
     ataacttcca gaactctttc acatccctcc agattcacaa aattctcctg tttgactcgg     42600
     actccgattc tcatggcaca tgtttctatt tgatcctcaa atgcatcctt gagcttctta     42660
     ttgatcttat ttctgaagac cccaagcttc tggaatttat ctccaaagta tttccttgtc     42720
     accaagtaaa tgaattgaag caactttatc acttcaaact tgctttgcat cgaatcataa     42780
     acgctagtaa caaatccatt aatcttccag gagaaaaagt ctataagctc atcttcctct     42840
     tcctcgttgt agaacttgtt acatctctcc agggcaaagt ttatggtgtt aaggagctgc     42900
     ttatacatga agatgttact ggaatcgttc ccaacttcct ctccaagaat gatgtacttg     42960
     gtgttgcaag gcttccgaag aacaagaatt tcatagatct ggtcgaaaaa ggctttctcc     43020
     ttatcaacag caattctggt atactgcgaa ataagatctt cggtggcatg agattcatcg     43080
     aaatctgggt ctattgtctc gatgaacgat ccgagaatct gaagattccg gtggcaactt     43140
     tcaagcccta gaagaaacgt gcagggactt gttcccttga gatagtcgcc caatgctgta     43200
     gaaataatgt cgtcatatac cttcttgtgt atcatcttat atacatcctt tgtatttaca     43260
     aagatatccc caagatccct gaacttgtcg tcatatgcat ctctaatctt gcttatcaac     43320
     tccacaaacg tgctatgctc aactgcgtgg aagtcaaggt ctatgatctt ttcttccttg     43380
     ttctccattc taaccggctc cttaaacagg tccaaggaat atatgtagga atgaacgaga     43440
     aaactttcct ttcccatttc aagtaatgag ttatatgcgg acctcatcat tgtcttgttg     43500
     ttctgcttat ttcctatttc aaacacatca agcatcttgt cttccattgc cttattgtat     43560
     tctcggagct tctcgcagtc ttcggtcacc tttgagatgc tatacaaaag aaaacataga     43620
     aatctccagt cctcctcgct atcacttgag ataagactgt caatcacatt gaaattcccc     43680
     ttctcaacct ccatcagata ctttacggct ttttccattc ttttgagatg gttgatcttc     43740
     ttgttttttt ctagcacgtc tcttgacggc ccaagcggct ccagaactat ctggcctatc     43800
     tctttgctca gatcgtcaat cttgtcaagc ttcagtccct cctggacggt acgaagcttt     43860
     gtgttgagct tttccctctt gaaaaacaaa ccctctctta tgttctcaag gtctccaaca     43920
     agctctacaa gattggtatg tgtctgaaaa acattgtctt ctttgatatc aacagattcc     43980
     tcaacaagac ttgtcagatt gaatgaccca gctctcaact ggcttacatg gacgcttttc     44040
     atcaggggag acaacaaatc acgtaatcaa agagacctga gaggaccgac ctcgagtccc     44100
     aaaagaaaga agagttagtt caagataatt taatgatggc gattagaaac cattccactc     44160
     ctcggtattc tctgcagtta ttccacccaa aatctcttct ttcccaacgt taagaaccgt     44220
     atttgttgtt tcaaggagct gctcttcaat aagctgctca agctcgacac tgtctctaaa     44280
     gaggaaaagc tcgacttcct tcatgtctcg agcaagttcc gccccggtct tcatgtaact     44340
     gattagtctg gataagataa aaaacccggc agcaatagca gatggcgacc tgttgttcat     44400
     ggggatggca atgtctactc ccaccagaga gttgtctgca ttgacaaatg caatggttgg     44460
     aagattgcag tattgtgatt ccaaaatcgc ctgcttatcg gcatatgtat cggaaacaat     44520
     cagaatcctc gggtcataca ttcttctaac ttccgagttt gtaaacgatc cgggaataaa     44580
     ccttccggtt attggtgttg caccgacagc ctcgcagaac ttgacaacgg gctttcttcc     44640
     gaatgtcttt gtagatacca cggcaatgct agagggatgc tttattccac aaaaggcccg     44700
     agctgcaatg atgagtttct cccacattgc attgatgtca ataatactaa tcttatcatg     44760
     aggccttgtg ccgtaaaggt atctagcaaa gttcttgttt gcggaggttc ctccaagatg     44820
     tgcctggcta agtataagca acttaacaaa ctcctctgga attttgatac tatccgagat     44880
     tctggtgtta tcttgcggca tttcaagggt acaaattttt tcaggattat gcatttagca     44940
     cggagcaaag tagaaacaga agcccaggga ttattaggaa ggaattctct tttcatgtga     45000
     tgtattccaa ccttctttta caaaaaattc ctgtaagata ttggggccag attgcaggtg     45060
     ttgaaatcaa ttcttttagg acgaatttat agcccccgta gctcagtcgg ttagagcgtg     45120
     gtacttatat gctggaaagc tgtgcaatac ttggtttata ctgctaagat atgccaaggc     45180
     cgcgggttcg agtcccgctg ggggcagttc ttttcttcta atattctata gtttctttta     45240
     attcctttgg ctttcttcct agaagtagat tcctaccttc ctgaactcca acagaagagc     45300
     aaggaagtcg tcaatgctca tcttggcagc ccgagccccg tcaagctctg ccctggacaa     45360
     aaccttttca aacacttcct ctggcgtggt gttttcaaag ctagggtttc cttttacctt     45420
     gctgaccaaa gacgaattcc taaagttggc cttgagagtc ttgttttttc taagaaagca     45480
     tatcttcaga aatctgtcaa actcctcgag gtctattggg ggcctgggaa tccgaggctc     45540
     tatccttaca aaactcgact cgatctttgg tggaggcaca aagctgttct tggacacctt     45600
     tagaacatga tccacctgtg caagcatctg tgctccaaca gatagcctac agtactctga     45660
     acttccaggc tttgccacca gcctgtctga aaactccctc tggaacatta tgaatgcaca     45720
     tttgaagtca tattttagaa gcttgaacat aaacgggctg ctgatttgat atggcaagtt     45780
     actgatgcaa agatcaaaat gggggaagtc atgcttcaat gcatccccta caaacaactg     45840
     gaacttctga gccattccag gagtgccgtt aactttcttt gccagctcag ctgccagcct     45900
     agggtcaatt tcatagcata tcaccttctt tgccttctga agtaacttca ttgtcaagtt     45960
     tcccgtccct ccccctattt ctagcaccgt gtccgttggc ttaatctttg ccctctctat     46020
     tattgtgtcg attactccca tgttcttcag tatatgctgt ccatgctgtt tattgaactt     46080
     tggatttacc atttgaacac accccaccat gcataaaaat ttaacattgt agatggattt     46140
     aatcgctgag gtctccaaag aaaacccccg atggcgttag aacatacaaa gacttttccc     46200
     cacggacaac ccagcttgcg tctcttggga cttccacaga gacttctcca aaaagatctg     46260
     tcaccattcc accaaatgct ataagattgt ccccgacaac cctagagctt ccaatgtctt     46320
     tcttgaagag gatctttgct ctacaagtat cgtacttcaa aagtagatct ccactggtta     46380
     caatgtacaa atatccctcg cgaggtacta acagctttac agtgtcaaag accttcagca     46440
     ccagagagga atctttgtag acatgcccaa ggggtgtggc atgaaatata gaatctccac     46500
     tgacccagaa gtcctgaata attgagtatc catctttttc tctgcatata ctttgattct     46560
     tgaagtactt gatgtcctca aatgccgacc catacagaac cccatcccct ccaagaaaat     46620
     gcattcgtgt tctgcccatt attacctttt tgacgcctct cctcatctca ggtaaattga     46680
     ccacaacctc cctagaaatt gcatcaaaaa caataatctt cgatgttttg aacacaagat     46740
     atatgtaatg ctcgtagatc cccatcttca atatgtctcc atagaatgta tactcctcgc     46800
     ccgaggataa agcaatcaat gtgcttctgt tcgtcaggca aaatacattt ccatcataca     46860
     ccacaaattc cttacagtct gatattcccc ttattagcct gaaagaaaca ttaggaacct     46920
     ctgcaaagag ctttatacct tccatccaaa ctcaccttct tttggggtag ttcaaaacaa     46980
     ttcttgaggg ccgtccagtg ggaaaaaatc atgatggtag agcgtcatta tattttattt     47040
     tcaactaaac aatactccgt ctgagaaatg atacaccttg tcgaacttat ttaacaggtc     47100
     cgaattccgc attatcatta taatagtttt gtccgagagg ttcttcataa tcatgtcaac     47160
     taatctattc tcagactctt tatccatgtg agaagtcacc tggtcaaata tatatataga     47220
     tgcatctttg acaactgtcc tcatcatact gaccttttgt ttctgtcccc cactcagtct     47280
     gttacctcca tttccaacaa gggtttgata ccctccatca aggtttttaa ataccccatc     47340
     cagctcatac cttttacaga attccacaat ctcctcatcg ctcaaacgtg agttcccatc     47400
     ccttatgttg ccaatgacag atttgttaaa cagctgcgat tcttgaggcg agtacgctat     47460
     catcttacgg agcccctctt tgctcaaacc attgagctcc ataccgtcga tttgaatgct     47520
     cccagaatag tcaagaaacc caagcagagc tctagcaaaa gaagtcttcc cccctccgtt     47580
     gtctccagat atacctatct tctccccctt tcttatgcac atgctcacat tccttatcag     47640
     cttcttgcct tctatcgata tctccaaccc ctcaattttt atctctcttt ctaagttctc     47700
     cttgtagtac ccgatttcct gtatgtcctc cctactcggc tcgcttctat tctgtgctat     47760
     gtttgtaaga ttcaatagaa tcattccaaa gctgttgctt atgtcgacac aatacattcg     47820
     aagctggtta cttagtgaga atatcaaggt atagtctcga aagccaatat tcttcgtatc     47880
     tccatttgaa aatcgaacag tcattataaa cattgctatg acaaacatat tctctccaat     47940
     aaagtttcca acctgcaacc agctccaata tatcttggca tattttgttt ggcccttcat     48000
     acatttgtac agctcgtttg cctctagctc ttcgttattg tatgatttta taatgtcata     48060
     attcaatatg ctgttgtaga ttttcctatt cgacaggtca atctccttgt tcatcttcag     48120
     tctgatgatg tttcgatagt ggtttaagac gatgacacat actccataga caatcacaac     48180
     tcctgccatg agcaacccat agcgattctc aatcccactt cggattttaa tcaccgttat     48240
     cagtacacag aacagactca ttataaagca ctttataatc gattccaaga catctcgtag     48300
     agacaagacc ttcctattca tgaatgaaat catgtctccc acccctatct ttttgaaatc     48360
     taaaaacgac atggatatat gctccctata cagatctata atgtagtctc tacatatagt     48420
     ttctatgtag ctagacatca caaacagaga aacaaatcca aacacatagg aagaaagagc     48480
     tactgctaaa tataccttga tttttccgtt cacagcctct gtctcatcag ccttctcctg     48540
     gatttcattc agaatttctg taatgaatat ttctccatat cctgctacta gtaatattgc     48600
     aatcacagga agaataatga ccctaacaac cggagatcca agaatatatt tgaaaaggat     48660
     atcccttact gccgagagtt tgctggatct cttcataacc tctttcattt ctggggtaga     48720
     attttcctct ccttttcgtc tattgagtct ctagtagctt gggaggtcta aaatcccatt     48780
     cgaaatggat tattgggtga gcttcacaaa cgcaatgttt ggattggcag aaaaggggtg     48840
     aagggcaggc ttgaacttgg agatggcctg tagtggtgtt tacaggattt tctgcccctt     48900
     ggaatgacag tcgtgcaata catcctactc aggagtgact tgagcttttc aagaggcgca     48960
     gtaattgccc aggcctgcca ttcaagcgtc tattccatcg aaaaatacag aaaccaccca     49020
     gacacaatag agtatctaga aaacatagaa tctatggcaa agataattct gaaggtaagt     49080
     ggatggatta attttagatt aaggaaaagg atgtggaaga gatagccgga tatcttactt     49140
     cgaaaggcat agaccatact gtttggattg aagatccgga aagaatacca acatgcatat     49200
     ctctcaggcc gtacaaaaga agccatatac ctgatgttgt tgattattta gcaaggtttg     49260
     ggctattccg ttgattacaa cctgaggagt ctcccttatt tatctcctta gaggctcctt     49320
     ttacgataaa gaaagggaca ttggaatggc tctattttag ggcaaaaaca aatcccctgg     49380
     agtaatgaac tcatgtctca aggatgaata caggcggcag ttgatgggag attgcaatca     49440
     gatgccttgc cataaggtgt tctgcagagg aggtctaaag gacgaggtgg ttgaggcatt     49500
     atcagaactg ctttcaaggt atggagatgt gtttctatgc agaaacatat gcaaaaccat     49560
     tgatgaagct tctggaagaa gcttaggaga agatggagac ataatcctag actttttctt     49620
     ttgcataaat ggaatgggcc ccaaaagagg acctgcttcg gaaatcagga cttgcgaaga     49680
     tgacgatggt gcaaggaagc cccgaacgaa aaacgaagaa gacaaaggcg tcttaaggct     49740
     tgagggagga atggagtcaa tggaatgggc caagagaaag tttaagaaga aaggtgttcc     49800
     tttgttcaaa aataagaccg ggaatagatt tggatgcttg aaaatcaacg agatgaagga     49860
     tgagtttgat ggagcaggtc ggctcgacca cagtatttgt actcttatat ccagaaaaga     49920
     agaaatctca gaggagaaaa gatacattct tattggtgtg ctccatctac ttctcaagaa     49980
     gtatgaaaac tctcttcatc taactcttgg aatgatgatt atcagaattt attactcgat     50040
     aagtagatat gatgatattg aagagatata ttatccaata ttgtacaagg tgttctgtaa     50100
     tatacgtagt ttgtacagtg aaatgcttaa gaagacttcg ctcagtgaag gcataggttg     50160
     cgaaggagga aagatagaca tgagagaagg ccgggctatt tgcctttacc tccccaggtt     50220
     tacaaggctt gatctttcga tgcttgtaga caacataact actactctta attctgagga     50280
     ggtgattgac agccgagaaa gtaagagagt tgataatctc ctaggaatgc tccatatgct     50340
     atatcttata aatgaggagt gtggtttcct cagctacaaa aaattctatc tatctgcctt     50400
     ttgttcccgg atgaacttcc gtgaggaatt caagcacttc agaacaaggt cgaagacacc     50460
     tcttaatttt ccctttatcc ttcctgtcca catcaaggca gagctgatta agtatgaaaa     50520
     taacgacaag atgaagacat ctttacaaga ttcctttttt aagtctctat ttgaggggca     50580
     tgtagatcca tatctgttca ttaccgtcaa tagagaaacc gtgtatagag atagcataga     50640
     aatattcaag aagatgaatg tcctggatgc taagaagcag cttagaacca cattcaaaaa     50700
     cgaggaagga gttgactccg gaggaataag aaaagagtat ttccagctac tgagccagga     50760
     aatcaaggaa gacgaaaggc tgtttgaaca cacagagaac cgaatctgga tcaggcccca     50820
     taaaggggat gaagaggaat acgaagctat tggaagaata attgccattg cattttacaa     50880
     caacattgtc ttaaacattc catttccaag cctattcttc aagaagcttc ttgatagaaa     50940
     gccaaccctc gatgatctta gagagatatc ttctggtata gccacatcgc tgaggaacct     51000
     caaaagactt tcaaaggatg aaataaacgg actagatctc cgatttgttg cggagcatat     51060
     agtcgatgga actacaagaa tatatcctct tgtgaagaat ggaaaaaaca taaagctgac     51120
     atcggaaaac atgaaactgt ttattgaaaa atatatcgag ttccatacag acactcttat     51180
     aaagcctcag ttcgaagcca ttaggagagg attctactcc ataatagaca gggacaaaat     51240
     ggtatacttg gatccaaagg aattggagaa gataatgatg gggtcgaata catttgacat     51300
     caaagcaata agatccacca ccacatactc cggattccag gaagattccc caatcatcac     51360
     atacttctgg gaaatattcg aggctctgaa caggaagaaa aagaaaaagc ttcttcagtt     51420
     cattacggga aacgacagga tacctgtctc cggctctgca tcgctgaagc tcatcataat     51480
     gaaaaacgga tgcgatacgg acagactccc ctcctcgcaa acatgtttca acacacttct     51540
     actccccgag tattcatcca aaaggaagtt ggagaaaaaa cttgaaactg cactagagct     51600
     cactgcagga ttcttccttc tctgaaaata aattatcata tcatctccgc ttcccaagga     51660
     acaaggtttc ctcccctcca tcactgctaa agtcgagatt gattgcagga tcaattggtc     51720
     tatgtatctt tctacctgca tatagattct cctttatatt ccttcgaagc ccactacacc     51780
     ggaattcttc aaggaatgca gcctcgtctt ctcctagact tattccaaac ccctcttctt     51840
     cttcaacacc tattctcgaa actcctttac attcgtagaa cactccacga cggcccccgt     51900
     ataaagacaa agtcaccttg tcgcttccca cactgtactc ataaagatgt ttattattat     51960
     tctcccataa ttcgcttctc ttcgagatcc tcacaaacac catcttcgat cctttggtac     52020
     cagaattact catcttcttg gagtaaagga ctttgttttt cattctgatt ccaaactcct     52080
     acaccaaaat aaacttcaaa tccattaaat cgggatgcaa atcccttggt cactcgtctg     52140
     ggggaacata cttctccaca tccctttttt tcttttcctc tctttttttc tttctttctc     52200
     tgctgctttc tctttcttca aaatcaaagt ctccatcaac aaagtattcc ccagtctcca     52260
     tctcaatgtc ctcttttctc ttgggaacat ccaggggcat atttccactg ggtcttccaa     52320
     caactttctt ctttgacttc ttgttgctct tcttgatctt tggaagaaaa cggctccaat     52380
     cctctccttc tttgcttttg tcttcttcca gctttctttt ttcaataaga ctcctaatct     52440
     gatacatcgg atgaatgttg ttcatacaat caacaacaat cttcttcacc tcttcaattc     52500
     ccttgaaact acctataatg cttactgtct ttccatgaac aagaacatgg cattttgtta     52560
     gtatctggat agctttcaaa gtcatttctt ttggccctat cagcctatcc ctccgctttt     52620
     caaatacctt ttctgagctt gccatcttct taatgtcaac cacctcgcag aagtactcgt     52680
     cttccaacac cttcattgct tcctcaattc caactccccg gctcacaagc ttaacaaagt     52740
     taaccgcctt aacaaatata aacgggtctc ttgtacttct gtttgtcatt acgtcgatcg     52800
     ttctttctcc catgtcgatc ttacaagata tcttcttcgc ctctaatgcc ttttctatgt     52860
     atttctgtgt ctgttcaatg tatttttccc tgtacttcgg aaacatcacg gtttctgaac     52920
     tcatctcggc aaactcatgc ttgaagtcgt cctcacaaaa cttgactcca tcctccatcc     52980
     agggccccaa ttcttagctt ttcacctata caaatttctg tatcctctcc ctcttctttc     53040
     ttccaaccac ctcgacaaag ctatcttcta ctgtcttttc tccttgtgac gcctccacac     53100
     ccttccaaac tcttctgggc ccccgaacaa tacaccttct gggctctggg agtatcctag     53160
     tcctctcaat tcccaccctc accagctttg caatttcttc ccataatttt ttaatgattt     53220
     cgctctggag gtttaacatc tcatcgatag attcgtagac attgcacatg tgtttgtacc     53280
     acttttgaac atctatatcc cccctttccc atgcatcagg acataaaaaa cctcccgtgt     53340
     attcatatcc aaaaatatat gagaaataca tcttatcttc gtcgaaatct tctcccttcc     53400
     ggaagtatct atggaagtag atgtgtgagt tcacgtactc tcttttctgg aatccaaaag     53460
     taaataaaat atcttcgaga tctcttcttt tcatcttcac catcttagaa ccgtccaagg     53520
     catctggaac tcctactttt ccgcacactt caaatgctcg tccatcttca acccatttca     53580
     gcaccttgtt cctgtcgttc tcgagtttcc catggataaa tcttactaca gatagataat     53640
     agatgtactt ttctctcctc ccatcaatat ccttcctcat ccaaaaatcc tcagaaggga     53700
     tatcaatgtc tatcttttct cctgaaaaca gaaaatccat gtagcatttg tagatttatt     53760
     gaaagtcttg gacaatatca ttgaacttat gccttttcac cttcaggttc acagttattc     53820
     ccgaagtctt cttgactttc tccttctcct ttttcttcgg aggggacttt tggggaacct     53880
     tgggaacctc caaatctcca acctcatcga ggaatccaaa cgagcagttt gcattgtctt     53940
     ggaaatatct ctttgcccat tctaacatcg attcctcaaa ctcaatcttg ttacttggat     54000
     cgtaatttat gcttttaaat tcatgatacg gcttcaatgt cttcatgtgc gagcacaaag     54060
     aaaacagaga atcccgaagt tttgaaatct ttttctcgtt ttctctaagt cttccaatca     54120
     tttgaggaac ctcgctcatc atgatgcgga tgttctcatt catcgaatcg atctcttcct     54180
     taggtatctc cctgtcgctt ttatggttca ccttgtatat cataccaagg aaattcttct     54240
     tctgcctttg gaaaaatttg ttataatact tcagtccaga tcttccaatc ttcttgaatc     54300
     catagctctc cagaagcctt ttaaattctt ctattccagt acaaaatcca aaaaacggcc     54360
     cggtaataaa tctaaacatc ccggggttcc ttataacaat gcatcgtccg cttttactcc     54420
     attcaattgc tgtgaaacga gtactgtcca ccatctcata tagtatctct atttcctttt     54480
     ctacggactt tgatttccca accattcttt caaggacttt tcagactaaa catttttggc     54540
     tttcctggac tttgaatcta catacttcac tccatcctta aaaaggcgga aaagcatctt     54600
     atacacactg ttctgagaca gcccacacag ctcaatttca aaactgctcg agatggtaat     54660
     ctgggctctc ttcctggccg tcccatctct ggaatctagc cgtctcgaca tcttccttat     54720
     aaacacttca aagattattt tgtattcctt gcttatctcc agactgcaaa gcctctccag     54780
     cactctaatc gacttgtcaa atctcccgtg cttcatccat gccaagcaca caagaaactc     54840
     atcccacatg gtctctctcc tttcttcaac tcctaggatc tttccaaggc gatgcagaac     54900
     accttgggaa taccggtctc tcttttctaa ttcttctcca agaaacttcc ttgtaaactt     54960
     gaagtatcgt acaagacaag gatacatgga ggatagttcc acaagcttgg gcaacgccag     55020
     tctcccaaaa tactcttctg gtgcattcct tcgcacattt tcaaatagat ccagatcccc     55080
     aaccccgaaa tccttttcat aggccctgta ccttggagat tgtaagataa gcgcttgtag     55140
     ggcatccctg cgatatttac tctttgtcct gtatacgtgg taaaatacaa tatcgttgtt     55200
     cttaaagaat ctcgaaaaca cacacacata tcttactgca agatcactga ttcttgggtc     55260
     tgtagagtag aacatatgga ggatgtttgt gtccacctcc tccacatgct tactaacctt     55320
     ctcgagatac ttcagtgcta gggatttggc aatccgattc tttgcatgga ataactgccc     55380
     catcttcctg attccacccc ttatgacctc tttttgcgag gtggacttta tgatcctctt     55440
     caaattcgac agacctacct cgatatcaga ataagaggaa tctggagaaa tatctatctt     55500
     taggagcttc ttcaaatgtg tgttcggctt catgaaatgg gttttagaag aagggattaa     55560
     ataagacatt aacaaatcga tgctttcaga gtaactatga caactggcat tacaaaatgc     55620
     tggttagtgc ctcatcatta agcattgtca gaagattcct ccgccaagct cccgaggaaa     55680
     ctggtactcg gaggatatcc tctgctaggg gctatggaaa gacctattta ataaaagtaa     55740
     ttttctcttg gcaagcccat gtccatagag aacaagccat tcagttttac atatattatc     55800
     cgtaactttc atagaataat ttccaaggga aaggatggag cagcatggag tccttgcggg     55860
     agagaagtta taattacaga ctctgccaag ttccaacggt tcctcgagaa attgtcaaga     55920
     aaaaaaaaag gctcgaagct agactacctg aaaagaaatg gctttattcg gggaaagaca     55980
     atgaaccaga aatcggtttt ctcccatcca tggtttgtaa gagggcagaa agatctcctg     56040
     aagaacttca cgctcaaaaa ctccttctgt tggtcacagg ggatacagat gggaagccat     56100
     ggagaacctg atgacccact ggactcattg aagctagggt tgtttgattt gggaagaaca     56160
     ttgttcaatc tccggaacag ttgtttagat ttgaattcgc atattcagct tctttttaat     56220
     atggctaagt ctaaatcatg tgagtaactg gaacagtgag ttttgacgat ggtgggggat     56280
     ttaacccttt gtgaagagtg aagggatgaa aagcagagag agggttttgg aggacataag     56340
     aaacagattg aggacactgc tgtcgagcag gaagtgcata ggcatggaaa gcataagaga     56400
     tgactttttt tttatgataa caaatcctaa aatcttcgac gagctagtga tggaaccggt     56460
     cttttcttgc aataaatatt gggagtttaa gagactaatg tatctttgtg gatattcgca     56520
     tatcaataga tgtatgttca tgaagggagg agaaaaggaa ggccgagccc ctagtatact     56580
     tcttaagagg cctgaagaaa aggatctttt gcgttttgaa gaagccttgg aagatctgcg     56640
     gaaaaagtat ttagatcttg aagagattct ggacgatgta tgggacagac tggataatat     56700
     agatggtgct cttgaaagat ccatgggagc aatacgggat gtatttaaca aaggagcaga     56760
     agtctcagga gttgatctcc aagaaataaa tggacttgtt gattcactaa tgaaatatga     56820
     tgagtcggag tccatggata cattcagcga gggagcaact ccggaagaat ccgatataga     56880
     agcattttcg tcctcctcag aggagggcca cacaaaggtg ttggaaaata aagaaaagaa     56940
     gatcagtttc ttttaggaaa ccttgggtag actaaaagct ttactttgga tggtttgggt     57000
     attaaagatg ctttttctcc cctgtttgct tttgtgtttt tgtgtcaaat gcttccagcg     57060
     ctatagatcc tagcacccca agtattgaga gggcttgtat ctttttgatc ttgtggccaa     57120
     acacaattaa tgacaaaagg atcgaaaaca tctttcttgt aaggttgact ttagtaaggg     57180
     ttagagaacc atgggattgt atcattgagt agattacaat ctggccaaag atgttgaatg     57240
     tggagtacag aagaagatct ggtgcaacct ctggtgttgc ctttatgaat gcaatggaat     57300
     atctaaggtt atctgtaagg aggattaccg tgaaagagat taggaatctg aatagattgg     57360
     tgtagtacat catatgaaag gatgaggcct ggaacttcct aaagatgtgg tcctgggtcg     57420
     aattgatgat tccatcggca agaagacttg tagtgagaac taaaattcca atgaggctga     57480
     gtctagatcc cgaggaattc tttccatcga agtacgaaaa agaaagaaca gatatggata     57540
     tcagacacaa ggaaaaatac ttcctacggg ttagtgttct tctgtatatg agaaagttca     57600
     tcagggcaat ggggagaagc ttgcaggact ttgctattat caatgtcgga tagctaatgt     57660
     acctaagtga gagaaaccct agttgggcag atattagact tagagacgct agataagcat     57720
     aatggaatag tatagctctc ccaagtcctc cttcaactcc tttgcaactc atcatcactc     57780
     ttcctatcac aatccctcct agactctgca gtaccaatgg aaacaggacc gattcgtacc     57840
     tccggccatg gtatgttgta gttgttagct tttctccata gattccaaac acaaggaaga     57900
     atgcatatat ccctacaaca tgaagcatta agctgacgtg cttgttcaga gatcccatgg     57960
     gcttaagatc gaatcttcac aaatcaaaaa gcattccatt aaaatttgtt tatctaccca     58020
     tggagttcaa ggcttctttg agactgccat gcgagagccc tgagattgtt gcaacagcta     58080
     tacgatgcga ggatagcgat tgcgacatgc cggaggaaac atattctcat gaagatgggt     58140
     acttagttgt gaatgtttct gcagccaaga taaaagatct ttccaaatca ctcaactcgt     58200
     tgttgtcaag gttcaagctg tctgtcgaaa gcatagagat gtgcaaaaag cttggaggca     58260
     ggaaggaagt ggggtagaag gtcctatgca gtatttccaa aataaattga atttaatatt     58320
     tttatgttcc atggcagatg tactttcttt tctaggacct catgattccc cggaaaacaa     58380
     ggcttcgaga cggttgagct cgttctcatc agcctctgtt ctaaactcgc tatacatggg     58440
     aaccttttga agatccgcac ttatgcatag ccttcctcct ttgcaagtga cagcagggat     58500
     ttttcgctcc acgccaatga gatctgtaat ttccggacag ttgcttgcta gtatgtaatg     58560
     gtttttgttc gacttcctca taactcttct caaacagctc agtggatctc tcacctcttt     58620
     gtgattacaa tgtaatatct ctaaatactt tgaaattcct ctcttgtggt cctttccaat     58680
     ctctttaagc ttcttgtaga cacacttagt tatgaaaagc tttggctggg acttaaacaa     58740
     gtcgtttatg tgtcttaggc ctaagaagta tctgttcagt gctgaaacga agttacactc     58800
     cacaataatt tggtagggga ttctgtatcc aattttcggc agcagcttca ctattttttt     58860
     actgtttctg tttatttttg catccattgc ctgtgggtta aattcctgga aaaaaagacc     58920
     cacaatggtt aaaaacaata acgaagttga actttctgaa gaggacttct atgtccaaag     58980
     atcaagtatg gtgaaagggg agatgagcca aggaaaaaac atgtatcccc acaagtttga     59040
     ggtgactcac agctttgggg agatccttag aaagatagga gaggtaaagg agcagtttgt     59100
     tgcagaagac gtggttcaat ctgcaggaag gataatgagt atcaggctcc actcccgatt     59160
     ctgctttttc ataatttctt cttgtggaga gagtatccaa ctcgttgtag atgccaagaa     59220
     agagggaagt gagcagataa tcaagtttct gaagagggga gacattgttg ggtttatagg     59280
     gaacgttgga agaacaagga ctctagaacc ctctgtgttc gccactgatg tgaaggtcct     59340
     tactccatgc cttaggacca ttccgacgga gcactttgga ttgaaggatc ctgagacgat     59400
     atacaggagg agatacatgg atcttctcat caaccgggag tcgaaggaaa ggtttgaaaa     59460
     gagaacacag atcatcaggt atattaggag cttcttggac tcgcgggggt ttctagaagt     59520
     tgagacgcct atgatgaatc tgattcctgg aggagcagca gcaaagcctt ttataactca     59580
     tcacaatgag cttaacttga atctttacat gagagtatct cccgagctgt acctgaagaa     59640
     gcttgttgtc gggggccttg acagagtgta tgagatagga aagcagttta gaaatgaagg     59700
     aattgatctt acccacaatc ccgagtttac atcctgtgaa ttctacatgg cctatgggga     59760
     ctacaatgat cttatgaaga tgactgaaga gcttatgagc ggaatagttc aggagatgtt     59820
     tggaacagac acgatagttt acaatccaag gaagagagga gaggagatca agccggtgtc     59880
     tctatcattc aagaggccct tccgagtgat tagcataatc gaggagctta acactcgtct     59940
     tgggttagat cttagtggag agactcttga taacgaggag accttggaaa aacttcttgg     60000
     ggtttgtgaa aaagaaggaa tccatgttga gaaacctcgt acacttacaa gagtgcttga     60060
     caagcttatt ggacatgtga ttgagcctca gtgtgttaat ccgaccttta taaaagatta     60120
     tccaatagca atgtctccct tggctaagaa ccatcgatca aagcctggct tgactgaaag     60180
     attcgaactt tttatcaact gtaaggaagt gtgcaatgcc tatacggagc taaacaaccc     60240
     ttttgaacag agggagagat tccttcagca ggcacaggac ataaatgctg gagatgacga     60300
     ggccatgatg aacgacgaag acttttgcac ggctcttgag tatgggcttc cgcccactgc     60360
     cggatggggc ctggggattg acagatttgt gatgtatctg acgaatgcag ctaatatccg     60420
     ggatgttatt ttctttccca ctatgaagcc tgaataaata ttttgccaga tttagggatg     60480
     gaaataatgc gaagagggtt ggcccttaca aaagttctaa acattcttat ggcgttgggt     60540
     ggagctaaaa aaataagact tgattctggg gatggagtct cttgctcgga ctctggagaa     60600
     atcctggatg gaatgctaaa cctaatggag atgtatgggg tggatggata tcttacactt     60660
     acttcggacg aacacctaaa tgagtatata ggagagggag atcaaagggt taggttcctg     60720
     acggggtttt ctggatcgaa cggaatggct gtaacatgtg cctatcctgc tttgtatacg     60780
     gattcgaggt attacattca agcagcaaac gagtcgaaga agtacaagct taagaagatg     60840
     gaagaagacg agagaattga agagtatttg gaagcatgca aatgtaaaca gattggaata     60900
     tgcaagaagt tcatgagatc taagagatac gaggatctaa agaagaggtt ggagtccaaa     60960
     ggaatatctt tgaagcctat tgatgaggat cttgtggata tcttgtggaa agacaagccg     61020
     aaaaggacat ttaataaggt gtatagtatt gaagaagaga ggatttcgaa gtacaaagag     61080
     gagcttatgg aattgtgcca agatcctgag gacaagaata tattagaagg gaaagtcctt     61140
     gatagggatg ttagcgttgt tggaagaaca tataaggaaa agatagaaga gataagatca     61200
     tttcttgagg taggccaaac aatggtcttt acggagcttg acacaatagc ctggatgttt     61260
     aatctcagag gatcggatgt ttcctacaac cctgtttttt actcttacgc ccttttatcc     61320
     aaggattcag caaagctatt taccaatgaa gggaatataa agatggatgg agtggaagtt     61380
     tatccttacg acgacttctc caaacatgca gcagagctcg agggtgatat tattatttcc     61440
     ggggagtgta atgcatatat aaaggatctg ttcaagaacg tgcagtattg cgacaaggtg     61500
     aggcttctcc agtcgcagaa gagagaggta gaaatcgaag gattccgttt gtcttatatg     61560
     tttgatggaa tggcacttgt agagctattt gagtggatag atctaagtct tgataagggg     61620
     atatctgaaa agaatatcaa agagaagctg gaagagatca agaaaaggtt ttctggatat     61680
     gtccagccca gctttgaatc aatagttgga ggagggccaa atggagcaat tgttcaccac     61740
     aaggcaagtg ataggcctgt atctcgagat gaagttatcc ttattgatag cgggtctcaa     61800
     tacatgtttg gaaccacaga caccacacgg accttgcatt ttggaaatcc aaaagacgag     61860
     gaaagaaaga gctacacccg tgttctcaaa ggacaactaa gatcaatgag gatgaaattt     61920
     ccgctctcta tgaatgcatc tgtgctggat tcaatgtcaa gaatagactt gtggagcgag     61980
     atgcttgact acgggcatgc tacagggcac ggagtggggc actttctgtg tgttcacgaa     62040
     catcccccaa ccatctcctt tggaggtgaa cagactctaa aacctgggca ggtgttttcg     62100
     attgagccgg ggttttacaa ggagggagaa tatgggataa gaattgaaaa tcttgtatat     62160
     ctgaaagaaa tcaatcagaa gttctacaag atccaaaact tgacctttgt cccatatcac     62220
     ctcaagcttg tagataccgc catgatgtcc caggaagagg tagatcattt gaacagaatc     62280
     tccgaagaga taagactcat cttgaaaccc ctcatgaaag gaagacctgg atacaggtat     62340
     cttatggaaa atacagaacc tatcagtaaa taaaggcctc tatactgttt tttgattgtt     62400
     ctctaaagat ttatttaaca atattgcact ggcgaacttc tccattcctt ttgtgagaaa     62460
     atacaacaat tagttcagag atagcactaa tcaaacatcg tactcgggag gatcaatcaa     62520
     gtcgtacaac agattgatgt ttcttttgca aagagggcag gtatccttca aatctagcca     62580
     ttcgtctatg cactcttgat ggaaatgatg gccacacggg aggagcttca gcttgattcc     62640
     cggaatgtag ttatcaaagc atattgcaca atggtatgtg tcatcggaaa catcattttg     62700
     gtccttatac ataacctcct ggagctttgg cttcacaaat gttatgagga acagaagcaa     62760
     aacaatggcc aggagagggg caatgaaggc cacaaatcca agtcctacaa acacaaccgt     62820
     cgtatagtac agcaatggat ttgcaacatt acaattttcg cattcttgaa tccagttgaa     62880
     cccgatgagg taccagaaca aaagaagagc ttctatgaag ttggaaaaca gggttatgtc     62940
     tgtgttctcc ctgtactctg gtattctact gattctaaag aatgggaggt ttttcgacat     63000
     gaatatcccg aacttggcta ttgttattac catgtataca agcagaaaaa gttttaaggg     63060
     aacttcacac ttttcgtttc tcgtaagaaa gagtataatg aagctggtaa cgatcttgag     63120
     gacctttaga aacccttcta caatgattaa tgccttcaga aacttcaatg cgttggttct     63180
     ttcctgagct tgggaattta taaaatccgg ctcgccatcc ctcacatcca ttcacatcct     63240
     tttttctatt tttcttttta tttttttcaa aggggctgtc tgtctccatt ggtaaatcct     63300
     aaaaccctct gtataaatgg gagtccagaa tgggaatttt tcgattgcta cggttctgga     63360
     ctagtgggat tgctcaaatc ctctttgaag agagagacac cgtgcctcga gcttgtacat     63420
     gtacttggat ggggatacct tcctcactat ctttatcatg gctggatctg cccgaagacc     63480
     cactcttgag aagatgtatt gaatgacgtc ttcattgctt ttgcagaaga aatagcagtg     63540
     aaccaacgac ttattccccc aggcactaat tttttgaaga tagtccaagc tatactcggg     63600
     tagattcaag aagaaatggt ctacttctct tcctgccatt ttctcgagga attcggctgc     63660
     agggagattg aagatttcaa tcttttttgg atcgagctta ttgatcttaa tggatttcct     63720
     taagcattca atggcgtgag agttcaagtc gtttgagtat actctgcagc ccttcttaag     63780
     tgctgccaac gaaacaggcc ccactccaca gaagggatcg cacaccacat ccccaacctg     63840
     gaacttcttc acaagaatca ttctttcgct ttggagcttg gaacaccaat agacatttct     63900
     atagtctatg caaaagagaa tgtctccttc cctgtgaata gtctccagca caggatctcc     63960
     tcctataacc tccagatcaa aggatcgata ctcattcgat atttgaccaa tctttgttat     64020
     cactgttcta cctgttttat cgtgaacaac ttgtccaatt acattcttat atttcatctg     64080
     ctcctcatct agattcaagt gaattatgga tccgacaatt tcaaaggatg aaggtgtttg     64140
     aacttctttc ggcaatattc tttgaagagc ctcgctgtaa gtaaaatatt catagcacaa     64200
     ctccagttct atatggatta ggacatcttc ctggctcaaa aagtcttcgt tgattaggac     64260
     taggaggtcg tggtcggttt cagttagaat cttgaacgtg tcatacttct ttctagttcg     64320
     gattaccgat ggaatgcgag gaatttttct gatggattcc ttgatttttt ggatgcaatt     64380
     cggaacttct tcttcacttg ttcccagtgc cttcagacaa agtactgatc tcacttcatt     64440
     cctaaaatcc atttatgaag ggcttcttct tttctgccat accaccgaaa acggaaagga     64500
     aatcttatca aatagaaaca tttattgtct ttttcagttt gaactttctt tatcataaag     64560
     atccagggtt atagctgcca gctccattac cttcttcttg tactcctttt cgttttccct     64620
     cagatgctgt gctgcatcca cgtttgctgg gctttcgcag ttaggagatg taagaagcgt     64680
     tattatgctg agtatcacgc tttcaggtgt tcttaccgga agccatctat ctcccagaga     64740
     ttcgtatcca tactcatcct ccccgggatt gtgcaatata gatatgcaaa catttccgtt     64800
     ttcatctata tttggatgcc acatcttcga acagaaacga aaactcggcg gtgaatccgg     64860
     atagtcgagg gggaagagca tccgtccttt gaagatccca ttttcgtatg gcgtcatcct     64920
     aggcccgaag attagaattt cccacgtgta tatgtctcca tcgacaaggc cgacactgta     64980
     atactcgttg gggttttctt ggattctctt gtagtctttt aaaagaagtc ctcttgaaaa     65040
     gcctcccttc tttcccatat tgttttcttg ggtttgaaat cttaatggtt tatatatagt     65100
     ttcgaatagg tagcagaaag ccatttggct cgaagaacag atgaaacctg tcggccatgc     65160
     cagacagatg taaacatcca gatcaaccat ctgcattgtt caagaggctt tgacaaatat     65220
     tttccaaaat tttcaccctg aatggaggaa gtaaagaagc tgaaggtctt tccaagacag     65280
     acaggcgtgt atctcaagcc atacgcagca gatggggagc agccagagag gagagtcagg     65340
     gcagaggtct gtgggttcaa ggctccggaa actgcttaca cacggcagta catcgataag     65400
     aagtgtccgt ttacaggtga tatcaatgtc cgaggaagga ctttcaaggg aattgttaag     65460
     aagatgaagg ctgagaaaac cattgttgtt gttgtcaact atgttcatta cagcaagaag     65520
     tataagagat attcaagaag acacaccaac ttctctgttc acatgtctcc ttgctttgaa     65580
     ggaatgatta atgtgggaga cactgttatc tgtggagaaa ccaggcctct ttccaagaca     65640
     aagtcgtcgg tggtcttggg atataccaag aaagctacgc ctggttcgtt caagcttctt     65700
     gaaagcatct aataaagcta cgttatcctt taaaagtatc tgcaccatag aattcaagaa     65760
     caacacgtcc ttataaatcc ttgtgtccaa gggcttcccg atgaagctat tgaacgattg     65820
     ggagaaagaa gagataatcc ataaaagcaa aatagtaaat ttcgacttcc tagaaaaaaa     65880
     agacttcatc agcgaggtta aagacggatt ctattatctc tccaaggata tcaaggcggt     65940
     tgagaccgaa ctatggaaga aggccaacga tgagttagca gaccacttag atataaagga     66000
     catagataaa gagatcaaaa gattcatatt tcttctgaac agatataatg aaatcaaaga     66060
     cataggacag gaactcattg gtagaatagc cagcctaaga cagaccactg ctcgagatat     66120
     tcatgaggaa ctagggatgg agactgaact gtagattctc agaaggcatg gaaactagta     66180
     aatacagtct gtgttttggc tgccttctat taaaactatt tcttctggca tcataatctt     66240
     ttctttcata acatctattg gatggtaagc taggctgtct tttcctccat cctttatgca     66300
     taaggatctt cctatgtggc attttgtttc aatactatat ccaagaatac tacatggact     66360
     atatggcttg ttgcactctc ccttgaacac aacgtcgttg cacattccaa tgtgcacaat     66420
     attgtcgtag gctcttccta tggtatagag tccaaggata tttgccatgt atgcatcccc     66480
     gggagaagag aaggccatta cagggagacc atatcgaatt cctgccaggg atgcaattgt     66540
     tcctccaagc gagtgtccag tgagaaccaa tctgctttcc ggatatgctt ctttcacaga     66600
     gtcaattatc ttcaaggcgt catcaaaata gcctattcta ccaaactcca ttctcttttc     66660
     ttcttcgcat cttctgcttt tgcatataga gtacaagatc ttgtccaaaa acttgtcttt     66720
     cttggatgtt tttcctattc ccatccccat cacagaaagt gttgttcctt tgaacgcaat     66780
     aactatcttc tcatcatgtc taaagacctt tgctcttaac ccgtctccat cgtatccaaa     66840
     cctggcttgc accgtgtcta gatcatggct actgtatgca tttgaagcca tccaaatgaa     66900
     ttctaagaga taaatcctct ccaggaagtt tagggtgtgt tcttgaaata aggctgtatt     66960
     taccttggga ctgttttccg ctccatctcc ggaaggatgg gaagtattcc aaatcctata     67020
     gtccatgtca tataaagagg tttgtagaag atacaaaagc attataaaga agcttacctc     67080
     caaacagtct tttgtttata gctgtttcat ctctaacctc ccttgaagat tatggaaagc     67140
     gtttcgccat ggatcatcct tttagacatt attgatcttg cagtaggagc catccagcta     67200
     ggaacacaaa aaaggatgga tggagtcttg gaaagattca tagtcatagt aatgctcaaa     67260
     tgtatggagc gagagatgca gagcagatct cctctcatag gagcaagaca tttgattgct     67320
     tgcgactcct ccaaaccact ccttacaaga ggattggaat gtctaggaat tgttgatttg     67380
     cctagataca tttcagagac cttaggcgag ataaagagag agcctggtgc ttttgcagag     67440
     atcatgagta tttctctggc ttgctttgta gtccaagcct ttctgttcag atcatcttcc     67500
     accaacctga agagaaaaac cttccatgtc tttgcgtttc ttgtgttcta caaaggacat     67560
     cgcctctcat ttctacttag cgaaggcttc tttctgattt tgggtctgtt gtcgccgtgt     67620
     agacatgtca attctctcct tacaccttac ctcagcagac acgataggga acacagtgta     67680
     ttatcgcatg tctatctttt gctggcttgc acatacccaa ggatgttcat gagacataaa     67740
     gaatatgttt cggcactgat ttctatatgc tttcaagact caatggcctc agttgttgga     67800
     gaatggtttg ggaagacaga gaaatccata cagggtgcaa taggaggagt agtatccgga     67860
     atagcaattt attttgctct ttacagaaaa gtcgacatgg tactgttctt catagttgca     67920
     ggcatagtgg aatatcttat tcccatcaat gacaacattg ccattccgct ttctgcaatt     67980
     tcatactcct ggttatcgaa gaagattatg agcagcatcc cttcttgggc tgtggtttga     68040
     cctctttcag gttttcctta ctgaactcaa cgcttttaag tttcctcttt cctattgagg     68100
     ctttctgggt ctttaccttc ttgtgaatcg tcttaacaag ttcaagaaat gcttctcgga     68160
     cattttctcc agtcagtgcc gaagtctcaa aaaacgacaa ctcgtttgta actgcttcat     68220
     cctttccctt ctgtgtgtcc acatctctgt cgtcctctag atcctttttg tttccaatga     68280
     gcacaattgg aatctcgctc ggtgagaagt ctcgaagctg cttcaaccac agactagtgg     68340
     ccttctttag actgtctttg tttgtaatgt cgtagacgat ggcagcacca gatgttcccc     68400
     tataatatgc ctgaacaatg gcctggtatc tctcttgccc agctgtgtcc catatctggg     68460
     ccttgacaat gtcctcgcct atcttgaagg tgattgtacc aaactcgacg ccgattgttg     68520
     cctttgaatc cttatggaac tcgtttcttg tcaacttcga aagaaggttt gtctttccga     68580
     cagccgaatc tcctatcaag actatcttga agagatagtc gaagttttca ctctttgtga     68640
     tgccaggcat tccaaataaa catataggac ttataagagc agaatatcta aaaccatatc     68700
     caaaacactc catcatctat cattcctaag gataaatggg gagtttgttt ggatccccga     68760
     tgctcaagaa gatccttctg agggcactaa acaagtttct tgggaactat gtagagaaca     68820
     tagacaaaca tcagtttgag cttggaatat tcaagggata tgtgtctgta tccaacctga     68880
     gaatcaaatc ttctgtcatt tcgaggctgt ttgagggaag ggttgtgtcg aactcgatag     68940
     ggacactgcg agttcttgtg ccttggaaga gcttttctag aaaacctatt gaaatatatg     69000
     taaaggatgt tgacatcaag cttgggaagg ctgggttctg ctggtgcttt cttgatgaga     69060
     agctgtgtac agagtgtgtt gagtacgaga aatatgagtt tatgaccaag cttgacaagc     69120
     ttagtgttct gtctgatgct cgagaggaca actctacgct ttttaaggat ctgattgctg     69180
     gagatggatt cagggtcttg attgagaatg taaatgtaga atatgtaagt ggagcatcaa     69240
     ttgctcttcg ggtgcagaaa gtggagttca ataagaaaac caaaggagaa gtgaagaaca     69300
     tgaagatctt cgatgctgtg gggatagaag tggttggggc atcgaaggtt ctaggcccat     69360
     tcgacatcta cagcaagata aagatgttac ctaaagatat aaacccaaga attgaagtat     69420
     ctcttaatga ctttcacgtg gaggtgaagc agcagattgc tgaggagatt cttagggggg     69480
     ccagagaata tgccgaggac agggtacgat ggacattgtt cagaagctat ctagaataca     69540
     gagagatact aaggacggct agagagatga acctatggaa ggaccaggaa gatccggcaa     69600
     gctcggacag aagtgttgca atggagatat ggaagagatt gataagactg cagaaaaaag     69660
     ctatggagtc caaaggcgtt gttctggagg agatacctgg gataatatca aagataaagg     69720
     aatacaggga aatcttaggc cgttcgggcc tatccttcaa ggaagtagaa agaaagaaga     69780
     gatgtgaaag ggagatttgc ttggaacggt tattgaaagt aaagagaagt ttgagcgagg     69840
     tctcggaaaa gaagtcgtgg aagaacatcc tgtcgtttat gaaagaagaa gcgaacaata     69900
     aaagaacatc aatgatcatt ccagcaacat ttagtgtagg ggaagctacg gttgtgatta     69960
     ttgacgaaaa gcaccaagga ttcaaaatag tcgttcccaa gacaagagta ggagttaaag     70020
     atctactttc tccgtccagg ctggatttta agggagacaa atggaggctg tattttattg     70080
     atgctagact caacgaacgt gatcctcata gcgagttgat ttctcttcta ttagatgtaa     70140
     gaggcacgct tatccaggat ggggccgggc tgtatgtaaa gggaatagct aaggaatgga     70200
     aggtgcttgg gtatagaaga gagcttcctc actgcttcga aggctttatg aggttagtga     70260
     aaaggtctta tgttccttcc tatggattgg cggctcctag agggaaaacc cgagcagatt     70320
     ttaaggtaga tatagtttct atggagtctg atctggagag atttgttaag atcgagccgt     70380
     ctagtaggta tgggatcgaa tgtgcaggga tggttctttc atatgtaaac gatgagatca     70440
     atacaaagag ggctgcatca ctaacgatat cgtcttcctt tgtttaccgg gttaattctg     70500
     tgtccaaaga aagagaggct ctttcaaaca agattgagac aacggttctg cttgttgaca     70560
     atgtgtttta tgtgaagacg tcgatggtgg atctctatgc acatggagta tatcctaatg     70620
     actttagagg aaacggagta gtgtttcctg ttggttttgt tgtcccaaac ttcgaggtat     70680
     gttctgatgc aataaggatc aatgggcctg acggaagagc agaactccaa cggatcaaga     70740
     tgtcgggaaa tggaggaagt atatttgata tggagatttt taaaggaaaa gtattggact     70800
     ccaatggaaa gacaatgtgc cggattccca ggatgaagat cgaggccaga attggaaggg     70860
     ctcttctttt ggatgttgtg tatctaaaga tatgcgggag agctagaagg attgcaagat     70920
     tggcacgggg aatgacgtgg atggcaaatg gagaagtgtc tacgaaagtt attgcaagaa     70980
     ttaaaagaat agaaggggac ataaggtgca aaggatctat cttaagaatt attgtagatg     71040
     agtatttcca aggccttgcg aaaagtgtcc gagctgtttt gaatgagagt attataaata     71100
     tcgagaactt tgaagccgga gaagaatttg gatggaagtc tgcagtgcta acaataagaa     71160
     aggaggatct caagaacttg gatggatttg gaaggatatt caagaaaata ggaagtaggt     71220
     cgagtgcctt caaagcctct gctggaggtc tggtgattaa gctgcttaat ggaggggaga     71280
     tagaaataga gagtcttcgg attttccgag acgagggagg tatgattatc tatccttttg     71340
     aagttaaggt cttcaacaca ggtgattcct caacctcagc agacagtagg aaaagagaag     71400
     tggagatgtg tattagcaaa attgagatat cagatactaa agcaactatt gagggaagta     71460
     tcaaaggaga gataaatgag gaaaccctta tcaaaataaa ggatgggata aaagagattc     71520
     caatcccatc ggggggatcc ttagagacgg ttgtcttact tgatatatct cttagtatgg     71580
     tgatatctgg aaatccactg aaaatagcat gtcctttgac tctttggcaa aaagcggatg     71640
     aatacgaaat cactttgcaa cagatagaga ttgcatcggg agacggacaa aacacaaatc     71700
     tatttgaagt ccacgccaag ggagcagatg gggtattaag actatcggta agcaagatgg     71760
     aaatccacat tgaacctttc aggcttgctt caatacttta tcctcttgtt cacgggactg     71820
     gggacacgga ctttgtgaaa aaggtagaag tggatataga agagatattt gcgaagacca     71880
     aaagcataga tggcataaga atgaggaatg tcagatatag agatgaacta cttctacagt     71940
     tttctgtttt agatgagccc gggagtaagg tagcatacaa aagagtgaat ggatcggaga     72000
     gctatcttct ttctgtgatc ggaggaagtt acgagttgag ttctttggct gctcttgttt     72060
     ccttctgttc atctgaatat atgcagatat actcgaagtt tggaattcag gtttccaggg     72120
     ctcggctcca tgtgttgtgt atggacctta aggtgttact aggcgatgct ctgtttgccc     72180
     ttcggatcaa tcttcctatt gtatatttcg atatggaaga tctaaactcc tttaaaggaa     72240
     gggctctttg ctcactagac gtctatgatt caaattctat ggaatttatt ccctttattg     72300
     aagaaaatgt gcttctagca aggaaatacg gaaccttctt ggatgtaaga acgcttacaa     72360
     aattaaggat tctgtatttg gacgaaatca caagcacaat ctggagtctc tttgcatcgg     72420
     aagaaacagg aataacgatg tttgggaagc ctttccgtaa caaagttagc ataagaaaca     72480
     tcacggacac agtgctatgg gtcaagacta aaagatatgc tgggagagtc gggaaaggac     72540
     aattccacga gtttgatgta gactatgacg agcatagaat tcaaattgga aaggatgaag     72600
     catgtgcctt ggtttatatt gtcaacagct gttctacctc ctttgtttct gaagggaaga     72660
     gttttgttat agaagtgaca tacgatggaa aactaagggg cataacaatt acacatgtct     72720
     tgtcgttcct taatctctgt gatattgagt tgatggggaa gatggactac cttgatgggt     72780
     ctgctttgga gctgcatatg ctccctgagt tccaccatac aattccacaa gagaaagact     72840
     tctttctgga gataggcatg catggaaagt atgtttctgc cggaaagata aatgtcagtt     72900
     cggctccgaa ggatgcaacc tccacctttg gaatgatatg caagctgggc ttagtagaaa     72960
     tagggatcga cacggttgtt agaaatgcag ggtctgtttc ttgtgttgtg ataattctct     73020
     atccaatttt tgaagtgatg aatagaacag catccgtatt gaacttaatc ctctctgttg     73080
     gaaaagacaa tactcctggt ggggaaagtg aaactcaaaa aaagaacatt ccgctttcgg     73140
     tcgatagaga ttgtaaagaa gacatatatg ggattagctt ttctgagctt cctcttctct     73200
     atgtgcagag tcttggaagt cgagctactg ccagggcgtt tgaaaataag gcatccatcg     73260
     aaatcaactc ccattactct ggagaaataa gaaaggagca ggctgagata atatcttttt     73320
     tcggaaggca tactcttgca catcggatca gaatggtaat atattcccct atggtgatta     73380
     taaaccacct tggaaatgat atctggataa atggagcccg gtttgggcca ggaccttcat     73440
     gctccaaccg gctgaaggat atacacagct tggctgttgg ggaatatagt attgaggaat     73500
     ccgtggaggt cggaaagaag tttaccaaag cctttattct gaagaaaagg ggttttaaag     73560
     gccacaagac ctggaaatct catgaaggcc aggaatggtc caatgaagcc atatttggag     73620
     gatttgggcc taaaacggga atacaaccaa gttgcatccg tcttctacta gagtttgggg     73680
     aggatcaagg tagaagaata attgagtgca agtacaccta cctgattaga aatcaatccc     73740
     aaatgagact tctggctgta tcggagcatg tatgttacta tgtggaaccc catgaagagg     73800
     tacctctcaa tacatccaca aatggattct atctgttcat tgcagattca gtgaatatta     73860
     gatccccaag gctttctgga gtgtttattc cattggacat taagataagg aaatacttta     73920
     agcttcaagg ttccgatgcc attttgttca gcgtgagcaa agtcacggac tctggacagc     73980
     atgtatttgg gataagaact gaaaaatatt ggccttatac gatacacaat gggatagatg     74040
     ttggtctgag attcagccag aaatatgata ctattgagca ttatgtggaa aagggatctg     74100
     tttatagata tgcgccagac agtctgatgc ttgatccaga gatactattg tgcattgaag     74160
     atcaaataat tcaggtaaac cttaacgagg atcaggtctt acttgttcat ggaattacag     74220
     tgtccatatc ccagggaagt actacaaggg ttgttcgggt ttccagaggg gagatctcta     74280
     gtagtgagtg taggatttgt ttaggaatag taattgacag cttatctata tcgttggtga     74340
     ataaggaagg gaatgaggtt ttatgcagcc atatagaagg cctggagatt ggagcagaat     74400
     gtatttcaag agaagctgga attccagagt tgatggctca tccaaaatat gtggaatttg     74460
     taattcaagg aacagctgaa agcattcagg tggataatca gagcttattc tgtgcatttc     74520
     cagtggtttt ccatcctctt gacaagtatt tgaggataga aaccgaaaga agaaatagaa     74580
     agaaacttct tgtatttgat tttacatttg ggagttcggc acagaatgtc tccgtatcaa     74640
     atctgtactt caaaacagag gcctttgcac tgaacattga agaaaacctg gccaagagca     74700
     ttagggagat gtttcttagg aaaaaagaga gagaggtaaa aagctacgaa aaaaacctaa     74760
     gaatccagaa tctaaagatg gagagaatgg gtgcaaaggt gaatttcctc aaggatatag     74820
     aatctggttt tgtttccaat gttgtgggat tatttatcaa caacataagt gacttctctt     74880
     tggaaataga tgggatgaag gaaacatgct tgtatacgac tttccaagag cttgaagatc     74940
     ttctggcttc tttctactta tctcagcttc agaaaaatct ctacaaggtt cttacgcact     75000
     tggactttat gggaaacata ggaagtttca ccgagtctgt atccatagga attaaggatc     75060
     ttcttaccga gccttccttg aactccaatg tagcttgtgg aatcttcaag ggaggaaaga     75120
     gtttcttgaa gaacaccatt tatggtgttt ctaacacagt tggaaaattc tctaaaagca     75180
     taggaacaag tgctaagttc attggatgca gtgcggatcc taaacacgaa aaattccgcc     75240
     attcctatgc acgtgatatg catcttctta taccccgggc tagacattca aaaggtccaa     75300
     tgacatctat actcaaagga acaggaaatc tttttgactc gataacgcgt ggaatggtgg     75360
     ggatagcaac ttctcctgtg gaaggagcct caaatggtgt tgctggtgtt gtgaagggat     75420
     tgggaaaagg agtccttggt gcctttgccg gaccgatcgc agaagttgcc gaccttgtaa     75480
     ctaatatttc tgacaccata aagacgtcca tgaatggaag agtcaaaagg atccaatatc     75540
     caaggcccgc aggattcctt ggatggtacg atgagggatt gagccaaggc ttctatatat     75600
     ttatgtctat ggccgggaaa gttcatgaag aagaaaggtt tgtggatggg acatttgggg     75660
     attttaacgg aagatgccag ctggttttga caacaagaag actactaata tcagatacta     75720
     ccactattct tgacgtgtgc ttaggaagta tagttgttga aggagacgat cgaaagttaa     75780
     aaatcggaga gttcatcatg tccatcgaaa ggccctcatt tgttgcttcc gtgaagtcaa     75840
     taattgaaag atgttgacag acatcagata tgcagtgtaa aaaaccaaag atctaataaa     75900
     attttatcat taataaatgc atatggctct gccatgatgt cttctacaag aaatagtcag     75960
     ggattctggt ggagacaagg gtttcgatct ttgtaggtga gggctcaaac tgagtaaagc     76020
     tgtatgttcc atattcatcc atttccatga gcgtggctaa attcccacac ctatagcagt     76080
     aatttggggc actaaatatg gtgacgcatc ccttttcatg gctccaattg aatccattca     76140
     tcacaagctg atgtgccctg catatcatct tcaatccatt tctctcatta aatgcatctg     76200
     ttatatcctt tccaaatgta aatcctgcac ctcgaggaga aggcccccat ccaagttttt     76260
     catctgggtc ggaccagagg agatcacaca tagggccttc gtgtggaatc tcaaccttcc     76320
     tatcgatagc cttcaactgg tccagtgtgt caaacgatgg actcaatccc ccatggcagc     76380
     agaacgtgtc gttcccaaca acagctgcaa caggcaggaa atcaaagagg tctgtaaagt     76440
     atctccacac aagagatgtt ccatactttc tgacacattc atcatagaac ccatacactt     76500
     gagttatttg cctactttca tggtttcccc taagtagcca taccctatca ggatatttca     76560
     cctttaaaca tagcaaaatg gagattgttt caaccgaatg gtatcctcta tctacatagt     76620
     ctcccataaa taagtaattt gtatatggcg gaaggcctcc aaccttgaac aattccataa     76680
     gatcgtagaa ctgcccgtgg acatctccgc atattgttac cggtgccttg acactaacaa     76740
     cattttcttc cttcatcaac atttcagttg ccttttcaca caggtccttt acctctgcct     76800
     ccgttagtaa attacatttg aatagcttct caagatagct ctcgatcatt tctttcccct     76860
     tcagggtcta aatatttttt ctgtttcatc ttcgcacttc ggcctccgat gcctgctaag     76920
     gttcaaacag caactttctc cacatccaca gaaacccgga ggtagcatct gaaccataag     76980
     ccatatcaaa ggtaattcaa aaatgcaatc cttttgctat gattggcttc attaatttaa     77040
     attctgtaaa tgacttttta atattcaacc tttgctaaac acaccctcag gaacctgcat     77100
     cgtatgacaa atagctcagc cttcacttca agcgacaacg aacaatactc tacagcagta     77160
     gataaaatgc atatcaagcc tttttatgaa atactctggt cttccagtga caacatcgag     77220
     cttgaggact tgggaaacga cccttttgtg gataatagtg tctttgattc gattggaatc     77280
     tcccacctaa gaccatcagg gaaggaagga aagtgcaagg agaaaggcat gtggacgtct     77340
     ctgcatgggg tccggaatca aaacagagcc tcccctgcac ccgttgcggg aaggcatctc     77400
     atagattttt ggaaagactt cagcaatggt gaggtttttt ctcttcccac tcttggacct     77460
     ggaaaaagtg acagcatcca gaggatttcc gttgatgttg ctaaacaggt tgtcgaaggg     77520
     atgtataaca tagattactt ggtgatcgat tgcagattcc catacgagta tcaaggagga     77580
     cacataagaa acgcggtaaa cataagctcc gccagggagt tggggatcct ctttcggaag     77640
     cctaaggttt taatcttcca ctgcgaattc tcatccataa gagccccgaa acttgctcag     77700
     tatcttcgga acatggacag gatgaagaac ccatatcctc tcctgaccat tcctgaggtg     77760
     tatgtcatgg aagggggata caggaagttt tacagcaagt atccaagcct atgtgatcca     77820
     aaaggataca taacaatggg cagtcttggc tatagagatc tgtataaaaa aaacaaattt     77880
     agatcaaata aacgatacta attgctcatc tttgtataaa acttccgcaa tccattgtcc     77940
     ttaagaaata acacaagcag agtttattac tgtttcaacc ttctcgaacc aattctcctc     78000
     tagaattcta aacgtgttct cagaaaacag ataaaagaaa catatctcca aggctaaatg     78060
     aaaaactgga tcctattagc tttgagagca tgtagagcaa tatctccaga gccagggaca     78120
     gcagtaaaca acgtgctcga gaactggagc ctggatttcg atgagtatgt agagaaaaat     78180
     atacaagctg gaagaaataa ggaaggaatt gttaggtact ccagcaaatg ctctggaaac     78240
     gactgcaact ccgagaagac aggatgtgct gataaccttt gcaaaagtaa gccagggaag     78300
     ttttcgtata gatatgatct tttaacttag ttttctctca ataataactc cttattctaa     78360
     agtcccattt gctgaatttc actaaccgcc accccaaact tctatagaga attttagtaa     78420
     taccctccaa tggagatccc ggtggaaata gccagtaact tctggaagat agccttcttt     78480
     cttctggttc tttacgtagt tctagagaag agacccagga ttagaaccaa aaagcctgtc     78540
     gagaaaggag aatatggaat gaacattata atcaacaagg attataatat gaccaagggt     78600
     aaagttattt cccagatctg tcatgggatg gcctctgtga tggagcatct gtttagaaac     78660
     aaagaactat ttcttgaatg gaagagaaac caagagccta agatagttct gaaggcctct     78720
     ggaggggaga ttgaggagat tataagactg gccaaaaaga acggtgttta ctaccacaaa     78780
     atacacgatg ccggtaggac acaggtccct tctggtgcaa acacggtact tatgcttggc     78840
     ccagcactga gatataagct tttgtccatt tctggccatt tgaaactgta ttagaccgcc     78900
     tacccattcc aaccgtccaa atccatggaa ctgtcttgat atataataag caagctgtgt     78960
     tcgttggttg gatcaaggcg gtaatgctat ttgggctacc cctttaatcc tccaaatgct     79020
     aattaaaaag actaaaaata taatccggat cactttcttc tttattattc cctcccaaga     79080
     gaagttatga attctaaaat gtttttggta gtcattatct tttggatctt ccaagtagta     79140
     gaggtgggcg tgatcgatgc tcttgaacat gcttttgtta atgccaaggt gtaccaagtt     79200
     cacaattttc cagacattct gggaatggat tacaacaagg atatccgata cataaacttt     79260
     tacgcattct tgagtggtgt tatatgtaca tggattttgg tgtttccgtt gacaatcaag     79320
     ctagtcatcc ttgctgtctt cggcacagag gatgattctg agaaggttgg agattatttt     79380
     ctatggttcc atttggcttt actacttctc ctgacgtttg ctgatatttt gattctttgg     79440
     acctgtgatc gagatacact tcgggctcag gcaactgatg cctatggcct ttattatatc     79500
     tatagaaacc ataaactttt ttacttatca catttggttg cagagattgt ttctttggtg     79560
     ggagttgtat tctatggatg tttgttcaaa gatatctact tggccggata gataaacaga     79620
     atggttttta agtacatggc cgtggtttca tgtttcttac ttttccagaa ttaccataaa     79680
     acttctttcg atcttctcgg ttatgctcct gtcgggagct gaaactcctt tcttcctact     79740
     ggaaggaact acaaagtaca aatccctaat cttctcattg ataaacttgg gtgtgacagt     79800
     cactcttctt ggagatatag gaaaatctcc ttctaaagcc actacataat catcagactc     79860
     cagctccttg catccagggg gaagagagca aatgtgccca tctccgccta tcccgagaag     79920
     acatacatcg atgtccggga gctctgcaga atacatcttg gctgcctcat ccaaaggtct     79980
     tgaagtccat attcgatgca cgtctgcgtt ggtcttgctt ataaatccta ttgatccagt     80040
     gtagttcaaa tggttttggt ctgctctctc atcagaatag aatattctcc accccgaggt     80100
     gtccatagtc aggtatcttt tgtcctcaag gcattgaagt agagaccctc cagagatcat     80160
     cagtgctaag cttcttccag agtattcttt taagattcga tatatctctg tgctgaagtc     80220
     ttctgtaaac aaaacatcca ttaggggttt aagactaatc ggacaaagat ctagaaacag     80280
     gattaatggc tgtttagaaa aaacccatat tttattcttc cttaccttcc tcaacattaa     80340
     tatacttgag ttcaaatcca tctggccctt gtgcaaaaat cttgatgaaa gccctaagct     80400
     tcttcatatg tagaaacctt gctatctgcc actttattcc ccgctttggt ataaatcctc     80460
     ctgtgacatt cacttcaaca atgttcccgc tcacctcgat ctggagaagc ttttccttct     80520
     ttcccatgtg gcatttgatc ttctgttgaa gaaatgcccc caggtccgaa ggagagacga     80580
     gactgtcgga tgccggcttt gtacagtcaa cagtaaactt ccttgtggtc ttctccgatg     80640
     ccgttgccat ttgtcttatt ggggtgaaaa attttggctc cagaagaaca caaaactgag     80700
     ctttggattt tagaggccta gctcaatgga gtctccacca aaatagcctt gcaaaacatc     80760
     ggggatgcta atccctctct cattttgata gttttccaca atgcagcata gtgtccgttg     80820
     aattgcacac atggttccat tcagtaaatg gacgtaaacc ttgcggttgt tctccttggc     80880
     aattccatac ctgatctcaa gctctctcga ctggtaatcc gtgcagtttg agcaagaaac     80940
     caactctctg tatttctctg cattcgggaa atacgcctca agatcgtact tcatgactgc     81000
     tgcatcattc aactccccag atacaatgct tacaacatta taacttatgt ctaatgactg     81060
     gtagaactct tcacatattt ttatcatctc ttcatgatgt ctttcagact cctcagggct     81120
     gcatattaca aactgttcaa tcttctcaaa ctgatggacc cggaatagcc ctgcattatc     81180
     ttttccatgg gctccagctt cctttctgaa gcagagagac tgcccacaga actttttggg     81240
     agtctcctga ggaacaattc tttcgtccat gtacagtgct gcgagagact gctcagacgt     81300
     tgcaacaaga tacaggtcgt cctcaacctt gtagagctga tcgtcaaaat cacttagctg     81360
     tgatgtcttt cccatcacgt ctcttttgag catcaccggt gtttggatat agacatagcc     81420
     cttgttctca agaaagtcaa tagcatatct cgaaagagcc tgtgctagcc tggccatctt     81480
     tccagataga tagtatcctc gatgccctac cacctttgcc cctgcttccg gatgagtgaa     81540
     gtctttcatt agcacacaaa aaggctttgg atctttcttt atgcttcttc cacttctata     81600
     ggaccttata atctcattgt ccttttcgtc attactgacc acaactttgg gagaaataat     81660
     gtttcctatc cctttcatca ccttactaag ctcatcttcg ataaccttta catcttcttt     81720
     gagtcttttt gcttccccct gaatgtcttt catctcttta actttttctc caagatctgc     81780
     atcctcttta ttctttccct gcttgtatcc cgactttatc tctctgtcca gttggttaac     81840
     tcgagtattg atttggtcga gccggaagtt ggtttctatc tttcttctgt ccaattcata     81900
     ggccctttca acacctgttc catctcgaaa ccgcttcttc tcgctctcaa ccaccttttc     81960
     acggctcttt tcatctctaa ttagaccgat gtcgatcatt cctggggatc catccaaaca     82020
     ttttatcgaa gaaagtaaat caaaacatct ttttaattct cttcccactc ttcctctcga     82080
     tcccggtctt tccagaactt cgaaaaatgc ccaactctgc aagatccatc atagaatccc     82140
     tgaggagccc ctattctcca tgtgtatttc aagctgtcat cgtagaatgg tcttgcaaag     82200
     ttgtagttcc acatctcggg aataagaaaa acccccatgt ctccagtcag cacaaattcc     82260
     atctctttcc aaccacattc ctcttttttc atcaccttta tcctatcatc gatgagtatg     82320
     gctagtccgt caattatttt gtacctttca tgcaggagat ctacagtttg gaggttgttt     82380
     ccattcatta ccactccaac aatattggac tcaggagtaa ataacgagga gtgaatcaca     82440
     gataatgacg aaaattgagg aacaagccca aaggagatcg gatctccccc aaccaccaat     82500
     ccaaagacta agacgtgggg atccattatc tccatgaact tcctgacgag gttcaaagga     82560
     atcttcagga tttttctttc atcaacttgg tctaagaatt ctgttttaca gtttcctttc     82620
     tccagcatct ccaaaatcca tctttcaaga tccccacttt tgctcattct gtccagtttc     82680
     acatatctgc ttctccatcc atcactacct ccaaaagaca catgtcctgg cctgttgaac     82740
     accattttac tattctttat ctctgtgtct ataacctttc cctcttcctc tcgtcccaaa     82800
     cccgctttaa acccaaacac tatgtctctt atctcattct gagacaaact agaaggctct     82860
     attccataaa tagtacagta actttcaact atgagatcct tcagctcaat ctcctttttt     82920
     atccattcag agtcacttat ctcaggccat atctcattaa ttccaagatc cttgactctt     82980
     gtttcatcaa catccattcc gtgcaccaca aggagaagcc tgcagaaatt cgtaaacctg     83040
     cttgtttcac gccacttctc atatagatta atgcttcgaa cacatttttc tttttcgaac     83100
     cctttgagtt tcaccaaatt agaaaatggt ggtattgata gacatgtttt caccgatata     83160
     gatgggtggt ctatactaaa gttctccatt gcatccacca tgtcttcaga gacaacaaca     83220
     cttctcttct taagctcctc acccatcaaa aatatatctt gggctgcaag aaaccttatc     83280
     tgccggatct ttttgctctc tccagagtaa cttttgaaat acagatttcc acttccagga     83340
     tcaaagataa acagcatctt ttccttctta agcaatgcct tgacgtcaac cagaagcccg     83400
     gagttaaaca tctccccact gttattaacc acctcaacat cggaagtgta cagctgaagt     83460
     gccttcctaa gcctctcccg aagcacatga agcatcgaat tctccatcaa gatcttctcc     83520
     atcgagtctc ttatcacagt atttagctct ccattcagat ttccatatgc actccatgta     83580
     ttgtaacaaa gatcgagaac tatgataaat ccattctgga ccggatatcg agtctgagga     83640
     tctctaacac actcagcaaa ccttaccctt gcatatttac gggaattcct tttgtcatag     83700
     tctccccatc tcagctgaac atcaatccac aatccatcac atctctctcc atctccctcc     83760
     gtctcttcag aaatacacat aggagactga acatagaaat cccccgacag aaggatgtct     83820
     gcacagctgc ttccaaacct gtaacttttc ttcccgtgta cttccagcct cttagtatca     83880
     cagtacttct taaacatatc acacaagtcc ttaacaacac tctcatggat tctcttccac     83940
     agatggtttc ggaatatctg aacaaacgaa atcttcaacg tcggtagctt tccgtgcata     84000
     aacactcccg tttggtccaa ttgaacctga tatccaacat atacatttcc cctgttgata     84060
     gttggtgacc accacaagat gaatcttctg ttgggaactt ggctcaaccc catcttctgg     84120
     gcgtttgtca gacgtctata ccctccagca acactgtcct cccaaaacac cttgctgaag     84180
     cttctgaaat acgtcgcccc aaacagcgtg tggtctgcaa tcccttcaag ccctccaagg     84240
     acttttaaaa catctgctgt gaatccctcc atactccata gcttcccatc atgccttgca     84300
     tctgtaaacc aaaaccattc gggattgctt gaatatttct taaacatgct aataatccta     84360
     aatcccctgt catacagtag ccatctactt ctttgaagaa gagtactcat tcgtggaatc     84420
     cccttttcag gttctatctt tccactcctc ccatactccg tccacactct gcttgactca     84480
     gaaaactcat cgtcccatcg ggatgtatag tccagaatcc ctggaatggt cttatgcttc     84540
     tcttcctcca tgtccgaaac atcttcctga aaaagccgga ctcctccagc acttagcatc     84600
     cctagtcctc ccatctcctt aggtgcatag aacataacag gtggaaacct caccggcatc     84660
     ttcgagttta ttcctttctt cacaacattc tgtatcatac attcagcttt tctaagcctc     84720
     tcctccagcc cctgagtgtc acagatgcac tctctgtagt acattgtaaa cgaaagaatc     84780
     tgtgtattcc atcttgttgc caccttgaga aatgtggcag atccactcgt gttcacaata     84840
     tgcattatat tactttcaaa catttctaca ctcttgtcac tcacagccaa gtttgcatac     84900
     atcccattct caagcttcca tgagcttctt tcatggatct tctttgaaga aatcatcaca     84960
     tcaattcccc ccatcgagaa cttaacacct gggaatatac tacatcctcg gaatctgatt     85020
     ctccctaaag aaggtaatag tctcgtcgca acctcggcat gaacacactt ctctaaaagt     85080
     ttcagtctct ccctgccatt gctactatca aattcctcag tctcttcatc ataaagattc     85140
     ccacaaatcc catcgaagta gtttcctctt cgatctttca tcacatcttc aaaccattca     85200
     gttccctttc catagtcaga gagtaaggcg ctttcttcct ctttctttag tttaaaaagg     85260
     atgtagacat cgtccatatg cctaaagtac agctttatgc tacttttctc gtccatgaaa     85320
     acatcttctc ctaaaacaca caggtcgatg ataaacgaat aaaacttata tacaaacgca     85380
     gaaagctgaa atcctttgat aaacccaaca tggttggtgt acctcatatc cttgtagaaa     85440
     actaagcagt tgtttctgct tatgatgtaa tccgccaaag tagggtccaa aacaagcttc     85500
     agcagcttcg aaaggaggtt gttatctatc atcttcataa tccccgagta ttttccctcg     85560
     taaagtacaa ctctttcccc atctactcca ctgaatgatg aaattttctc gcataagtcc     85620
     atcagggcct ttaagtccat ctcgtctcca ggcttgataa actcagggaa gatgttgagc     85680
     ctctcggatt cgtagaacag gtatgcacaa agaaatgcat ccacaagcct ctccatgtac     85740
     gatacatggt agtattcaat tcccccgctt ccatatctct ttagagtaac agaaacctct     85800
     ttgaacgatc tttgagtaag caatgacttt tttatcttga aaatggtgtc ggcagagtcc     85860
     tccagcgcct tgtcgaaaaa ctcgcattcc tcggccgttg cattcttctt aagcctgtcc     85920
     actgcaatgc tcaagaactt ctcctcattc ttctcaggaa acaatatctt ccctgttcct     85980
     ttgctcctga agtattccgc agaaagcttg tagatagcaa cagcctctgc tgctttgaga     86040
     aacggctggc tcaaatactc cgcttgctca gccatccgtt ccttcatata tagccttgta     86100
     atctttccaa gacgcttctt ctctcccttt ttactcttct ctcccccgtt aatcgcactc     86160
     tcaatatacc atccagacct cagccgaacg tatctgtcta ttatcccctg caattcaaaa     86220
     agttccttct gatgcttgac tcctgccatt ttcccctgct cctgtatatt caacacaaag     86280
     ttatctgaaa atgtaaccac actctgctta gaagatatcg ttgtatttcc ctccccctct     86340
     tggagagtat caaccatagg cctgatagcc tccaggttta caatcgtagt ctctgaagtt     86400
     cctttcaggc cctcttgctc aagagataaa gaagcacttc ttcttattcc tagttccttg     86460
     atgtgctcat gtacaatatg gtagggaaca tttgccttcc aacatctcca cgcttcacta     86520
     aaatgctgga gaagcctcct tacttgtgtc ggatggagca cagacgaaac ttcggccata     86580
     atctgcctct ttagtgcaac atcatatcca ctctcgcttc gttgcttcga tagaggcttt     86640
     ggattatagt cccttccttc cgcaatcctt gtaaccagcc cagaaatata tcttccaagc     86700
     aacggaatgt gtccccggaa cataaagcac cacgtcctcc actgctctcc ccatccttta     86760
     aatcctatgt aatccgaaag cctcttccat gacttgcatt gcttgatctg cttcataagc     86820
     ttatacttgt acctgtatat tcctgtcaga accccaacat tgttaagcac atgatctaca     86880
     ttcgccatca gttcatatcc gtcaatgttt ccttgtctaa acagaacgtg gatatccaca     86940
     agatgcttca caagcttaag catttctctt gttagatgat aagatgttcc gactcgggac     87000
     ttctttcttt cttttgtcgt cagttgccga ataggcttca aattgaagtt ccagtcaaga     87060
     atgagatagc taagcttctt ccttctcaac acttcgctaa gcatcctgtg cccttgatac     87120
     accaattgga gccccgcctc aacccagtct atctctgtcc tttggaaata tcttgtattt     87180
     ttcagcttct taagaatgtg gctaggaggc ctcttctttg tcttcttctc tgtgatcctt     87240
     gcatagttcc tgagaaggtt tcggaccttg ggaccctcgt ccgtcctttc tctcaagcac     87300
     tcccctttca gcaatgggat gtcggccgga tgtctttcct tttttctcct gccatcctct     87360
     ctcttctccc ttctaaatgg acttatagca tccaaatgag ttttttccaa aacttgtacc     87420
     cttgtacttc tgttgtaaag ataaggataa gctatccttt cgagcccagg ctccctctcc     87480
     attatattca catcatttcc actcctctca gtaacataag gcccattctc aagctgcaca     87540
     cctacatgcc tgcttatcaa gaatgctttg caattaaaca gatatccctc gtccacatct     87600
     ctaaagtctt ccttccactt tatgttgtct tgactcccaa tagcagttgg aacagggagg     87660
     ccaattatac ttccatagtc cactactggt tcgtcgtcat caaacacagg gtatctcaga     87720
     acacgtacaa gtcctctttt tctttcctct gaagaaaaca acatacttgc atggctccat     87780
     ctattcttgt actcttctac atctactctc ctcttctctg tgacaaaggt caccagccca     87840
     gaaacatggt atacaacatc cacatatctg atcgactccc atggcattgg catcgacctc     87900
     acaagattat gaagtgcata cggcatgtac ctcattgctc ccatgaagga aggatgcatg     87960
     tcttttgatg tccttattat tcttcgaaga tgttctggcg gcatcctttc ctttctaaca     88020
     ctagaaggca tcctagggca aatactcgat gtccaaatac tccctgcaaa aaggcatttg     88080
     ggattttgaa ttggttcttc gtcttccctc agtagagggg catggaggcc aggtcattgt     88140
     cgacaacaac agaaaagctg gttgtctcca gagcaataga tatatatgga gtagcagacg     88200
     aggattcggt aacaaagtac atcacagcaa tgtatgggta catccaccca aacagatgga     88260
     agacaatcta ccaggaggtg cttgacacat gtgcaaaaca tggatactcg tctcctgttg     88320
     atttctgtga ggacctgaga cttgatgttg caaggaagat gtacatggag aaggcattgc     88380
     tctataacag gcttttggag ggagaggagg tggaatggcc tgaacagcac atggaacacg     88440
     actggaacat tggagacatc gagaaaatag atgagctttc caaagggtct gaggacattc     88500
     ttgacaagag actcctgtat cctactgtag acccgcgaat cataaagcag catgtggagg     88560
     ccatgagtaa gtggcagagt agagctgaag aaagtcgaaa tggagtaggc aaggccgagg     88620
     aaaagaaaaa agagtatggg atagaggaca aagaaagaag aagattttat catagaatgt     88680
     ctaatgaaga gaaggaactt gacgatttct tggacagaat agaagaagaa cactacaaca     88740
     tgccacaaag tggtgttgcc ccaaacagac taagagaaaa atatcccatc ctaaaggctt     88800
     ctccaatagg aagcggatat ccgggattcc gaatggaagg atctgatgtt tctctagaaa     88860
     accagtacag agcagttgta aagaaaatcc tgggaaaaac catgcatggg agtaatgata     88920
     ggcaatggag acaggaactc cgaattatcg tgcaatatca catgagaaga ataggaatgg     88980
     ttaacgagat tgaaaaggtg aatgcattga tagacagtag cactatgtca cacacgctaa     89040
     tgaacatctt gatgcttctc caggagctgg tcgaaaggcc aagaaaccaa gagctggtcc     89100
     aggactacct atttttcaaa aaggatattc ttatgtttgg taattactac agaaaatgat     89160
     cagctttcgt atcctggaca gacacttacc aattaaaaat tccattgaaa gcctaaactt     89220
     tattcgttgc ttctcatttg actatggtat ccactatggc tcttcttcga gcctccaagt     89280
     cctggtctcc actgaggtca aacacgcttt caatcacagt catctcgaca ttggtcgttt     89340
     tcactcctgc aacacacatc caatcattga tggcaacccc tcccccaatg caagggcttc     89400
     ctccattgac tgtccctgca atcacattca cctcgagaag ctcactaagc tccttttggc     89460
     actcttgact cgtgagggga tgaacaagca ttccttggtt gttcaatgca ccaaaggttc     89520
     ccacaagtgg ctcttggcct atattgtgtc ggtagacagg aacctgtaga acatctttga     89580
     taatgtcttc cgactctcca tccagatctc catgtatgat tgcaacatgg tcgttgcaga     89640
     gaactacatt tccaagggca ttcagtctct cttcaatccg cctcactaca acattctccg     89700
     gcaatgtgtt tcttatgtgc ataatctcct ggtctgttat cgtgtgtggc acaagtaatc     89760
     catgtctgtt tcccctgcat tgcgacccta cacttctaat gctattgatc gttgtttcca     89820
     caatcgggat tgcaacagtc tcctgcagaa acttgagtac attgtttgac tgacttcttc     89880
     caaccacaca gtatgtgttg gtaagtgata tgtatgctcc tatctcagag cttccttcaa     89940
     aatctattct gtacgacatg ggcccctgag aatttttcat tttccactct ccagataact     90000
     tcttccagag tctacctctt gtcagctttc ggctatactt ttaatgttgt tacatctaat     90060
     tgtaacctcc ccaaccattg cttcgctctc tccatccttc tctatgcatt tgtccagaag     90120
     tatattgaag tagttgtccg acgtgacaag aaccccttca tagacctgcc cccactttaa     90180
     cgtaacagaa acattcttgt ctcttatcct gtgaagaaat tgcttcggat tctccctgga     90240
     aggctttccg ccataggact cttccatctt gtagggtcct cagggatttg aataaacatc     90300
     gtactagatc cttacaaaac tcatttatta gacaactttt ccacagagag tttaatcagg     90360
     aaacattaga ttcgagatcc tttcttcgga gcaaacatgg ctttggttgt atgcaacttg     90420
     gcaagtccta tgatgacata cataatcgga attgcaaaca taatgtatag accattccga     90480
     attctttttg cctctgcaat attgttttct tggattgttt tcagacgtgt attcgtcctg     90540
     tacaaagaca tgagtttggc ctccaaatca agaaacaaat tcttaattgc caggttgtca     90600
     ttgtcaacat ctccagacga catgacatct gtgtatatgc ttatagaagc cttctcaaac     90660
     ccatcattga agacttcaat tcgataggcc ccaggagttg tgtacttggc attaacactc     90720
     tctataagct cttccttgaa ctcactgtca tcgtcaacct ctccaggctt gattatcttg     90780
     tagtacacaa gcgcgtcgga atattggttc aactggattg taagttccac atccttgcta     90840
     tcaagaattg cccagtacac ctccttgtct ccaggcctta ggatcttctg gatcctagaa     90900
     cacattgcaa aagaaacaat ccagaagaat agcatgggtt aggtcttctc tttgcttttt     90960
     caaaccaagc ctctagttgg ctaaaacaaa acaccccatg ggatcaggtg ccagcacaat     91020
     cccaggcgat acagaagaag atgccagaca attctcccac ttcccctcaa aagatatcca     91080
     ggaatggtct tcctcgttca gatcagaata tcctggcggg cttatgacac cgaaggattt     91140
     ggaggaaatc ttcaggagtt ttttcccctt tggatctccc acaaacttct ctaggaggct     91200
     tttcgaaaca atcaacatag gccagaccac agccatcgat tttcacgaac ttctgattgc     91260
     atacagtata ctgataaagg gaagcgacca tgaaaaacta cggtggatat ttaggtttta     91320
     tgacaaggac aatgatggtc ttgtatctaa ggaagaaatg gtcgaggttg tccagtatct     91380
     agcagatatg acatcgcaca ccctcgatgt ctccatagat tcagaaggaa tagtagagga     91440
     gatattcact tctgttggag gttccaagag cttccttacc ttcgaggact tcaaggcact     91500
     ttcaacaaag aatgaaaagc tatttaagat gctaacccca ttctccgaat aacagagaaa     91560
     taagaccacc aatccattac taaatatatt ataccaatgc aatgtgcttt aatgtaatta     91620
     tttcagtttg atcttcttgg agtcctttga gtcgtcatag aagtccggct tcacctcgta     91680
     cttaagtttt ttcaccggct tcttctccga tctgcttctg gcctccaagt ccttaattct     91740
     tctcttgatc gcctcctgca tccttatgcc agcctcgttc gttaccttct ccccatagga     91800
     atcgattctg gctgctattg caatcttaga cgccaagctc ctagctatct ttcctttatg     91860
     ttgagaatcc acttgtccta ggagagaaca tccgtagatc ataccatact tcggagtatt     91920
     tgtctttgac ttcaatgctt ggaacaaggc tttctctgcc cccatgatct ggatcgatga     91980
     cccaggcatc ttagcaagat ttgaaagaga ccctgctttg cttatcatct ttgctcctat     92040
     cacttcccca atcagagacg ttatgtttgg ggcaagatcc tccatcttca cccgtatgta     92100
     ttccacaagc tcatctcgga attcaaagct ctttaatacg ctttttgcat cctccaatat     92160
     attcagaaca tccgatgagt ccattgcaat ccccatgctt gtctttgcaa gacttacaat     92220
     cctttcccac tcatctttgg ctatttcctt gagctcttcc ttcttctcct caatactctc     92280
     ctttctccca atcgccacaa caagtcttaa atatttcctg ttattgtctg tcacagaaga     92340
     cagttcgggg aagtggaacc cataccattc cttgagtctc atgcaatgga ggttgatgtc     92400
     tctgtccata tcctccagaa gtgagacaga ctgaatcacc atggtgtcaa tcttctcggg     92460
     cacaatctta accttttcca ttgatatctt gtgtgctatg cacaggatcc tttccgaata     92520
     ttccctccca ctcatcccaa aatacttgtg gacattggat cttatcagcc tctggacatc     92580
     atcattcaag tatacaacct ttctcaaaaa cttcttcgat aaaggctcca ccagtttctg     92640
     gtcatccaca gccaagacct ctttgtcctt aacctctgca agcttcataa acctctccag     92700
     attgctcgga acttccccct tgatcagcag tccagaagac tctagtgctt cgtcaatact     92760
     ctcaaatttg tacgtctcga caagtcgtgg ctcttcagac agatctgtct tgtcgaaaag     92820
     tccataccca acaacagtct ccaccaagta aatcatttca aacggtcgaa aaaaatagaa     92880
     aaaatagaaa tccatttcca gatcttaaaa agatttgtcc atgtcacagg ctctgctatc     92940
     tgccttgatg tcctcaggtg gcatgtctat cttctccata gagatgtttt ccttcctaat     93000
     cttcactccg tacttcaagc ttccaagagt gttgactcgg agacttccgt accctcctat     93060
     cttcctaagc tccagaaccc cattgtagtt tggacagaag cagctgaaca tgttcgagtc     93120
     aaacatccca accgtatcaa aatacaggct taagcttgtg tttgccatga agaacccagg     93180
     aatcgaaacc atgcatacat ggccattagc ccttacagct ctcttgagct caaagagaaa     93240
     ctttgccatc tcctcttcac ccagtccaga aagtttccaa acaggagatc ccaacgagaa     93300
     tatggctatc ctcaattcct tttcctttct tgctatgtcc agaatgcttt tcaacgttgc     93360
     atcctctcca gaaagcaaga ttccttcgaa tctccttttt ttcgagaggt tgaacttgaa     93420
     caaaggtctt gctagagata gcttggtgta tctccatgca attaccattt tgtcttcatc     93480
     ctccttctcg gtaaatgatc cagtaccgta tatctccaca ttccggcctt ccttcataac     93540
     tgccatcatg ttctcttggt tggaagctcc ttctgaaaga aaaaccttca gtattgtcga     93600
     atgaatctga gaattttcat cctcaagcaa gagaatggat gttcctcttg taaagcactc     93660
     tcctagtact gtgtcaaacc cggatattcc tgtagataga tgttctattc tcttatatcc     93720
     tgtgcttttt acaaatgact ccatgcaggg gcatattgtc atactaatcc aacacccagg     93780
     cctattgctt ctggcttgta tttccagata tatcttcaat ccttcatgtg cggaatactt     93840
     ctctcagaag aagaaaacac tgcatacgag agggtggcct ctcttataag aaacagagga     93900
     ggagactatt acaacaaggt ctatatcgat ggtatggtgg caatcgcctc ggttctttcg     93960
     ataagggatt ctgtttgcca gcctgtggaa ggaaacgggt atctgtttct ttacaacggt     94020
     gaaatctata acaatgaaag aagcgacaca ctgtctatca aaaatataat agataaggtc     94080
     ttgtgcgaga gtgggaaagc agttttggat ggtagatgta tagtagataa gatttatgca     94140
     gaaatcaaca gacatgaaaa cgaaatggca atgatattga tgattggaag ccatgtgtac     94200
     ttctttaagg acgacatagg gagaaggagc ttgggataca cactggatcc gttctgtgtc     94260
     tcatccgtgg agtatgatga ggagatcaac cccatggcta tatactccta cgacaggtct     94320
     acaagaaagc tgagcgaatg gctaaaagac agccaaattg ttaaaaggta catgacaatg     94380
     ggagatgcaa tattaaagcg tctcagcaac gagaagtact cgaagaagta tcgatactta     94440
     gcaaagcatc tgtccttgca gaatgtagga aatcatgagg caaagcttga ggatgtcgat     94500
     agtgcagttg aagagtttaa caagatcttc agaaggtcta tagaaagaag aattagtggt     94560
     ggaaacatct gtgtattctt tagtggggga gtggactcga tgcttgtggc tgttttcctc     94620
     cactatgcag cagatcttcg ccagaagatt tatttgataa acacatcgtt tgggaaatca     94680
     tgggacagag aggctgggaa gaaagggttt gaaagccttt gcacaatgtt caaggaaagg     94740
     tcttttgtct ttgttgccaa caacatcgga gtagaggagg ttagggctgc aaaagaacat     94800
     atctacagac tgatccatcc aaaagacgga cgcatggatt tcaacatagg agcaacattg     94860
     tttttctcag caaaagagtc gagaaagtac agtaggattg catatttggg atcaggggca     94920
     gatgaaatgt ttggaggata ccacaggtac aggggagaag gctttagaga ggagatgctc     94980
     tttgatcttt tcacaatctc gcaccacaac ctctgtagag atgacagggc tgtttctgac     95040
     tgccaggttg agtgtaggtt cccatttctg gactcggagt tggtgggata ttccctgaag     95100
     atagggaata atgtagttgc aatggatgga gaaaagaagt ttatcttgag agagaccttg     95160
     agaagaaacg gacttgaatg tgtgtctgga gttccgaaga aggcaatgca atatgggagt     95220
     ggaatcttca agatggaagg gaagatatag aacttaagag aacatcactt ttattcaaag     95280
     ccaacttagc aggcatttct tgatattagc cttgtccctc tgtcaagctt gaacccgctg     95340
     ttcttgaaca ggccgcaaga gtagaagctg gatggaattg aaaacccaaa ggaggaaatt     95400
     ctcctttcga actcatctaa agacacagat tgggaatgga aggccttcat cttctcatta     95460
     aacatctctt tcagaaggaa aatcaaaaca tctgtgttgc ttctgttgaa gtactttata     95520
     aacttcttcc tcaggctctt cgacatagag tatttctgag ctcccatgaa agagtcgagg     95580
     acaacagaaa tggcttcgtc aatatcctcg gcagagactg ctgtactcag tctcatcttt     95640
     gcaaatgctt cgctgatccg gacaatactc tcaacatgtc tgacagtcac tggaagccca     95700
     gaaggcaagc tctccttacg gagctccaga tacaagcttg agattttctc gatatcaaca     95760
     tcattgaaga caggcaccac attggtcctt gcgtacagta tgtatttctt tagcaaatcc     95820
     tggcccatca tcatcttttt ggaatcaaac ccatcggtct tctctcctcc tccatgagac     95880
     tctatgataa accttgcagt cttctcgtcc tctccagagt cgatattatc ttttgtaaca     95940
     cagagaatat caaacctcga tattataggg tcgctcagat ttacattctg cgagaacgtc     96000
     agagacccat tgtatcgccc ccttattgga tttgccgctg ctatcacgct acatcttgca     96060
     tgcaatgttg caacaattcc tgccttcgaa atcgagatcg actgttgctc catcgcctcg     96120
     tgtatactag ttctgtcatg ctcattcatt ttgtcaaact catcaataag gcacactcct     96180
     ttatctgcta gcactagtgc ccctccctcg agtgtccatt cctttacaac cggatccttc     96240
     cgaacagatg ccgtcagccc aacactcgaa gctccctgcc ctgtagccag cactgctcgg     96300
     tgcgatgtat tttccacata tcggagaaac tgagacttgg ccattccagg atctccaaga     96360
     agaaggacat taatgtctcc ccggatcctg tggcttgtac tttccttagg aacccctcca     96420
     agcatagcta atgcgatggc tctcttcacc tcttcgtgtc catacaccga tggagctatc     96480
     gaattaatta ttattttctt gatttccgga tgtcttccca tcttcctgat ctccctgata     96540
     tcatcttcag tcatctcgat cttcccaact cttttactaa cagaacttgc ctcaatcact     96600
     gtgaaaaaca caggaaatcc attctttatg ttcaaggaca cattgaagtt gtttttgtat     96660
     atcccaacaa tctcaacctc ttctccaggc ttcgcacaat caattagatc atagaaaagc     96720
     agcacctcct tcgatcgagg aagagaccct ggcgggacac tcccaggaat ctcctggatt     96780
     gttaacttct ggaagtcctt gtaaatggtc tccgaggtac taacagtaaa aggccctttc     96840
     gactggcatt caaagcaatg tgtaggctta aatgatgatg ccacaaatgg cccaaacaca     96900
     gacttgcact taaggcagct aaacttcaca atagagtaaa gcggaaatac accgcttctt     96960
     cgtgtgacca caccgtttac cctcaccagc tttccaaggt ggctattcct cagtgagcgg     97020
     atactatcgc tcactggaag atcaacaact cttgcatgca cctttggctt tatgagatgg     97080
     tagtttggaa aatgcatcct caccacctcg gataaagctt ggtccatcac ctcaatcgtc     97140
     atctctgcat gctggttaag gagcttcagg agatctgtag attcctcttc aatatccaaa     97200
     tagctcacct ctatgctctc aagattctcc gagcacatct tccgaatcct tccaatgtac     97260
     ttcttatttc ggaactcatt gaaaaaacga acaaatttcc tggtaagctt gacccggaaa     97320
     aagccttgct caaaaaaatc ctttgtaatc tcgtcagcct taaatatgtc ctcggcgtcg     97380
     tactcgttcc cagaatctcc ttctctcctt gccttgtttt cctcagactt catacttgaa     97440
     atctcctgtc ctatgaggtc ttcaatatca gaatgctgca taacctcgct ttcctcaagc     97500
     tccgaagact catataattc ctcttttatc tcatctattt cagagctctc aagctccttt     97560
     accatcctca tccccacttc tcgtccctct ccagacgtgc tctcgtcctc ttcaagcctt     97620
     cttttcacca ttccagggga agccttaagc cccaaataaa gatgccgttg gaaaaaggaa     97680
     agtactttat tacagatcca catcccataa agattatgct tcttttttgc tcagcagact     97740
     gtttgcatac tctttcagac ggagaataga ctcctcgtct ccaagctcag atacaagaaa     97800
     ttcactacag aaacccatta tgtatacata ccctagctcc acctccatcc ccgtggcttt     97860
     caccatgaga agatcaaata tactaccata cacatcctcg atcttgtagt cgtctattct     97920
     tttttgcccc agaatccctt cagacagatt cattctgtct ttcagtcggc tgtcttttgc     97980
     aagaaatgag cttccaaccc ccttcacctg cttatttaca aactccacgg tcctccggag     98040
     ctctgccatc ctgctaacca ggatctgcgg atcctcaatg tatcttgtat agggatcaac     98100
     aagcatccgt gttagatcaa tcggctctgt tgtgtagtaa tacagatacc ggaggttatt     98160
     aaaattctgt ctttgcacct cttgatccac cctgtctatc aatattgcta ttcccttgat     98220
     aaggaccaga gtacattcaa gatagaatct ttcgtcataa aactcttttt tacagaactc     98280
     atgcagcagt tcctccacct ccgggagatt caggtcagaa gatccctcgg aaagtgccct     98340
     tcctatcaca agatcaagaa aaattggttc aaacctctcg taatatgaaa tgtcctctaa     98400
     atacactttt acaggcacat ttctttgctt ttcataaaca tccacatact cccttatgaa     98460
     ctccacaggg tcggaaaact ccttcataac ttcctcctgc tccgtcaggc taagcttcat     98520
     aacaaactga tgggtccttg gaagaaactt ttatgctcta catcatctgc tctggtcgtt     98580
     aaaaatattt tcgtctccaa gccttaatgg agaaagagaa cattccggac aggacaactg     98640
     cctcaaacat gggggatgcc tccatctccc cgagtcttct tgagccctca gagccggggt     98700
     gctgtccctt cgatgtgttc acacccgagg ccctagtaag cagattcaaa acatatgacg     98760
     actgcactga agatatcatc aagcttatca gatcggtcca tgtctgccag aacaaaataa     98820
     agaagctgtg ccgtgtcttc gactcactgt ccaactatga caccggcttg atagttaacc     98880
     ttacaaggga tggaaatcga atgctgagat atgtgtcgac gtatctgatg ctcaataaga     98940
     taaagcagtg ggttatagat ggaaggggat ttgaagtggt ggaggctatg tacgatgagg     99000
     tgtttctggt taggttccga gatgtggatt tcaatataag ggctgcttgt gttgagttta     99060
     tgtgtgagtg gattatctct gcccctggga tcttcaatct gccctgctac ctgaagtaca     99120
     ttggatgggc tctcagtgac aaaaacgata gtgttaggag aaaagggata agctcatgca     99180
     cgagacttgt acggaagaag atcaatgtcc aggggtttgt atctcgtttt aagagtagga     99240
     taatagagct atctctatac gataggagtc ctgcattaag ggacgaagga aaagcactct     99300
     gtatggagct gtatattgga gggatggtct ctaaggatga tgtatacaaa gttctaaggt     99360
     ccatgaacga aggagataag aaaggattga tgagctctac catcagaaag atacttggaa     99420
     cagaggaacc aagtgataga agtctcttgg agaatcacga gggcttgcat gaactacttt     99480
     caaacacgtc tttatttatt tgctcatgca ttcctcacag tggaaaagat gttgaaggat     99540
     tcatagactt tattttggac ttcctacgca caaaaaactc ttgctgccaa tcaaagagcc     99600
     tgtgttacct aagaatcctc ggagttctct ctggctcggg ggtggatgtt gagaaatatc     99660
     acagaatctt tgagatagtc aaggacagta gagaaaacac ggcacaaact gtggaagcta     99720
     tctcaaaagt tgatccagag gtgtttagga ggcatccaga tgctaccaat aggcttctgg     99780
     aggcaatgaa agatcttctg gcccagtaca aatgtgaaga gatgttttca aggtttgtac     99840
     atctcttgaa gaagcttgag aaggactttc cagcctttgt tcaccgagtt gtggaatcac     99900
     ttaaatcctc ctgtgtagag tttgtgcatt gcgcaatcaa gtcgtttgac atatcggaaa     99960
     gcgtggaaaa caactttcca tcagagatca aatgctatgc tgcactatgg aagataatgt    100020
     ccgaggacta cgaaagagtc aacggatatg agttcaagaa aatcggcaat ctttctgtac    100080
     tttgtgactt tctccttttc tttagagaga aatgcattga atttggagta gtgaaccgga    100140
     gtgttgaaag agcttctgac cagggggaat gtttcaagat aatgtatgat cgtctctctg    100200
     ttcttattca ttcacaagca gaagatgttt ttacagacca aaaaggatgc atttcgttgt    100260
     tcaagcttgt tgatggaggc ctttttgttg actactcgag tattatattc aggacttgta    100320
     acctagagct gatctcagag tttctgggca agagtaagtc aaagatgaac cttgtctctg    100380
     gatacttcag atatcttatg gatgtggaag aaaaggatgt agacaagaag gtcggaagac    100440
     tagtgggttc cagatgcagc atggcaaaga gagggcttga tacggagaag gttgttttcc    100500
     gaggtatgaa ggagctaatc gaactaagaa aggtgtttct gtacgataca gttctcattt    100560
     actttgtttc ttccctaaca gccaacgaat gcataatcat agaacagggt ctggaaaagt    100620
     caagacttaa ggcatctttg ctccgaagga tcagagaggg ttgagatata ataggattct    100680
     gttgcatgaa tgatgcatgg ctggaaagtg ttcaagtatt caagaagagt ggaaggagaa    100740
     gaaggagaga agtcgttttg tgggattggg ttggaggaaa taagccgagt gatacttcat    100800
     tcagaagttg gtcggcaagg gattataaag gagaggtggc tccatgtgtt cacagagggt    100860
     agcaaaacac tagggttggc tctgttgcca tctatgctag aggttcgggt ctacatcgtc    100920
     tctgccatta gacaagagct ggtgatactg gagagaataa agcttgagga gaaatgggat    100980
     attagggttt gtgtaagcaa gagagtgatt agatgtagat gtaaacagag gaaatttcaa    101040
     gtcatcttct ttagtaaaga agattcagaa gactttgcaa gtaagtttgg gcacttttcc    101100
     aagccccctc cttcaatacc aaaatatttc ccgttgattg ggacatttga aggacttgat    101160
     ggaaacgaga aaaaggagaa gaagactccc aaatacaaaa agaagaagaa agttattgag    101220
     gagtttttat cgttgctgtt tgaggccctt gggaactaac ctatgaacac catgttttct    101280
     ctgtgaaacc ttacagaatc cagacatgca aaaaagccaa tgaggttttt tctttggtga    101340
     atcctcgggt agatggcatt tctcttgtat tcctcccggg ctgcatcatc gacccctatg    101400
     tcctctgtgg ttccgtctcc tcttctcaac cggtggaacg taggcttgtc aagtaaaaga    101460
     tattcagaag gtccttttgg aacatgaatg ttctctttgc taaacaccat gtcgaacttt    101520
     gattccacac tatctctgga atacctacac aataaaatcc caaaaagcat catctttcta    101580
     atctggtgga gtaggaagct ctggccggta atcgataccc tcacatattc tatcccgttg    101640
     tttacgtatg gatccgagac gatgacagat ttaatgtatc tcttagtgcc cttttcacta    101700
     ttgagcttag tgaagttgtg aaagtccttg gttcctgtgt acttctgaag gatggcttca    101760
     aagaccctga ggtcgtcttc agaagatgta tatccgacca aactatcaat catatcgctt    101820
     ggataatctc ttgttactct tccatctctg cattctccat ccttctgcct caaaacctcc    101880
     acctccttgt cgaagtctcc ctttgcaagg aagaacgtcg ggacaatgta ttcgtaggcc    101940
     cgaaaaacag cctgcttgga tggaatagtg ctttttgtaa gccttatgat gtcatataga    102000
     tggatctcct ttctagaaag aagggttcta agtccagata taagttccgg agtgatgtcg    102060
     gcctctatct tcacagagac gaggttgagt gcagcatgga cgcccttatc cgttctggaa    102120
     gacgatttga tgtgaacttt ctttgggtcg tcggcatttc tttggctgat cacctccatc    102180
     tcaagaaggc aaccaattat ttccttctcc accgtgtcca gctccttgtt aaactgcagc    102240
     ccgtggtatt tgcttccatc gtatcccact agtagtccag ccctgacctt cattagggga    102300
     agagaaggtt ggagaaaatt tgatccctat gccaacgctt atagtaaaga agaaaaaagt    102360
     ccaggaactt cttcagaggg aatttgacga ccactggttt gaaaggactc tgtttgactt    102420
     tgggctggag ttggacgaca ctgtggaaga agaaggagaa tgcatgtaca ggatagacat    102480
     cccagccaat agatatgacc ttctttgcac cgagggactt tgctatgcat taagggtatt    102540
     tctctctatg gaagagtacg aggacataga aatcgaagaa ggaagagtct cggtttacaa    102600
     gtctggagga agagaaaggc cctgtgttgc ctgtgcaatt gtcaggggag tggacttccg    102660
     gtcggaggaa acctacagga gcttcatcga ctaccaagat aaactccatc taacgattgg    102720
     aaggaacaga acattagtat caatggggac acacgaccta gacaagatcc aagcacctat    102780
     tttttatagg agtgagactc ctgatcggat tgtgttcaag cctttgagcg cagataggag    102840
     gatgagtgca caggaactga gttcatactt tgctccaggg agtaagattg gaaagtatat    102900
     gaagcttatt gagaagaatg aaaagtatcc ctactttgaa gattccaagg gaactgtttt    102960
     gtcgttacct ccagtaataa attccgatgc aacaaagata gaccttgaga caaagaacgt    103020
     gtttatcgat gtgacaggaa cagacttcca cagagtcaac acggcattga aactaatatt    103080
     gggatgcttt cgaggaaaga ggatagaaag tgttgagatt ttggatggag acgaaaggat    103140
     aagaacaccc attatgcaca atcacttgta cacgctggag ctggatgaga tcaataggag    103200
     gctaggcttg gatctttctc tggaagttgc aaagacttac atggaaagaa tgatgcataa    103260
     ggcaagcatt gttgatggaa aaacccttca ggttaaggtg catgatatca gatcggacgt    103320
     tatccataaa tgtgacttga ttgaggacgt agctattgcc catggattca ataacttcaa    103380
     aagagagttg cccttgatct caactattgg atcagaggat cctttgaaca gattctcgga    103440
     caaactccga atggagctct ccatcatggg atttgatgag gctctgactc tgacactatt    103500
     atcccggcag gagaatataa ttgacggaga tctggccgtt gtcctcatga acccaaagtc    103560
     cataggatat gaggtctgta gaacgtctct tattccaggc ctgatgaaga cagtggcttc    103620
     gaatctgcac gtgaaaattc ccttcaagct gtttgaagtc tcggatgttg ttcttttgga    103680
     taaagaaaac cagagtggag caagaaactc aagaagactg gcggccctat actgtgggca    103740
     ttcgccatgt cttgaagagg tccagggctc tttatctctt cttctggaga agtgcggagt    103800
     tcagccgtcg tatactcccc acgacgatcc tataaggtat ctcaagaacc agggtgcatt    103860
     tgtagttgta gagggcattc ccattggatc gataggcgtg tgcaacccag aaatatgcag    103920
     agctttcaag gttccgtatg cagcatcgtt ctttgagata gatgccgaga aactgttttc    103980
     tgtctacaaa gatatgaatt aaaggactaa acaaataagg atgaaagctt cagactctaa    104040
     tacttttaaa ttcaaacgta aagggaattc gcaaagacta tgtctctttt gattttcact    104100
     attcccagag caaacatgtt ttccagttct gtgttgccaa tcaccctggc agcactactc    104160
     aactgcctga gtaactcttc aagtctcttg aaggttctaa tgatgcttcc ttcgaaaaca    104220
     cttgtcttgt tgcagatgtt aatgaatgta tgtccgcaca cccacatccg gacaacatcc    104280
     atcagctcat aggaaaactt ccggagatat gtggtcggat ccacgtctat cgagcatgac    104340
     ttcaagacct tgcagacctt ctcaacagag tccgacagaa gcttgtagta caacttgttt    104400
     tcttcgctca gaacaaagtt gtccgaatcc cattcctcaa acacaatgca cgaaagaagc    104460
     ggaacaaagt gctccacagg aatccctgca aagtctccat tgaatatcat ttctgtcagg    104520
     accagctcat ctcctgagga aatctcgcat gccattcggc cctttatcaa cacagtagta    104580
     tcgtcacaat attcaagctt cttcagaacc ttgatcatct tcttgcattc tctcatgtgg    104640
     tagatttctt tgagactatt gagctccagg agcttttcaa gacattgctg cttcattatc    104700
     tcgttcagga agtatgatct tgcagaggac atctcttctc ccatttctac atgcaagtgt    104760
     cccgccttgg ggttttctgc atgccgtctc ccgttctccg gtacctggac catgactgca    104820
     tcatccccaa tcacgtcttt gctgcacaaa gaaagacact ccatcgaagt ctttccgcag    104880
     actatacaga catcgaagct ccatcctgga tttgccgata ttatctctgt ttctatcctg    104940
     tttatctctt catccagttc gtcctcaacg ggaattttcc caaagctccg ggtaaatacc    105000
     cgcatgtcta actttactct gctgtcatat acattgtcga cgcaatccaa gggaaagctg    105060
     cacatgtaca cacctttgtt agtcccaacc atgcaaagaa tcttctcctt taccttgcta    105120
     actattgcat ttcgaatcgt aatcgaagga ccatttctct gcacaaataa gtcaatcact    105180
     cttcccttct tcaagtgccc gttaaactta tcaactagcc ttttgtttct ttcgattttc    105240
     ttctcctccc ttctcttgta taggtccaca attcggttgg gcgaaaggtc ttccagacga    105300
     ttatgcatta tatgcagagt ctcctcctct gcaagggcct tcttatatga ctggaaatga    105360
     tagaaacttc tactaatgag gtacagagga tctaggccct ccaccctcat cagattcaaa    105420
     agcatgttgt acgtcagtct aaatgcactc acaagattgt ccgaggatgt ggaaaaaagc    105480
     ttgttaacct ccttgtaggt gattggttct gagataatgc ttatgacaat tcccatgctg    105540
     tctattcctc ttcgtccagc tcttccgctc atttgtgtgt attctcctgg gctcacgagc    105600
     ctcatgcttt ccccatcaaa cttcttcagc gcagtaaaca ccaccgactt cgcgggcatg    105660
     ttgagcccaa tagaaaacgt ctccgttgca aacagtacct tgagcagccc ttcttgaaac    105720
     agtatctcga caacctcttt gataataggc aagagtccag agtggtgaat cccaatccct    105780
     ctcataagaa gaggaagaat gttttggata atcggaattt ccctatcctc cttgcggaga    105840
     gacattatgg cattggtaaa gatcgtttca accatctcgg cctcggagtc tttcagataa    105900
     ctcttgtcca gcttcattgc aaaccgctcg cagtcctttc tcctgaagga aaacacaaca    105960
     acaggaagag atgcatcact aatcgcctct cccacctcct taggcccgat gttcctcttc    106020
     tggattgacc gcattgcgga caaaaaattc gacttgtgga actttgcatc cttgatcttg    106080
     tacagcttgt tgctacggaa gtaatgaacc aatggcgtca ctcttttctc tgtatataca    106140
     acatgaacaa cctggctttg gatatggcat atccactctg caaactccag tgcatttgga    106200
     atggttgcac tcagaaatac catccgaaca tgtcttggaa gtagtattat agtctcttcc    106260
     cacaccactc ctctttcttt atctctcatg tagtggattt cgtcaaagat gatccagtga    106320
     atctcacgga caacttctcc tcccttgtag agcatgttcc ggagaatctc cgttgtcatc    106380
     acaaggcaag ttgctgtggg gttgatggta acatcccctg tcatcagccc cacatctcca    106440
     aactccgaaa gaagctctct gtacttctgg ttcgacagcg ccttgatcgg agatgtatac    106500
     acaactctct ggctgttttt cagagacatt gcaattgcat actcggcaac aactgtcttt    106560
     ccagagcttg tatgggcact tacaagaaca ctctcatctc tctcaagact acagacagaa    106620
     atcttctgga agtcatccag ctcgaacaag tagtcctttg caatcggctt gccaaactct    106680
     cttgggagag gcacgtagtc tactccagcc ggaatgactg cctcgtggcg agttccattc    106740
     cggtctattt ggtcgaccac ggccgttctc ctctccaacc tctcgggaat agtaatatcc    106800
     tgcggagtcg tattgtcctc gaggacatcg aagtatttgt catcgatcat ttagggtggt    106860
     tgggcgataa gtattagaac tgttggccga aatctgtttg cagccaccgg caaaatggga    106920
     cctgggggat tcgaaccccc gaacgttacc gtattcgatc ttgagtcgaa cgccttagac    106980
     cactcggcca aagtccctca ggtcggattc aggacatgcc gaaagcactc cggaagacag    107040
     tacacagcca tccaggttct ttaaataagt cttaataaag gccctttgga tggatgacat    107100
     tgatctgcat tattccatga ggtacataat aaactacaga aatgtatctg ttatgatgtt    107160
     atgccatcta ttatgcctgc tgaaacaaca tctgaagatg acactaacct atccagacat    107220
     tccggttatt ataacggacg aagttgccca gtactatcgc tcccgagacc caagaataat    107280
     tcaagaattt agggaaagca catacgttgc aaggaaaaac atcgagaagc ttattctaag    107340
     ggtgagcaga tggatagtaa tgtgcgagga acaattcgat tacttccaag gctacgacca    107400
     ctttgagtcg aacgtgtgca gcgatttcga caagcttctt gaggattact ttaaaaataa    107460
     aagctctgaa gagaataaaa aaagatggga tgacctacaa gaatttgttg aaatttgtag    107520
     ttacagatac ctaaattacg acagccagaa ggctaactgg cttgcaggga taagtaaaac    107580
     aatttcaaag tgcgatgagc ttaatacact cctgaacgca aagctgtgtt ttgtgccgaa    107640
     ggaggctcta gacagcgaag actatgtgat ggggattatc cagtccgaga tgcaaaacca    107700
     cccatggaca cccactcact acctggagga agcgaagcac aggtatgtga tcgtcacact    107760
     aatgaatctt ctgcacatgg tggcagaagt aaagaacaaa gagaattcct tctggatact    107820
     cgaaaaggag ttaaaaaaca gaatgccagg cttgaagaaa gaggaaagac ttctggatgt    107880
     ttcttatcaa agcggaacag aagaaaaaaa gccggctgtt gggattttca agaagtgtat    107940
     cattttagtt aaggatgcta gactatcaag cgtggtagtg attgttggaa ttggtatggc    108000
     aataggtatt attaaattcc tgaattgatc atcatgatta ttcttcttgg cctcggatct    108060
     gttccaaaga tcttgatttc gatatttcat tgttcttggg acttcttgat atgcaagagt    108120
     cggcatactt cttgggagtc agcctgagca atgatgtggt cccagctgga tccgagacat    108180
     ttatatgcat agtagaaata ctctgcagac agctcgtact cttttgccct ggcgtgtttt    108240
     ctggcttcgt caatcattcg ggcagccagc tcgtcggcat ggcctgttat tttcataaga    108300
     tactcctcat cattcttcat tgcttcttca gctcttctgt aaagcttata agcaacacat    108360
     cctgttataa caatcttaac cattgtagat agcatgaaga ttggcagagg attttaggtt    108420
     aaaaaaaata tttccaaata catcatggga ctggagagag ttgaagtaga gaacttcaag    108480
     tcgtatgcgg gatttcatat tattgggcct tttgataggt tcacttgcat tgtcgggcca    108540
     aatggatcgg ggaagagcaa tataatggat gctgtgacat tttgccttgg gattggatcc    108600
     aagcacctcc gagctaacaa tattaggagc ctgatcaacg gtggatccag ccatgccagt    108660
     gtggcacttc acatcgaagg gtctggagag aggagagtct ttaagaggag gattagtagt    108720
     gaagggcgaa gccagtactt tgtggattct gagagtgttg ggtatgagag gttcagagag    108780
     gttgttgagg ggatgaatct gctggttgat gcccgaaact tcctggtgtt ccaaggggat    108840
     gtcaatgcga taggaaacat gatgccgatg gagcttacaa gggtatttga agaagcaagt    108900
     ggaagcctga agcttaagga ggcttatgag gagaagcaga gggcacaggc aaaggctgtg    108960
     agtgaatgtg cgtcgctgtt tgaggagaag aaagaggtga tgagccggat gaaggaggct    109020
     gaagaggttc gagagcaaga aggagagttt cgaaagctag tggagaggaa gcataaggtg    109080
     cagagagata tagtgctgta tgaacttatg gagaagagga ataagaagaa agacataagc    109140
     aatgaaatgt tgagtcttgg gcaggaaagt agaaagatgg aggagttggt atgcaaaaag    109200
     gagaaggagg ttgaaaagca tagaggaagg ataagtgaga tcaggagaag gtattttgag    109260
     gccgatgccc tagtgtcgaa acagaaggaa gtggtggcgg aaagaagagc atggaagtcc    109320
     ttaggggagt cagagaggag taagagaaga gtacggattg cggagattga aatggaaatc    109380
     agggcgggac aggaaatgat ggggggaaag aagagagaga ttgagaggag aaggagagat    109440
     ctggcaggag ttgccgaagg gtattctgag ctatggaggg aagaggaaga aagaaaagaa    109500
     cggctgaacg gagttaagga gaaagaagag gagattgaaa agagagaaaa ggaatttctt    109560
     cggatgtgtg gagaggagag ggagagattg aatactctgg agatggaaga atttcctcgg    109620
     caaatgatga aagatgattg cataaggaag attggcaact tgaaggagag aagcgaagaa    109680
     ttggaaagta tgatcaagga aaagaagatg atccggggaa atactggagt gaagatagat    109740
     gcgcttgaaa gatcttcgga agagttgggg aggaagatat tacatcacga ggaaaagtac    109800
     tcaaggctta tctctgagga gaaggaaaaa aatgaggagc tttcgtgggt gcttggagag    109860
     attctgcgca tcaaagggaa gagaagaatt gatggacggc attctgtgat tgcaggggct    109920
     gtggagactc ttagggagat gtttcctggg gtgtatggaa gggttgttga tctgattaag    109980
     cccacccgag acaaatacga gattgcattg tcggtgcttt tgggagggca tgatcaatct    110040
     gttgttgttg acacagaggt gacagcgatg tcgtgtatca actttataaa ggagaagaag    110100
     ctgtgcaaga tgacgtttgt tcctctgcac agcatccgag accagggaga tggtagagat    110160
     gtggagaatg ctgtggagaa gtatggagaa ggggtaagaa gagcatcgga tgcggttaaa    110220
     tacgatggga agtataagaa gatagtatct tttctatttc gagaaaagct aatagcagat    110280
     agcatggaga tagccaagga tatttgctat ggaagaaaaa tcaaggtgag tgtgtgtacg    110340
     ttggatggga tctacatata cggaggagga tatttgataa gcggaggagg agaaggacga    110400
     aacaagttcc aggaggatga gctggatgaa ctagtgaaga aaaggatgag gattttagac    110460
     gagcttcggc gaatccaaga tggcaagaat gagctttctc atgttgagat atgtagagaa    110520
     agaatggagg tttggaaaaa gagcaaggag ttggaaatgg agactttgag ggagctggac    110580
     tcgtgcattg aggatctgga gctccggatt ggagaaaata aaaggatgtt ggaagaaaca    110640
     gaggagtgtt tgaaacgaac agaagaggag atggggcagt ctgaagttta tctaaaggag    110700
     cttcgaaaga aaatcgaaga agtggaatct tctgtgtttt gcggaatatt tccaaatgcc    110760
     tacttcggaa gctttgaaga gtacaagaag gctcgggaga gtgaagcttt tgcactgaaa    110820
     agtatggagt atgagggaat aaaggcaaag actgagctta ggattgagat gctggaacgg    110880
     gaggtaaggg acctagaaga ggaaacagaa agacttcgaa gggaagtaga aggattgagt    110940
     aaagatccct gccgcgatga aatagacatc gatgcattgg attcggagct catgattctt    111000
     gaagagggaa gaagaaaaaa tcttgaggct tttaaaaagg ctcgggacga gtttaaagag    111060
     atcaatgagg agttcaaaga gttggttgac cgtagaaatg aacttgatca gcagataatc    111120
     cacagcacat ctgctcgaga gcgtcttgaa gaagagatta aggacaccct gagctttgca    111180
     gttctcgagg agattgatct cccttgtgca aagaggatgt cgatggggga gatttctgtg    111240
     gatgagatag acttctctgg actggaaggg agtgtctcga aacttcgaaa ggagctggag    111300
     gaaatcaacc aaaagataag cagccaggca cctgtgataa gaatggagga aagagatgga    111360
     gataatgcta gatacatgag gataagcgca gaatacgaaa agcgaaaggc aatggcaatt    111420
     gctgccaaga atgagttcaa cgaggtgaag aaaagaagaa cacacttgtt catggagtgt    111480
     tttgagaagg tcaataagga gatatcaagg atatacaagc ttcttacaat gaccgagaca    111540
     ggtgaaggaa atgcatacct ggtccttgaa aacacagctg aacccttcag agaaggcatt    111600
     agattccatc tgatgcctcc aaacaagaga tttcgagaag ttagactgct ttcaggagga    111660
     gaaaagacta tggctgcttt gtccctcctc ttctctctcc atgcgtacag gcctgctccc    111720
     ttctatttat ttgacgaggt ggactctgcc ttggacaagg ctaatgtgtc gaagattgtg    111780
     tccttcatag tttcgtgtaa cgcccagttt atcctcatca ccctaaagcc atctctattc    111840
     caacatagcg atggcctggt tggagtgtac aaggatcctc gcgaaggtgt gagtaaggtt    111900
     cttacctata gattgggaga ctgacaatta aaacctgctt atgtgttcac acaatttact    111960
     ctttattggg ctttgagatg caataccttg cattacttgg caatccctag ctttctcatc    112020
     aattcaagct caagcacctc ttttttcttt tgatggagac tgttgccgtc tccaaggctt    112080
     ttccccttct tcgcattcac tgtgctgatc cgggaagcat ctttaaagat ctcctcccca    112140
     tacccgggct tgatgatgtt tgcctcggac tcaatacata ttctctccac ctcacaattc    112200
     ttgctctcct cgttaactct ttcccaatgc tcctcactta tcatcctgtc ctcatacaac    112260
     actccaagaa tctccatgtc cttctctaac ttcatcaccc tttccttgaa gcaggctgct    112320
     gccttgacaa gttgtctgag aagtacagaa gaggctgctc cctcggattt ttgcagaaaa    112380
     tacatctcaa gctccatgtt tggattctct tctgccggca tcttcctctt gttgattctt    112440
     cttacgaagg aaaacgtcag aatcattgtc gacagaatta tcccaagcaa gagaatcatt    112500
     ttaatgggct ttgagggacg caatttgttt accgcttcaa aacaaaaaac agaaagtcta    112560
     gaatgatctg tctggaagta atttaatctt gcgtataagt cactcctttt catagtcctt    112620
     gggctcaaac gccttctttg ccaacttgat ctcctcgttt gtaatcagta aatgcctaac    112680
     tcgtgagtac ttcttcctat ctctcttcaa gtagtataag agatcctctg tctttgtctt    112740
     tccctttacc tgtgccatgt tgtgagtgtt tgtcaaaaga atgctcatgt agtccaagac    112800
     atatccatgg agagcttctg cagtgtcata tctaggcgca atgacatctc catatccata    112860
     catcattact tttatgtctt tcatgaagtt cactcttctg gtttccctca tcccaagggc    112920
     cccactatct cgatgtcaaa gattcacaaa gaccccatta tctccgtatg atagaacggt    112980
     acattcgaca gtgtctcctt ttgcaaatct atcgcatagg tgctcgtttg gattgaagtc    113040
     aacaggccgg aagattcctc tgtattcaat ggctgtcttt ctcccctcca cttcaaatat    113100
     ctgcacaatc atctgtgtaa atgtcacttt tatgactctg gccttccctt tggatcctat    113160
     ctccggaaat atggtgccta ttgcgggatg tccattgcac gtcaaaacat ctgctccatc    113220
     tccaggaagc ctagtcatta agggaggatg ctcatgaaat aaattaaaag ctcgatggat    113280
     gtgctaggga gcctgctcca cccctatctc cagatcctga attcctacag gcaatcagcc    113340
     tccacaactc cttgattaaa gggagaagga ggtgagatgt gaataggagc gacatagagt    113400
     aaaggaagaa aattgtataa taactggttg tctttcaatt aaaagtattc tgaacagggc    113460
     ttggaataat gaagaggaag acagtggagt ataagttggt tgacgaggaa aacgatattg    113520
     taagaagcta cgagcccaga cggaagccaa agagaagcag gatactgctc cacgaatggc    113580
     aaagcatgat gctagagcat agcttccgga caaacccata tccagacaga atagaaaaat    113640
     acaatctgtt tctgaagaca gggattcctg tcaagaacat caagatctgg ttccagaaca    113700
     gaagagcccg ggaaaagtcg ttctatgagg aaatggagga gattcatgaa tgtgagagga    113760
     tggagtatca agggctggac acaagagtag ctagttttgg agaggagttc cagtactaca    113820
     agtattgatg gagactcttg tcctggaagt gttttccgag actatgtctt tggcacttgg    113880
     tagcaataaa taacctaggg cccagccctc aaagaaggat gatcaccgag cttggaaagt    113940
     cgataacaaa cactttgtca aatcttttaa gatcgcgggc cacagaccaa gacatcgagg    114000
     cggcgataaa ggagatatgc cattcgctga ttctatcgaa tgtaaatcca agatatgtaa    114060
     gcaacttgag aaacgaactg aaggcccggt tggacccaag tgggatggcg ccaggactta    114120
     acaaggcaag ggtagtccag aatgcagtct acgaaaagct agttgatctt ctggatccaa    114180
     aggccaaggg ctacaagatc gagaagggaa agacaagcat tattgtgttt gtggggctgc    114240
     aagggtctgg aaagacaacc agcatatgca agtacgccaa cttttataag aaaaaaggat    114300
     tcaaggttgg gatagtgtgt gcagacacgt tcagggcagg ggcgtttgac caggttagac    114360
     agaatgcctt gaagatcaag gttccttttt tcggaagctc agaggcagat cctgtgaagg    114420
     ttgcaggagc gggggtagaa agatttagga gagagaggtt tgaggttatt cttgtggata    114480
     ccagtgggag acatacacag gaaagtgagc tgtttgtgga gatgaaagat atcatgagag    114540
     aggtaaggcc agacagcatt gtatttgtga tggatgcggg aatagggcag tccgcagaag    114600
     atcaggctat tggattcaag aaggcagtga atgtgggatc cataattttg acaaagattg    114660
     atgggacaaa caaggcaggg ggagcaataa gttctgtggc agcaacagga tgtccgatcg    114720
     agtttgtagg aaatggagag ggaatggaag atcttgaggt gtttgacgca agaaggtttg    114780
     tgtcgcgaat gcttggaatg ggagatgtgg agggactgat ggaaaaggtc gaaagccttg    114840
     ggattgacga aaaggaggtt gtaagaaagc tgaagcaggg gaagtttact ctcggagact    114900
     tctacgatca attccagaag atcctgagcc tcgggccgat ttccaagctg cttgaaatga    114960
     tgccgggctt ttcggggctt tccctacctg acgaagagtc ttttaaaaag ctcatctata    115020
     tatttgattc tctgagccgc ggggagctgg actccacagg acagatgttt gagaaggagc    115080
     caagtaggat tatgagggta gcccggggaa gtgggacatc tgtccaagga gtggttgaga    115140
     ttcttaccca gtttaagaag gcccatgcag tgatgcagaa gatcagttcg attcctggaa    115200
     ttgagagcat gatggggaat ccatcttcga tgagcttgac acagaaagca aagctaaagg    115260
     agcaggcgaa gaatatcctg ccaaaggatc ttcttgacaa gatggcctcg atgttttgaa    115320
     tgtggtagga aatacattta attatccgtt tttgagtaaa atgctttgaa ttgaaattgg    115380
     aactcttcta cgtttagtgt tcacggatct gtccgggtgt ttcctatgat cctgtcttca    115440
     agagatgaga tccccttgaa gacaatggca tttgatttct cgatatggtt gtggcacttt    115500
     tcgcccataa gtattatttc ccctatgtgg ttcctgactt tatgtaggag gttaaggatt    115560
     cttttctttt tcagagcact acttcttata aggtcccgaa cctcctcgga aagctctgga    115620
     gtggctgctt cgagatcgat gaagtgttct ccatctctgt tgagcttcat acaatagtcg    115680
     atcatctcaa gagacatttc tctcagtctt cggcaactta ttttttcttt aatttccttg    115740
     gagtctctga ttgtctcgat atcgcaggga gaagtgggct tgtatttgta atagaatgca    115800
     tcctcgttaa tgtccctttc atatgttcct ccctccctca gcctgcttat attgaaagca    115860
     aatctatcga gaatcctatc gcagtatgat agatccaggt cataatcaac atctctcttt    115920
     atccaaagct tgtttggaag gcagggcctg gaaagggttt tgaggcagtc catctcgctt    115980
     tccgaatctc taggatccgc ccctggatgg ccaaggctct cattgactac gtctgaagaa    116040
     atggagatcg aactttcttc tatcatttca ttagtggttt cctctacagc catttctgga    116100
     atgtctgggg agtcaaaaat attgaagaga ccttatttcc tgattccggc aggggcatta    116160
     aaaatggaag agacaacaaa caaacacaca agcggtctcc gacttggcga aaaagcaagt    116220
     cttaaggacg agatacagag aaggtttatg gagaagaagt gggtatgggt tccgagcaat    116280
     aaggaggcct accgaagcgg gtttgtggtg aaggaggagg gagataacct tgaggttgat    116340
     tgcgaagggg ttgttatcaa atgcaaaagc tgtgagatat ttaggatgaa tcctccgaag    116400
     ttcgacatga tagatgacct tgcagagctg agttatctca acgagcccgg ggtcctgcac    116460
     aatttgaaga gaagatatca gaacggacgg atatatacat actcgggact gtttcttctt    116520
     gcaatcaacc catacaagaa cctccggata tatggagaga aggatgcaag gaaatacact    116580
     cttagcaaga agtatgagct ggagccgcat atcttcgcgg ttgcaaatga agcatataag    116640
     tcgatggttt caagcaggga aaaccaatcg atcttgatta caggggaatc tggggcaggg    116700
     aagacagaaa acacaaagag agtggtggag tttcttgcga tggtgggagg aagcaaggat    116760
     gcagaagtaa gcattgacag gaagataata gatgcaaacc ccattctgga agcgtttgga    116820
     aatgcacaga cggtgaagaa cgacaattcc agtagatttg gaaagtttat aaagatcaaa    116880
     ttcaacggag gaaacatatg tggagcacat attgagaagt atctgttgga gaagtctagg    116940
     gtgaccaacc agaacagaaa cgagaggaac taccacatat tctaccagct tcttgggagt    117000
     gaggaccagg gactcaagaa gcagctgttt ctgtcggggg agccaaagga ctataggttc    117060
     ctccgaggtt ccaaattcag gatccctggg gtggatgatg cagaggagtt caagaggctt    117120
     agagagtcga tggacatttt ggggattagc aggggtgagc agaatgggta ctttgggatt    117180
     gtgtctgcgg tcctgcatct tggaaacatc gagtttcgag aaaaggacgg ggcagccgag    117240
     atagccaatc ttgatgttgc agaaaaggtc tgcaagctcc tcaacattcc tcttacagag    117300
     tttatcaagg gtcttatcca tccaatgatc agggctggga atgagtatgt tgcacaaagc    117360
     aggagcaagg aacaagctct taagattgtg gaagggcttg caaggattct gtatgacaag    117420
     atgtttgaca gcgtgatagg aagaatcaac atgtctctca gctctccaca caaaggcaac    117480
     tttattgggg ttcttgacat agcagggttt gagatcttcg agaagaattc atttgagcaa    117540
     ctctgcataa actacacaaa cgagaagtta cagcagtttt ttaatcacca catgtttatt    117600
     ttggagcagg aggtgtaccg gaaggagaat attgattggg actttattga ctttgggctg    117660
     gatctgcaac cgacgatcga cctgatagag aagaacaatc caattgggat tctgagctat    117720
     ctggacgagg agtgtgtgat gccgatggca acggagaaga catttcttgg gaagctgatg    117780
     aaaaacatcc gggatgagaa gttcgaggtt gaccgaatcc gagatgtttt tattctaaac    117840
     cattatgcag gagatgtgga gtacacagtt gaggattggc tttcaaagaa caaggactcg    117900
     cattctgagg cgctgacatc gttaatccgc atgtcgagtg atgagactgt ttctaagcta    117960
     agcctggagg aggagatgat caagaaaggg tttttccgaa cggtttcgca gaagcataag    118020
     gagcagctcg catccttgat gtctgagctt cgtgggacaa acccacactt tgtgcggtgc    118080
     ataattccga accttgagaa aagcggagag agtttagaca atggagtagt tctagggcaa    118140
     ctgaagtgta acggagttct tgaggggata agaatcagca gacagggatt tccgtctcgg    118200
     atggggtatc tggagtttgt gcggagatat aagataatgg taaaagagga ggttctggat    118260
     ggggagctct ggggggatgg ggtttgtatg gagctctgca aggaaggaac aggaaagatt    118320
     ttatcagaga ttggaattgg gggaagccaa tacaggatgg gacgtacgaa ggtgtttttt    118380
     agacaagggg ttcttgcaga catcgaggac atgagggatg gaaagatctc tgagattgtc    118440
     aaagaggttc aggctcttat tagaagaaga cttgcattcc ggaaatacaa tctgacacaa    118500
     aggaggatgc aggggattct tgtgattcaa aggaatggaa ggatatgcaa tgagctgcag    118560
     cgatggaact ggtggagatt gtatcagaag atcaaaccct tgctggatgt ccggaagaag    118620
     gataatgaga tgagggagaa ggatgcgatg attcaggaat acattcgaat gcttgatgct    118680
     gagaagagca ggagggagga gtctgaagag atgatgaaga tgataagtct gaagaaggat    118740
     ctattggaga agactgttga ggatgagaag aggttttcta tggagaagga cgaactgctg    118800
     atggccttaa gatacaaggt ggattcgatg gggcaagaac ttgagaaggc acggaaggaa    118860
     gctgatgaag ctcatgagga gaaaaaggta tgctcggaac gtctagctga gatgggcaag    118920
     acattggaag ggagagaagc agaaatatgt gatctccgaa aggagatgga agaacagaag    118980
     aatactcttt tattacagga gagagacatc tgtacactgc gtgaggagat agtaagcaag    119040
     ctgagcgaga aggatgcaat ggtggagaag atgcttcgag agagggataa ggaggtaatg    119100
     atgctgaagg aaaagatcaa ggagaaggac cttgatggag agaagaaggc tgagaagatc    119160
     aaaaggcttg agttgtctga agaagaaaga aggagagagc tgaagaaaaa ggagcaggag    119220
     atgaacgagc tccgaactaa ttggttgagc atgaagaaat ggaaggagga gtgtgtagag    119280
     ctaagggcag actatgaggc gatgcagaag aagttaaaag acgaagcaga agatgcattg    119340
     cttgaaaacg accgcctcca gaacgagatt cgaaagatga ggaaggagat ggaggagcag    119400
     gaacttatgc ggaagaagct tctggacgat ctggagtttg agaggagtag ggggcagaag    119460
     cttgaaggag catttcaaga gctcaggaga gaacacgaga ttgtagagga gcagcttcag    119520
     aaggaaaagc agctgaagga ttcaacacaa gagtcgttag tggagaggat aaagggcctt    119580
     gagaggaaaa ccaagagcct tagtgagaag ttgaagagtg aagagcttgc aaacaagcag    119640
     cttatgaatg agaaagacga catgcacaga gagatccatg ttttgcagca gtcgaaactg    119700
     gacgagattt tcgacaggga ggcagcattc aacagtgcca aaaagaatct tcagatggag    119760
     atccaaaggc tggaaatgga gaaccaaaag ctgaatacgg agattatgga atcgaagtgt    119820
     atgggggagg ctagtgagga gagtgtttcg gcaatggaaa agttttatgt gattcttgag    119880
     gaggagagga agaagagaaa agagattgag caccaggtat ctgagcagga aaacaagaac    119940
     gtcatattga gcagcgaagt ggaaatgcta aaggagatgg ttgagataga aagaagaagc    120000
     aaagaagaaa tgatgagggg gcaagagaaa gagacaggac tgcgaagggc gatttctggg    120060
     gtgcggaaag agattgagga tgttgaaaat gaaatgaaca tgattgtcag tgggttcaat    120120
     gagctgtatt tctctgttct taacaaatac aaaggggatc ttaaggaatg taaagagagt    120180
     ttggaattga agaatcatac tattgaggag ctgaatgata ggattttgga tctgagctcg    120240
     cttgccgaag gaaggagagc ggtggaagaa gaaacgagtg gaaggatgga agaaatgagc    120300
     aagcagtaca gcaagatggc caatgacttc tcatcgctga gtgccaaatg taattctctt    120360
     gagatatctc tatctgagaa ggaggaggag atcaagagat atgaagagaa gtgcagtgaa    120420
     tatgacaatc tggtcagaga tttgggatgc cgaattgacg aggagattaa gaatctccac    120480
     aggagtgatg aggagagaag aggatatatt agaaagctcg aagatgattt gaacggaagt    120540
     atggcaggaa taaggaagct ggaggagaag tatagggcac gaatggagga aagtgtacag    120600
     tatgtccttg atggggagaa gaggaagctt aaggctctag aggagttaca cgggcagcta    120660
     gcaaagagat ttgatgatct acaaggggaa catcggattc ttttggacga aaagatgaag    120720
     gactcgttga ggattgagca gcttgaggga gagctctgtg ctctccggaa ggcggagaca    120780
     caaaggcaag acatgatttt gatgtatgaa tccgagattt ctggattgaa gcggtgtgca    120840
     aggttccaag acgagatcca aacatcgttt gggggagaaa gaagccctgc agttgtgcat    120900
     gtctgtgata aagagaagta tcaagcgctg gatcgtaaga gggcagttat tgagaatgag    120960
     ttgttaaggg caaacaacga taaggagtcc cagattgcag ccaataagaa gcttcgggag    121020
     gaggtagaaa gactccgagg agagattgag gggagcagga gcaaggcatt ggaaatgaag    121080
     aagaagttgg ggcatcagat gctaacggcg aaccgtctca gcagggaact tgaagaagag    121140
     aaggagatgg taaggtttct gaggactctt ggaggaggga ggaagaagaa agcctgagtg    121200
     tgaatttgca ggatgttagg atgaaaaacc ttttttagtt atgtttgaaa attttatgcc    121260
     cttgtctcat ggcgaagagg aagaaccata ccaatcataa tcagaacaga aaggatcacc    121320
     gaaacgggat taagaagcct aggatgccga acttctctga gttcttaggc cttcatccag    121380
     caaccttaat gagaatggaa gaggcaacca aactatggaa tgcatctatc tcaagaaaat    121440
     aaacgttctt tttgagtcta tgtttgttat gtatatggat ttatggaagg cccctggaat    121500
     ggtgctaata gttgatacat ttgaagttcc gtctctactg atatcccaga agctcttccg    121560
     gtcttcgtct gttgtggaga tagaggaggt gacgaaagag acgatagatg aggttttaac    121620
     ggcggacggg gtatatagta ttcataagga atgctttgac tacgaaagga tcagatggat    121680
     gaaatactac ttcaatgagg ttgtcgaggt gtttgcaaat gtccaataca ttaacaaaag    121740
     caagaaggtt gttaggtact actcgatagt cagggatgca gaaggagttg ccacagatct    121800
     ggttgagatc aaagaagacg aagaaaaaga ggcatatgac aagacggcgt ttctcccaca    121860
     tgttcaagca caagaagagg aaattgttat tttcccggat gatgaagact gatgtgggcc    121920
     acggccctgc tcctagagga attataagaa aatttttaag ataaagccct aagaagatga    121980
     cacttgactt agcatttccc acaagagaaa aggttgcatc aacctacaag aaggaccggt    122040
     tgtacaggga aggcaacggg ttttttatgt atgtgaggtg tggaggatgc agacacacta    122100
     cgtgctgcta ctcgcactcg cagacgaaca tctcctgtcc agggtgcgga gatataatcc    122160
     tgacgtcctc aggggggagg gcgattgtgt cacccaactg tgagttcaag aggatcataa    122220
     gaagtattga ttaaagattt tagttctact cttctatcat ttggcagcct tggagagtca    122280
     aagttgaaaa tttttcaagc cctgatggac attggacaga cacatctcgg cgggttgata    122340
     tctaattccc agcaagacga gaaagtaagg tatcatgttg tcggatcaag ggtcaagatg    122400
     gcatgcaatg tcataaggag cctatatggg ggatcccatc ggacaaagct tatagtgaac    122460
     ggatatggac aggtaatcct ttcttcccag ccaggagtca tttatgataa catcaagata    122520
     aaccatcctc ttgtgaagct actgcaggat tatgtcaaga aaatggatgt ggttggagat    122580
     ggagcaacgt tttttgtgac tcttgtgtcg gagctgatcc aggaggcgat ggatgttgtt    122640
     ggaaaaggaa tgaagggggc atatcttggc tacatgcttc gggaagtcca taaggagata    122700
     gaagagttag cctctgaact tcggattaag cacgaggttg actttgagga ccgggagagc    122760
     atatcaaagg ttctgaaggg ggttttgaag gattctgtac tggagaaaat agttgtcgag    122820
     gggatatcgc tttgcagaag cttcagcaca gaaaacatcc gggtgtgcaa ggtggtgtgt    122880
     gggtctacag aagatagcta tgttgtgcag ggaatggtgt tcaacaggtc tccggaagga    122940
     gaagtaaagc atgtgaccaa aggaaaaaca tctatctaca actgcccgtt ggatatatcg    123000
     agaacagagc tgaaggggac ggttctgatg aggacggcat ctgagctctt gtcctttagt    123060
     aaagaggaaa acaagaggat caaggagaca gtggagtcta tgaatggaga tgttgtaata    123120
     tgcagtggga aggttgataa gatctacctc gactttctga acaagaaaaa gaagcttgtt    123180
     ttccgaatca ccagcaagta tgatttgaga agaattagag aactggtagg aggacacatt    123240
     ctggcggctt tagatccgca gacggaagat tcgatggggt ttgttgaaga ggtggaaacc    123300
     tttaaggaag gcaactccga gtataccaaa tttatctcgg gaagcaagaa ggtgtatacc    123360
     ttggttctaa agaattctgt gcaggcagtg ctggatgagc aagaaaggat ggtccaaaaa    123420
     gcattgaacg tcctgagtaa gaattccaag gaaggaaaga ttgacctagt ggatggggct    123480
     gggagatttg agaaaaagtt atcgaagata tttctagaga gatccatggg ttgtaaagag    123540
     ggcaagaatc ttgtgtacaa gtgtattgga aaagcccttg ggacattcaa gacctccgat    123600
     gctgaagtct acgatgcata caatgccaag gtaaaggcat taaagtactc aatcgagttc    123660
     atctccactc tatttgagac tggagactat ctcataggaa agccagaagc aatcaatatt    123720
     gcacccaaga gtaaccagca ttgggatgaa gaccactagg gagagtcttt gaattctgcc    123780
     attggtaata gctatgatta aatctaactt ttaaacgaag gacaattaaa gaaaattcat    123840
     tggggaaata tttcctctgg gctttccatc tcttttgagg gataagaatc ctaactgtag    123900
     agattctata tttctgctaa aaatcggagt ataaaatata gcacaagaga tgggtttaag    123960
     gttggaatgc cgattcgctc aagattcacc aaggacgaga aaaaggttat gaagttcatt    124020
     gattcgaccg aagagataat aaagcatatg aacaagtccg actcaaacaa gaggtcaagg    124080
     ttaaagttga gtggggagca gattgatatc ctggagtcga acttcaagat cgacagccat    124140
     ccgaacagta ccaccaaaag cctcctggca aatgccctga gcataccgtt taagaacatc    124200
     cagatatggt tccagaatag aagggccaag gagaagatgg tgagagatag ctccaagaga    124260
     aggaatggaa atacgatagc tgaggaaagg gaccaggagc ggggtacggt aaactaccag    124320
     acaatgtgcc ccttcgactt tcctcctcag gagaggtact ttctttagcc catggaacat    124380
     ctgcactatt gtaatttaat tgttgcttcg gtgccattta aaaggatagt tagcacccag    124440
     gtagcaaaat tttgtatcct tgttccagcg gccgagaact actctcaaaa cgaattctat    124500
     ttaaatttac cgaaggaatg ccctgctttt tgagtcgctc atctccagat ggagaatgag    124560
     tgctatacaa agcaaaacca agtccatgtg cttctgatcg atgaaacaca tgtctacatt    124620
     ttggtgtaat ctttttttgt tcgtactact gaaaagtatc tttagccaca gacccttaag    124680
     atgttgattc tggccaacac caacagggag atgagctttg aagtttcccg cgtcaacgga    124740
     agagtttttc ttgcggggag tctggaggga atagagtaca aggggtctga atggaattct    124800
     ccttgcaact attatgtggt tgagtcttcg gaagggatat ttgagctgaa caaggccatg    124860
     gaagccaaag taattgtgtt tgagacaatc tatgagacag gactacttca tgagaagacg    124920
     tctttcgaaa agctagcctc cacttttggg aacaggaagt ttgccgagca ttataagaga    124980
     aaggggattg aaggatactc caagagattc ttcacgtcga aatttcagta cagagaacaa    125040
     gtactgcctc ctattgataa agagaaatgg aatcctgaag agagatttcc gttggaaaaa    125100
     atgtttcccc aggacgtgct ttccagcttt ttggagataa agctagacac agtgctgcta    125160
     catccagatc ttatgagttt gaagcaggat gtaaactaca aaatacactt tttgcttgcc    125220
     gactgtataa tcaagcttat ggagaagaag tatgtcacca gcgattgcct gaacgattcc    125280
     ggatactcga gttttttcga gatgatcaag gatgaggtgg aaaacagaat gctgactcct    125340
     ttgtgcagag ataagctagc cattctctgt tacatattgt ttctacaaat cgagggatct    125400
     tctgtgaggt acgaagtctt gccggacttt aagttttcca aagagaaagt cttggctatg    125460
     tttagggtga taggatgctc gtatattgcg aaattagaca gtttcaagat gaaggagaaa    125520
     cagatgcacc catcagatac tagaaattag ccttgaactt agaagactta agatctggag    125580
     ccagacacaa tataggaaat gttcggggct ctactattca gaggcatacc gttgatcacg    125640
     tgtccccgtg cattcaaggg ctgaatttgg tggggatatg gttaatcatt aaaagccata    125700
     tctaaacgtt ctgtagatat taattttttt ttgtcacttt ctgatgaaat agagcttgct    125760
     agggagataa tgaaggcttt ggtgaagtga agcatttaca ttttccagtt accttatcta    125820
     tctcttatct cggattcttt gtttatactt gtggaatctg tttacttaaa atcctaatcc    125880
     atttcccgat gagcatggtc tattaagtga tttggtactg tatcgagacc tccaggcacg    125940
     gaagatcggg aatctttgca ggatcccgag ctaacttcat ggaatgggct gaaatgtcgc    126000
     gtgatccata tccctaagga atgaaaagcg tagactttga aatgaagctt gtagaaaggt    126060
     atgggactgg agtgattcca aaggaagaca tcgaaagtgt gttgaacgag gcgatcgaga    126120
     acaacgtcat agagaaggat gaggtgggga gatgggaaaa ggatgaagag tacacagtat    126180
     cgagatttct caggacgata agaaaatgga gaacagactt cttgaaggac tcattcagca    126240
     taaatgacat ttcctgtaag gacgagggtc gttgcggaga caggtacttg gatgaaggag    126300
     agttcaaagg attggagtgc catgaagaac caaacgtcaa tgattcgttt gtgacaaccg    126360
     atgaagcatt tctctcctct cttcgggaca agaccaagat aattacatcg cgaagaaaca    126420
     acaatgggaa gaagattgtg agggaagtcc tgagggcatg gggggaatac gaaaagcttc    126480
     cgacaaaaaa gaagagctac ggatggtatt ttcttgtact gctggttgtt cctgtgtact    126540
     tcttgtatgt acaaaagcca ttttgatctg tattaaaact ctattttccg aggcttaccc    126600
     atgtacaatg ttatcatacc aacatacaat gaaagagaga atatctgcgt tctgttgcga    126660
     atggtttccg atgtgctgag agaagaggga aaggctttca agataattgt tgtggatgat    126720
     agtagtcccg atgggacaca tgaagcagta gaatcgctgg ggcttccaaa tgtgtgtctt    126780
     ttattgcgga agaagaagct tgggcttgga agtgcatata gagcagcact ggaacattgt    126840
     gagcatccct ttacagttgt aatggatgga gatctgtcac atgatcctat gtacatcaag    126900
     gatatgatca ggttgcaaaa aaagggagcg gatatagttg tcggaagcag atattccaaa    126960
     gaaggggggg tgtatggttg gtcaatcaag aggaagatca taagtcttgg ggccaacaac    127020
     cttgcccgga cactcctcaa catggatgtg tcggacctca cagggagttt tcgattgtac    127080
     aaaacagagg tgttcaagtt gctggttaag gagtctgtat ccacgggcta ttcgttccag    127140
     atggaactga tgttcctagc gaaaaggcac aatcttacta ttgccgagtg cccaatagtt    127200
     ttccacgata gaaggaaagg acaatccaaa ctgtctgcaa tggagatggt gatgtacttt    127260
     aaaacagtgg tctctctgtt tttcagtgtt taattaaatc tgtgaatttg cagaactttg    127320
     gtgtaagtta tcttccattg gatcccttag atgaggatat tgaatgttgc cgagaaacct    127380
     tctgttgcaa gatcgatatc ctcggtctta tcgaaggatc taagtgtcag gagagggctt    127440
     catcagtact gtccaaacat ccagtttgac catggcaatc agatggtctt cacaagtgtt    127500
     ctgggacatg tgctctcgag cgactttgag aacaagagcc ggtgggatga agtagatcca    127560
     gagacactgt ttacagaaag gattgtcaag tatgtacagc cggagtttat aaaggttaag    127620
     gaaaatatag aaagagaggc gttgaaatgc gacatggttg tgatttggac tgactgtgat    127680
     agagaagggg aaaacattgg aaggcagata agagacattg tccttggggt gaagaaggtt    127740
     gaagtgaagc gggcaagatt ttctgggatc actctccggg acatagaggg agcattggga    127800
     aacctagggg aaataaacga agcagaggca gaggcggtcg aagtacgcat ggaattggat    127860
     cttagaatag gatcggcgtt tactaggctg cagaccttgt cactgggcag gacgatacag    127920
     gagaaaaggg tactaagctt tgggccgtgc caggtaccta cattgggatt tgtggttgag    127980
     agggcaaggg aaagggagag ctttgtccct gagatgttct ggactctaat gtttaagact    128040
     aaaagtaaga aacttggaga tgaatttacg tggagaagag gatctgtctt tgataagaac    128100
     tgtgttatat gtttccatag aagcttgtct ggagaaagtg ctaggatagt gttaaaagaa    128160
     gtgagagaaa gaaccaaata caagccgctt cctcttagaa ctgttgagct tcagaagaaa    128220
     tgttcatcgt acttcaagct aagtggacac aaggtgatgg agattgcaga ggggctgtac    128280
     aacaaaggat atataagcta tcccaggaca gagacagatg cattcgatag gaagtttgac    128340
     ttcaagtaca tattgggtaa gttatgtaag gattcgaagg taggtgagca tgctgagaag    128400
     ttgattgggg ggtttgatta tccgcggaat ggaagaaaca atgacatggc acattctcca    128460
     atatatccac taaaagaagg gacaggactt tcaggaaagg atagagatat ctatgacttt    128520
     atttgtagaa ggtttcttgg atgtatatca aaggatgcca agggccttga gacacggtat    128580
     gaactgaaga ttggatctga gatgtttgat ctgaagggga taagggtggt cgaaaagaac    128640
     tatctggagg tgtattacta tgataagtgg gatgataaag aagtcagtga ctttcagatg    128700
     ggagagatgg tttcggggga tctttgtatc tcggagggca agacaacacc tccaaactat    128760
     cttaccgagg ccgaactgat aagcctgatg gataagaatg gaataggaac agatgcaacg    128820
     atacatgagc atattcaaaa gattcaagag agaggatatg caatcaaggt tggagaagaa    128880
     ataaggcctc tggagcttgg ggcagctctt attggaggat atgaaaggtt tggattgaat    128940
     gttggcaagc ctgagcttcg gaagagccta gaaggtaatc tcaagaagat atcggagggc    129000
     cggatgagtg gaagagaagt agtgaaggag ggaattatag cctatagaga catatatgcc    129060
     ctccttaaaa gaaatatcga ggaatttgtc tgtattctta gacagggtat tgaaaatgat    129120
     acaaagcggc tgggagtgga gaagagaaaa aaggcggaaa gggcagaaca aggaaagaca    129180
     aaagcagagg gtttcaaggg tctcaaccca aagaaagctc tgaacaaaga aggagaaaag    129240
     aaaagagtgg aatgtgattg taaagacgaa gccaaggtgc tgaaggtaaa gaagggagac    129300
     aatactggaa aggagttcta ttgttgtgga aagacagcaa aaagatgtta ttttttccag    129360
     tggtgtgaca aggaggaaac caagagagac gaggagctga aatgcttctg cgggtttgag    129420
     ccccaattgc ttgtagcaaa cacagaaaac aataaaggaa ggaagttctt caagtgcaag    129480
     aaagcataca agccatgtaa gttcttccaa tgggaggaat gaaggagatc tcctttaaga    129540
     ggggaagtcc ccttttaagg tttgattcaa ggaacaggtt ctccttttaa aatataaaat    129600
     ctctcttttg gaagatggga atggttgaag agagcagtgt ggcagaacca gttccacagg    129660
     caaagcctca acaagaaata gagagaaaag ggtcttttcc agagaatgaa gtatccaagg    129720
     acatgccggt ggtcaagttg aaggacatta tgatgtatgc agaaaacatg gaagggatgg    129780
     aaaacaagaa gttgattccc tatgtagtct acttggacga gcagttcaag gaaattgtcc    129840
     agagaaggag aaaggatgca aaggtagttc ttatactcta cataactatt atgtctatct    129900
     ttgttattgg gctaattgta tgtggagtaa agctctttgg gtatttgatg ggatgggagt    129960
     gagtttgagt tttgaggatt ctctggtatc caaatatggt attaaatgga tttatgttga    130020
     gttgtttgtt agaaggtagc cctgatgtat gttgcaggag ataccattac ggctgttatt    130080
     gatataggca gtgaaacagc caagattgga tattcggata cgctcttacc gatgatattc    130140
     tgtcctagca tatcatggaa gaacgagtac atatccccgg tgactaggtc ggttgtaagc    130200
     gatgtgggat cgtatcttag gattctatgc gacaatgcgc cacgggatgc acaatcactg    130260
     gtgatttcag agaacacgat ggaagcagga ggaacaaaga gggagattct ggggtatctt    130320
     atggagagac gaatgtgtga atcagtgttg tttgtcagga gtggaatcct ggatgccttt    130380
     tcatatggaa aaacaacagg agtggttgtt agtcttggag gaggatcgag ccaagtttgt    130440
     agtgttgttg atgggctcat cacttgccgg agacggctgg atgttggggg gaacgacctg    130500
     acacaggact ttagaagagg gatggaagaa tgcgggattg atttaaggaa gtttattggt    130560
     gtgaatgatg gtggatcttg gtgtgaaagg aagattgagt ttgagaaaaa cgaattttgc    130620
     cgatatgtta aagaagcagt tctgagtttt cggagcgagg aaacagacag aagatatgag    130680
     tttccgaatg gagagacggt tgagatggag gactggtgta acagaatttc aaaaaggctg    130740
     aaggaggttg taaagctgat tgttgaggtt actgaattga atgcaatgga agtgaggtct    130800
     acgctgagca gtaacatatt ggttggggga ggatgcggag aaataagagg aatggagagt    130860
     tttatttgcg aagagcttgg gaaggagcgg ccgcgatgga aagtgaaggt gaacgttgaa    130920
     aggagccggt ttagtacgtt tgaagggggt tctgtgattg gatctatggg gagtgcaaaa    130980
     agcttccaca ttggaatcaa ggactatgaa gagtacggag aaggaattct agacagaaag    131040
     aaatgcgaat ggattgtgga gactgtatga tttgaatgaa taaagcatga gctatctagg    131100
     gttttaacct ctgtttttag actctaaaaa atataaaaac tttttcatcc agggccccta    131160
     caatggctac aaagattgag aacgatgtca aaccacgttt gaatgtttgt tttatcggac    131220
     acgtagactc tggaaagagc actacggtgg gaatgcttgc ctatcagtta ggagcggttg    131280
     acaagagaga aatggagaag tatgagaagg aggcagctct caacaacaag gagtcgttct    131340
     atcttgcata cttaaccgac aagaccgagg cagaaagaaa gagaggaatt acaatcacaa    131400
     ccactcttat tgctctctct acagagaagt tcgatatcaa cgttcttgat tgccccgggc    131460
     acaaggactt tgtgaagaac atggtggcag gagcatcgca ggcagatgtg gcagtagtga    131520
     ttgttccagc atctggattt gagtcctgtg ttggggttgg agggatgttg aagacacaca    131580
     ttatgatttc agggattctc ggatgcgaga agctgattat atgtgtcaac aagatggacg    131640
     agattgccga ggacaagagg aggatggaga agttcaagga ggtatctgat gagatgcgta    131700
     gaattgtcaa gaggtgccac agagattcaa accctattgt cctgcctata tctgcgtaca    131760
     agggaatcaa cctgacgaag aagggagaac acttcaactg gttcagtgga tggaaagaga    131820
     aggaaggatc ggaggtgata cacactcttg aggaggctct ggattaccag aaggtacctg    131880
     agagacacaa cgacaagcct ttaagaatgc cgatcaccaa agtttgctct attgcaggaa    131940
     ttggtaagat tttcacaggg cgtgtggagt acggaaccat cacaccaaat cttaagatta    132000
     caattcagcc ggcaggagtg gtgggagaga ccaggtctgt ggagatccac aacaagccaa    132060
     ggcccatgat tccatgtgga gagaactgtg gagttgctct caagggagga gttgttgggg    132120
     aaatcgacaa agtggatgca ggacacgtga tttcggccaa cgatgagaac aaggccatag    132180
     catatcctgg ggcaaagatc agaacaattg ttgttgccag gccaaaggga ttgtcggtag    132240
     gatatactcc acagatcaac tttggaaact gccactctcc aggaaggatt gccaagatta    132300
     tttcaagagt agttggtgga aaggaagtac aggagaacct tgaaaacatt ggaaatggac    132360
     agacgtttat tggagttgtt gttttccaga agccgttggt tgtcgatagg atggacaagt    132420
     tccagaacct ggcaaagttt gcacttatgg acagtaacgg ggttgtggga attggaaatg    132480
     tcatggagcc tcttaccaaa gaccagcttc tcaaggagta cgggattgac ataaatgaag    132540
     atcccaaggc agcaaaaaag gcagccggta agaagaaagc ataagtaatc tttcttccaa    132600
     aagaagtatc tttattaaac ttcttttatt aatttcttat attcttttta gtgcttttgt    132660
     aaggaaatgg ttcatctccc gtcggccttt gctaaggaaa gcctccattt caaccttctt    132720
     gcctgtcttc ttaagaagca acgggtcatt ggtaaaacat tcgaactcca taagtctgtc    132780
     aaccatcttc aggtcgtatt tattcaggcc tgcaaggccg tcctgatgga tcctcttgtc    132840
     taggatgtct tctgcacaga cgccaatccg cacaatagtt tcaactcttg tctctggagc    132900
     ctctctactc ccatacttat agacacaaaa gatgtgaata ccaaagggat caaagtcaaa    132960
     gagtcctcca atggctgtct tgtgttctat catcttcaac aatagcatag tgttcttgca    133020
     tggatatcct ctcccacaca caagtagcac accttcaaga tatctttccc tttcaattcc    133080
     agatgctatt ctttgtaata ttgtatcttt ttcaacaacc aaaaccctct cgtaactgca    133140
     gaacacctca actatgccct ccatgtctgg aataagctgt gggttgttcc tacatgagga    133200
     catctctatt atgtctgggc ccttaacaaa agctagcttt ccgataaagg ttcctttgag    133260
     agtatttctt attctaagat cgctttttga aactcgaagc tctgaggcga tggtagatat    133320
     caaccttttg acagcagtct gacttttgaa tatattcaca gccatgtaaa agatttctct    133380
     ttcatttctg gtgattccta gttcttgcat ctccatgatt atctcatgga gccttatcct    133440
     cattacaaga gttctcgact tcagctctgt caggagcttt agtgcattgt gctttagcga    133500
     tgtggatatc tcagaagaaa aggccattct atcgccaaag cataaaccca gaataacgaa    133560
     tccctgggat attgcatgat atataccgca gagatatacg aaagagttag gaagctctta    133620
     ggagatttgt gcatggtgca gaccggggac aatccagtgg catacaaggt gtcaaagtac    133680
     aaatcaaaga agcctgtgta tcttgttgaa ggaaatggag gagaaatgta tctgatgggg    133740
     gatcacgtct tcgagcttga gcgtagtggg tttgatgtag gggtttcaaa ggagaaagag    133800
     gtattggtta tgcttttcaa gttcagcact agaagtctag agggaggcag aagagttgca    133860
     agagaatctc cagaggaagg gcaatttata gaggtggatg taggtccggt gacatgtgat    133920
     ggaagaagaa tgggaaccct gatagcatca agtattccac agggtttatg tgcattgtct    133980
     agtgtgctaa aaagatttat tcggattgat accaacgggt attcagaagg aggatttgaa    134040
     aagttgcttg tgagggttct tagttccaac agggtcctat gaatctgttt attgaagctg    134100
     tatcctgtat ggttggttct tggagatttg cttattagct ggacctatta acttgcttgc    134160
     tctggaaagt ggtttaattc aggctccata gaaaatcagt aacctgaagc ataaataata    134220
     aataaggaat atcaacacga ctagagggaa aataatgctt ctacttctta caattgttgg    134280
     aatagtggtc tgcagggaaa atgcagtgat tctgattctc tgtaggaaca gcgacaagaa    134340
     tggcataaca gaaacgataa agaatttcga agaggtgttc aatagaaact tcggatatcc    134400
     ttatgtattt ctgaacgatg aggagtttac cgaggacttc aagaaagcta taaaggatgt    134460
     tacatctaat agtgttgagt ttggaagact cgagcccgag gagtgggaga ttccaaagtg    134520
     gatagatatg gagaaggcaa aggaggaaat gaagaaaatg gaagacagga aaatcatcta    134580
     tggagggtct ctatcataca ggaagatgtg caggttcttt tctggattct tctacaggaa    134640
     caagcttgtc cagaagtatg actattattg gaggatagag ccagatgtaa agttcctgtg    134700
     ccagatagag tatgatccgt tcacatatct tcgggagaac aacaaacagt atgggtttgt    134760
     gatatccttg gttgagttta tggagacgat tcccagtctg tttggagagg tgataaagtt    134820
     tgcaacacat aacctgaact tgatcaaaaa ggccaatgga aatagattca tactaaacaa    134880
     ggacgggtca tacaacggat gtcatttttg gtccaacttt gaaatagcaa actttggatt    134940
     ctttagaaat gaaacatacc agaagtactt tgattggtta gacaaggctg gggggttttt    135000
     ctacgaaaga tggggtgatg cgcctgtgca cagtattgca gcatctctct tcctggataa    135060
     ggatcagatc cacttcttca gcgacattgg gtatgagcat cctccattcc agcattgtcc    135120
     aagagaggcg tccatgagat cgaaatgcaa gtgcagtatt tcgaactcgt tagacttttc    135180
     tccaaattcg tgtctgggct tgtacataaa gtctcttttg tgaatgaaga atgcctggaa    135240
     gtatattcga taataataaa ttggtacgac ggatattttg gtttattttt gacccgatac    135300
     gagatggatt ctgaaaagga agctttgaag gaaaggaaga aaatggagaa ggaagagaag    135360
     aagaggcaga agctggagaa attcctggca aagaaaacac aagaaatgaa tgtttccaag    135420
     ccaaggaagg agtacaaggg agatggctat gacccgctag ggattgaagg gaagtggtac    135480
     gagttctggg agaacaacga gcttttcaag cctatagagg gaaaagagaa atatgtaatt    135540
     ccgattcctc cgccaaatgt cacaggaaac cttcatatag gacatgcaat gatggtttca    135600
     attcaggata ctttgtgtag atacaagagg atgtgcgggt atgaggtttt gtatattcct    135660
     gggacagacc atgcaggaat agccacacag aatgttgtat tgaagcaatt ggaaagagaa    135720
     ggagttgtct ctgacagaga agggtttctt aagaaggcct gggagtggaa ggataagcat    135780
     ggatcaagaa tatatgagca atttaagaga ttagggacga gtgtagactt cagcagggaa    135840
     agatttaccc tagatccagg gatgaacgaa gctgttgttg atgcgtttgt aaagctctat    135900
     gaaagaggcc ttatatatcg agagctgaaa attgtgaact ggtgtgccaa gctgtcgaca    135960
     accataagtg acttggaggt taatcacgaa gaggtgatgg ccagcacaga tctacaagta    136020
     gatggaggaa agtatgagtt tggggtaatt tatcatttta agtatcccat gacaatagat    136080
     aaggaatttt caggagatta tctttcgcta ccggcaattg aagtggcaac aacaagaccg    136140
     gaaacgattc ttggagacac ggcgatatgt gtgaatggaa aggacgaaag atttggagcc    136200
     agaggaataa aggagacttt tggggatgtt cctgaaggaa gcaagctcta ttgtgtaaat    136260
     ccgttgacca gtgaggtgat tcctgttgtc tttgacgact atgcagatat gagctttgga    136320
     actggagtgg tgaaaataac acctgcacat gatgcaaatg acttcgatgt atcgaggaga    136380
     catggacttc cttgcaagat tgtgtttgat gaagaaaaca gggtaatcat tgagggagag    136440
     ttcaaggggc taaagagatt tgaggcaaga aaagctgtta tttcaaagct tacagacatt    136500
     ggcttgtttg ttggaaagaa ggagtatcct caggtgattc caagatgttc ccgatctaat    136560
     gacattatag agcctattgt caagagtcaa tggtggatgg actgtaagga aatggcaaat    136620
     aaggctattg aggcagttaa agaaggaaga ataagaatac tacctgaagg ggcagaaagg    136680
     cgatggtata aatggcttga gaatatcagg gactggtgtc tatcgaggca actgtggtgg    136740
     gggcatcgaa tacctgcata cagaatgcct tctggaaaat ggtatgttgg aagaagcaag    136800
     gaagaagcat ttttgaagat gaagaatgag tgtcctgagg atggatgtag tattgatgag    136860
     tttgagcagg acgaggatgt tctagacaca tggttttctt cgggcctatg gccgtttgcc    136920
     attctaggat ggcccaaaga gacagaagac cttcaaaagt actatcctag caccttgctt    136980
     gaaacaggca gcgacattct cttcttctgg gtggcgagaa tggtgatgct tggaattgaa    137040
     ctgaccggaa aagagccttt cagccaagtg tttctccatg ggatagtaag agatgcacat    137100
     ggaaggaaga tgagcaaaag ccttgggaat gtcattgacc cgatttttgt gattgatgga    137160
     tgtcctcttt caaagctgat ttcgacaatg agaagcggga atctcgatga gagggagatg    137220
     aagagggcag aagaagtcct acgaaaggat ttcccaaacg gaataccaag gtgcggggca    137280
     gatgctctta gatttacttt actttcctac acctctggaa tgaaggatat caaccttgat    137340
     gtactgaggg tggaaggata tcgaaggttt tgcaacaaaa tatggaatgc tcatagattt    137400
     gtgaaggcag cagtagatga ggccattgaa gaaagcctta gagggtccac ttgtaagaag    137460
     aaatacgaga agtatattct tccggctgat aagctacaga ttcgttctgg agaaggaccc    137520
     gttgaatgga ttcttaaaaa aaggaacgag ttaatagaaa taagccagag aatgattgat    137580
     tcattcaact tcatgggagc cacacaagca atccatcagt tttttattta cgatctgtgt    137640
     gatgtcttca tagaggttgt taagaaaaac aagagcgaaa gatacatagg ggtactatta    137700
     agcgtgttta tcgattcgat gaagatactc catccattta tgccatttat cacagaagag    137760
     gtgttttctg attatttcga tagttctatt tccacttcac catatcctag gacagatggg    137820
     tctaaccatg aaaacaagtt ttctgggaca cttcaaatta taaggcatgt aagggcaaag    137880
     gcagagtcaa agggatggcc tagggttgca gtagggattg ccccaggaga agatgttgac    137940
     cttgcagacc tggagtttgt ccgtctgctt tgcaaaaaaa ttatcgaatt taaggtagta    138000
     gaacattcag aaagctcaga aagccatctg tatgagaagg taggggattc tggagtattt    138060
     gtgagccaag cagattgaca agaacataac tgattaaagt cttttaattt agctttttgg    138120
     cagagtgagt ggaaaccaaa aagtctcttc cccttcggta atattcctgt acatcacgtg    138180
     ggcagctgag aacccacttg tccagagaca cacgtatttc cccaaagaca cttcgcattg    138240
     atggattatt gaagtattgc tgcctcacca tggcaatgaa agttgtaaag gtcacgaggc    138300
     tcgactttct gaggaatatc attaggaagg agagaggaac agcaagaacc tctgtaaaca    138360
     atgctagtct ccccagggtg acatggtatg ccgacaagga gacacagatg ggatatatag    138420
     atgttctttc gaaagtcttc ttgttggaca gaacaaatga gctgagatga tatatcgaca    138480
     gaaggtaaaa cgggagaaga agagcctcat ggggaaacgt gaagaacact gtgatgcagt    138540
     aaatgtttgg ctgtgacagg atttccttca tggatgagag atgtggaagt aaggaaattg    138600
     agtatgacga tatcaagcac agaatgttta cgaagtttgg cagtggatat ataggaattc    138660
     tgatcagatg aagcacaatg tatagtgtgt agtttaccgc aaacaaagta ttcagtaaca    138720
     tccatgtctt cttagtagaa tttatctcta gcatttttct tagaagggct aagggatcaa    138780
     gtggtattta gagaacgaag tttggggtgt ttcatgtagt gtgccaaata acaaaatgct    138840
     gaatagtgat atttgaaacg tccataaaga cataaaggca ggcgagaaag aaaatctcgg    138900
     gaatgataac tatcaaagag gccttgaacc aagctataga tgaagagatg gaaatggata    138960
     agagagtgtt tgttcttggg gaggaggtgg gcatatctgg aggaaacaaa ggagtcacta    139020
     gaggtctata cgagaagtat ggaaagtgga gagttcttga tacacccatc agtgaaatgg    139080
     gattcacagg cctgggtgtg gggcatccta tctaggccta aggccgataa ttgagtttat    139140
     gacatggaac tttgcattgc agtctattga ccatataatc aactcgtgtg ccaagacact    139200
     gtacatgtct ggggggaaag ttagttgccc tattgtattt agagggccta atggattcaa    139260
     tcctggatat gcagctcaac acacacaaga cttctgcagc tactatggtg cagtccccgg    139320
     tcttaaggtt gtcgctccct tcacagcaaa ggatcataaa ggattactga aatcggcgat    139380
     ccgagataac aatccagtgg tatttttgga aaatgagacg ctttacgatg atacatataa    139440
     ggacatagaa cagggataca tgcaatcact agataaagct gtgatcgaag tagaagggtg    139500
     cgacgtcact cttgtaggaa tttcactttc agtaaagaca tgtctggagg ctgctaaggc    139560
     actgaaagat ctagggattt cttgtgaagt tatcaacctc gtgtcgatca agcccataga    139620
     taaacaaaca ttattgacct ctgccaagaa gacaaagcat gtgtttgtaa ttgattttgc    139680
     atggccatcg ttcagtgttg cttccgagat ttctgcaata atacacgaga actgctttaa    139740
     agatttgatg gcttctgttc aaagaataaa cgcaaaagac attcctactc cctactcaga    139800
     gaaaatagaa gcaatggcgt ttccaacatg tacagatgtc attgattcgg tggttgaagt    139860
     ctataaaagc acctccaaag ataataaatt aggtctttaa tttctactct aaagaagttc    139920
     ttcaaactca actaatccac tgtttttatc gttaacagca aatgtgtcgt catttatttc    139980
     tccatcctcc ttcaatatct taatttcttt tggcatatac ttcctgtcaa tatctgccct    140040
     cttctcatcc ccgtctctaa cacgtagtaa aactatgtcg cctggaatca ttcgaacacg    140100
     tctgtagtct cttccacgaa cctttgcagt cctgtaaact ccgtcagaac aacttacctt    140160
     aaactgtcct tggccaaggg gacatattat ttgcccatac acagtcccct cttcttctgc    140220
     aaataccaaa gctctgtcgt tcgtaaatct tcctttcctt cctttcatcc acccctagat    140280
     ctccgccaat tttatcacaa ccaatcttgt aaagaaaatt caaaagtcaa cattaggggc    140340
     catgagtttt aattatccct tttgaagcca tgtatgcagc taggctccta ctcgcaattc    140400
     ccctatggct tatcctgttt ttctcgtcag ttggcatatt ttttaggaca ccattaaatc    140460
     catcgggaat gaaaatatac ccaaattctg ttttgcaatc tttctctggc tctgtgatag    140520
     agcccttcag tttccctgaa aacaccttct tgactatttc tccattttca taatgggcaa    140580
     ttcccaagct acagactgct gtggcgcttt tattccctat cttctctaca atctcccaaa    140640
     tcttccgggt gcctatttcg agaaaatcct tcacatagac accgggaaat cctcctaagg    140700
     cttcaagaga aaacgaagtg tcgtcaacta tcactgcatc ctttgggttt ataaagggcg    140760
     ccgcttgatc cagtttgtgt tctacaatct tttctgaagg cccttggatt tcggtcattg    140820
     aaattctcat gtgatctatg tctgtcttga ggaactcttt aacctcattt agttttttca    140880
     aattggttgt tgcaaaataa attttccccg tggtcattcc taagggtatc agttcgttaa    140940
     taattcactc cttcctgtat ttttcgatcc ctcatgccgt tctttcaaaa gacaggtgaa    141000
     tgtgaatatg aattagcacg gagtaatttc acaaggagct atccggataa gcctaagtct    141060
     attaaaacaa ttggtaataa tctatttatg gaaacaaact aattttttaa atcgtaaaat    141120
     agtttgccct aaatgaaagg aggcttgagt gttacatcgg caatagtaac aatggtaaca    141180
     tcgatgatgg gtactggaat caactacatg ccatatgcat ttaaaagtgt tggatacatc    141240
     agggggattc ttctgataaa tggagtggga attctaacgt ttttctctct atatgcgatc    141300
     tcaattgcag caaatagatc caaggagcaa aacccaacct attcctcatt atcaacacac    141360
     atctcgaagg cacttaagat cttagtggat atgtctattt tcagttcgtg ttttggagtg    141420
     aatattgtgt tctacagata tcttgcggag ctcatcacga tcatggttcc aataggcaag    141480
     tatgtggatc cagaaatagg gagaaagata gttattggag ctctttcaat tccatttctg    141540
     cttctatcat tacaaaagaa tctttcgaac ctcaaagtga catcctatat tacggtggct    141600
     tctgtaagct atcttgcagt actgatgggg atttactgtc tttttattgg aggaaaaagt    141660
     gctgaagagc caatgcagag gtttggaagc aacttttcag gtgggatttc ctgctttatg    141720
     tttgcattgt cctgccaagc aaatatggtc aagacataca ccgagatgga gcataagtct    141780
     ccaagcaaca taatcaaagt cgcaatggga gcttcgttga taggaactct tatttatgga    141840
     agtgttgggc tttgtggata tgctgtgttt ggggacacca tcaaaggttc gataattgat    141900
     atactgataa gcccagaaag cagtatcaac ttatatctca tgagaaacac catcgacaag    141960
     tacgcactat cttcaaagat ggcttgcatc ggggcgatgc tggttctgtt tggggcattc    142020
     ccggttcaga tgaacccgtt ggttggaata ccccttagct acttcgctcg ggaagggagc    142080
     aacgaagatg cagtaaggag aaaggtagtc tccgtgctta tgattttatt cttatcgttg    142140
     tctcttctgg aagatcttaa cattgacact attcttcaga tggtaggcgc cacagcagtt    142200
     aacctggtgt cttttaccta tcccttcatc tattacctat atttcagaag caaagtggac    142260
     ttcatgtctg gcttggcttt gtttggaata attggtagta tagcatctat gatctacatg    142320
     tcatacaaca taatgttatc ataatagttc ttagttggga aatctctagg gaaatttaat    142380
     tagttcaaaa actctttcta gaaagttgaa gattttaatt aaagcatctg ttgagttcaa    142440
     attgttatga gttactctag tctcttcaac aactcaaaga ccctttcctg cacatccttg    142500
     ttacaaaaaa gaggtgttct atggcacgca tcgttcatat caatgcatat ccacctgttg    142560
     ataaatgcag taggatctct ctcaaattca tttagcaccc tctctctttc ttcacacctc    142620
     ttcagcagct gcctaagaga ttcaattttt ctgtcaagcg catggatttt tttggtataa    142680
     agcgtaggat attggtgtag gtcatcccat tcaaatggaa tatcaaatat ctcggtgtac    142740
     tcatcgaccg gggggatatc aactatcagg tagtccaaag cacacaaatg tggagccaca    142800
     agccccggaa gttcgggaaa tgaaaatctg tccactccaa gaatatcttt cagtaaggga    142860
     ttgcattcaa ctatatccga gtcaatagac atcaatccgc tcttgtttat gtatctccac    142920
     aagtgtgtta tcacatttgg ctttgtgtct gtgtatctcc ccaggatatt actcagcttt    142980
     ggagacaatc tgaagatttc tcttgggttt tcaaggtcga acatcaatct tatggtcttc    143040
     gggcttttat cactgttcac ctcaaacgct tcagcgtctc cattacactt tgtccattcg    143100
     aagaagtttt ccatggacat attcttacat ttcatctgtc ctagttggcc ttcttgatcc    143160
     ccagtcatgt cttcttccat acccctatca ctttcatccg atccagagga aggcccaaag    143220
     tgaatatcag ctgttgtagg aatagagcta tcaaatataa cacagaatct tttcacaaca    143280
     tcggaaaact tcatttgccc tccattctta tagtcattga tcactctact atcaaggcgt    143340
     atgaatatac ccttcttcat agcaaccttg acataacatc ggagagactt cttgcatttg    143400
     attcttttga gatactcggc ttccatattc agtttctttt ctaagcataa ccggtcaatc    143460
     tctgcctcaa tgttttgtaa cttgtcgtac aagacggtca ttcctctcta actggggtat    143520
     gtgaagaaag ttattcgaat acatccagta caaagtaaac atttacctaa agttttctat    143580
     tacgagtgta tgcatcgtac atcttggaga ttttgggagt gagacaccca ttcccctatc    143640
     ctcattcaat tgttttcctg gaataccctg gaatgaacag aaaagaatta tacgaaatgt    143700
     ttaaccatgg agaacccgca gacacaggct ctgtagacat ggacgaggcc gaatatattc    143760
     ggctatctta cattaccaac ttttcaaggg atgacattct tctggatcta attccaagat    143820
     acaagtcttc atacagtcct gagggcaccc ggttctttgt tgaaacgata gccatgattg    143880
     tggataatcc aaggatggca ggatgtgtat tcagccctat ttccctcaca acccttgttg    143940
     tgaattcttt tgggacatca tactttgatg ttatggattg ctttgaaagg ctaagcgaag    144000
     tcgaagggat gccaaaaaag gtattccttc cgatgatcta cggactgtcg tttagatgtt    144060
     ctaaaatgga tgctacatca aatatagcca gctatagctc tgcacttgaa acactggcag    144120
     gtctccctag tgttcttgaa gaacttaaga acgaagtcta ctggggcctg tgtgacctta    144180
     gacctggaag agatgttgtt cttgactttc ctgtgtactc tgggtttgct tgtgcctttc    144240
     cttgctttct tgatggattc ttcgagcctt tcatatacaa gaaatgtgac tatgcaacac    144300
     ctgcccacga ctaccttggg atttctatga gggaagtggt ggagaagtcc cggagatcgt    144360
     accattccct ctgtgatcat tcttacaaga tgcatcaaat aatatactcg atcataagat    144420
     cttcgaaaga attgaggatt aatttcatga aatatgtatg caaggtcata tcggtgagta    144480
     aagaaaggaa taagactgtt ttcaactgga gagaaaatat aagcgatggg tttgcataca    144540
     atatgtccat ggtcatgagc aggtttaatg gaaagataat tgacagaaac atgaccgata    144600
     aaataaaccc agagagtgtg gaagagatct ctgtggattc atttccaaca ttctgctact    144660
     tctcaaagat ccatctacag tttacatcct gtgtcaagtt tggagaatac attagaagcc    144720
     ttgcttatga atacaggctc ctcgatggag acggaggaga aagaatagag gcatatagaa    144780
     aaggaatcga ctcaaagatg agtgctttga acggtcttct ttttatgaca gatctctttt    144840
     cagacgagaa ggcatttacg gatttcatga ccgaatacac tgcagaaact gagtacccat    144900
     ggccagacta ctactatagg acactcctat ggatgcagga gatgactatt gacatcatga    144960
     agtcggcaac aatttcgagt tcattgaata aggttatgga gaatatcatg gactggaaaa    145020
     gtcctctttt taagaaagag gttgtgaaga tactaagcca tcgaagcaac tccataaagt    145080
     tcaccatgct caatcgggtg atagattact ataactcttt ggggagagat gagatgagga    145140
     tggaacctag aagcataatc cattctatct tcaaggaggg aagagtgttt gctaaaatga    145200
     atgtttgcag aagaaacatc acattcatca actgcatgat gaaggacttt gaatacagct    145260
     tgtctgaggg tctttcttca atcaaggata taaaggaaga catgaagact gttgaagagc    145320
     ttagcaggga actggaagaa gttaagaaaa agaactccga aatcaaaaag gcagagtcga    145380
     tcaacgaaag aataatttcc atgaagaaga gtatccgttt ctccaaaagt aaggcaagaa    145440
     actccttcct atatgttgat gggtgctttg acttgtttat gcatatcctc gacgaaaagc    145500
     ctgacttgtt tttggtggaa gagatgatct cgaactttgt gagagttctg aattgcaatc    145560
     tgaaagtgat tgcagggcct agatgcacag accttgtgat caagtctcca gagcagtacg    145620
     gctttgacgc taaaaacctc ctgaggagaa tggtcatgat ctatataaag attaggagct    145680
     ctaagtttgt tgagatggtg gccaatgaca agatgtactt tgacattgag ttcttccgca    145740
     cagctcttcg gatatgcgag aataagtatc tcatcaacga gtctcagttg gaagagctga    145800
     gaagccttat ctctgatctg gagaaagtcg aggtggtgga gaagatcgag tctgttcctg    145860
     acgagtttat tgatccacta acgttcaacc caataagaaa tccagtgaag ctcttgactt    145920
     ctcggataac tgtagacaaa tccacatacg atatgttaat gatgaatgga ggaatggatc    145980
     cattcaacag aatgcctctt acagaggaca tggttgtgga ggattccgaa ctcaaagaga    146040
     agatagacag atactatagc tatagtagta aagggaaaga aatctgatta tttggtttct    146100
     ggtggtaaat agaattggcg gcattatgtt attttatatt aagttcgtgc tctcaagagc    146160
     ccttccgatt tgatgaccca aggaaaattt attgtattcg aaggattgga tagatctgga    146220
     aagacaacca tagttgatag cttatatgat agcctttctt ccatggggga tgttcgaaag    146280
     atgaggtttc ctaatagaag cggcaatata ggaaaagtca tagatgcata cctacggaaa    146340
     gaaatcaatc tggaaaacga aaccattcac ctgctgttca gtggagatag atatgaacaa    146400
     aaaagtacaa tcgaggagct taggaagagc tctatacttc tctgcgatcg ctattcccta    146460
     agcggggcat cttattctgt agccaagggc ttagatctcg actggtgcgt tatggttgat    146520
     tctggacttc ccaagcctga catgactatt ttcatagata tccctctaga tgaaatatct    146580
     cgaagaaaag gatttggaaa cgaagttcac gaccaccttc catttttaga gaaagttctt    146640
     tctgcataca aggtccttct taaaagagaa aaaaatgtcc ttattgtcga tggaactttt    146700
     cctatctcct ccattgttga aattgtgaaa agaaaaatac ttgaatagtt tctttattag    146760
     tacctgagga gatcagtgct cacgtacaag atctttaaag aaattggttc ttctcgggat    146820
     actcctattc aaccctttcc aaatctgaag gcgtgataca tttttcatcc ttctctccat    146880
     gttctctgtc actatctccg ataagatcct ttcctccatg ggtttgcaag atatatttgg    146940
     tgagatagta cttggtctgc gtagaatttt tgcatgtgtt aggaaagaga tcaagaatat    147000
     tattgtatgc ttcttttctt gccttattaa aagagatact cttctgattc ataagtgagg    147060
     tcttaataaa aagtaaaaag tactcactga cgttgaatag aaaaccctct ttctggaaac    147120
     ctttaaataa ggaaaggtcc tcggaataaa gatgataact ccgaatgtct tctgcaattg    147180
     cactgaacac cccttccatt ttgttctcgc aatcctttac atatttgttt gcttcctcat    147240
     ccgatggctt ctcggccgaa tccaggcccg gcaaccccca gtcgagttcc ctttctttct    147300
     ggaagatctc aagtaccatt agagacacat agtactctgt cttgcaatcc ccaggttgaa    147360
     ttggcctttc tagcttctcg atcccagact ttataagact tgccaggcag tcgcagatct    147420
     tagtgtcgtt tttgggaatc tttccatatt tcctctttga ggccaatgtt ttcgtattag    147480
     acaattttcc cttagacctc tccttcttta catcatttcc tttatcgaga gacccagtac    147540
     ctgatttcaa gagcttggat cgttcccttg ccttgtgtac actcaacact ttcttggcgc    147600
     tgtatggtag tcttccctta tatacaaaga aatcctctag tttacactct atcatcacca    147660
     tctgtgtctc tccctcaaaa ggttctatga acgggtcgtt atagtcatat tcgtcggccc    147720
     tttgtcttct cttcctcggc ttctccttct tcaggagatc tatctctttg gattccataa    147780
     cacttacctg aactgtaatc tctttttcaa agttcattgt aaaagtaaaa gggataagct    147840
     attgcataga gaaaggcgtc tttattatct gttttctaac tatagaagaa taattaagtt    147900
     ctctcctgaa cgccaccaga tcttttggtc ttcttgagtt tgatgtctct gagatcctgc    147960
     ttgtcaatat aaatagtccc tatcctatcg ttgaataaat tcttggttgt attcctcctg    148020
     ggcttgctcg gctcatcaag tgccttttta taaagctcgt cactacaatg atagcttctt    148080
     gcaagctcca tttcaaacaa aggcccacaa tcctcaacac taagatcctt taaaacccgg    148140
     acatacttca gtacatatcc gctttctgtc cttgcaaaga cccatgagta tcttatccct    148200
     tctagacaga ccttggaact tctcatgttg aaaagatcta tcacaagact ttccagccta    148260
     gggttattaa tgttctctag aaccacaaaa tatttcatat ggagctctgg gcttacacac    148320
     tcaaagtccg acaccggttg atatttattt atcttgaact caaccatatc tataatctca    148380
     tcgttgaaag tacgtccaat cacaaggaga ttctccttgg ttacagaaat aaatatcccg    148440
     gacttcttct tcttcatcaa cttctccact tgctccacac aatcaaaagc acttatcttt    148500
     tcctgtatgt ggattgtatc tcctcttata gcgcctatct ctctttggat cttttctccc    148560
     tcgctgctgc agatcaccga gagcaagatc ttcctttcac gaggcctctt cactctcatt    148620
     tgtgggtaaa aaattgaagc cagatgtaca aacagaaata agcactagta tctttcttta    148680
     aagccaggag acagcaggat gcttctttac agttcaataa aacaaaatta ttgttcttgg    148740
     tttcacatgt ttaccccctt gaacacacca cgccaatgag cataaactta ggtgacatat    148800
     ttacaatatc cgggagaaga caatcacaaa aagaggatag atacacaaag agtacaatgg    148860
     gaatacacac aaatgttctg gccagcataa ggcttatgac atcttcccga agcactcgga    148920
     tagaaaacag acatattgac acgtctccac ataggatact ggatgcacca ggtatgctgg    148980
     acgactatta cctcaacttg ctcgactgga gcaccacaaa tcttctggta atagggctgg    149040
     gagagtctgt ctatggatat aatgccgttg acaaaagtgt agtcgatatc cattctgggg    149100
     agaattatgt gtcatcggta aaaagcaatg gaaacatcct ttgcattggt acttcagacg    149160
     gagcgatgcg ccttgtagac acctcggtga ataaggagat aaatacaata agaaatcacc    149220
     aagccagagt ctcatcgttg agttggaatg gaaacataat aagtagtgga gacaaagcgg    149280
     gaaagttatg caacttcgac acaagatgcg gaaaaatctc tatggttgga gcccattccc    149340
     aggaaatatg tggcctggca tggagtgcag atatgaaata tcttgctagc gggggaaatg    149400
     ataatgttat aagaatatgg caattgggaa acaacaattc gcaaacgctt ttagggcata    149460
     aatctgctgt taaggctctt gcgtggtgtc cttggagatc ggggatattg acttctggag    149520
     gaggagcaaa ggatatgacc ataaagtttt gggatgttgc cgaaaatagg ctggaaagaa    149580
     gcataagcac acagtctcag gtgtgtaccc tcacatatct ccccaagtat aaagaaatca    149640
     tctcctcgca cggatacagt gaaaacgaca ttcgaatatg gaagacttcc acaatgaatc    149700
     taatctcttc cttcgggaag cacgggtcga gagttcttca cgtagctcta agtcctgatg    149760
     gatcggaact ggcctcggta tctgcagatg aaaacttgaa gttctggaag atattcaaca    149820
     cagaaaaagc atctgtaaga agagacagcc tctcgtttag gtaaagtgca actctcggaa    149880
     tgctgtgcaa cggcatagat ctgtatggat aggcgagagt ctataagtta tattttaatt    149940
     aaagctttca aaactacaga cacaaaccag tgtggcccat acttccctct tcgtagtaga    150000
     cgtcgcattc agtgagaggc ttatcgtcat atagcagaga aagattattt tcgagggagt    150060
     cctcatttct tccgttgtct atgagcttaa cgattgtctc tattgcttcc accttgctca    150120
     tctcaccaat gagggtaagc agtgtggact tcctgatctt tggtgaattc actgctcttt    150180
     catagatttc gtcgactctt ttagaaagac cctggggagt atcaacaata agattaacca    150240
     ttcgatattt gttgtacagt ctttcacgcc tgtttcttga agttgagaaa atacaaagat    150300
     tatacatcag catctcatct acagtaatct tttctatata tgtaatcgta ggagcaagaa    150360
     tattcaagat ggaagagttg atattcccca caagggaaac cgaggatacc tctctgtcca    150420
     gtacaactag caggatgtat ttgttcttgg ccaaaacatc tttgttcctt gctatcgcct    150480
     ggttcctcca cttaacgagg tattctctca acgcatttag gaacatgatt ctagagaaca    150540
     cttcaatagt ggtcttccta ataatctctt caagtatgga aacacatatt ttccttacaa    150600
     cggtctttct ctctacagag cccaatcttt ccttgtcttt cgggaactta ttacaaaggg    150660
     actccttgga gatattcaat tttttccaaa gcactgcaga gagaatatat gacaggattt    150720
     gataatccac cgccccatgg agcataaaaa caactggctt cttcacattt gtttctatct    150780
     ttctgctttt aggaactact ttatcatatt cctctccaca tcccttttcc tcaaaatcca    150840
     cctttcctcc cctaatgggg atccccttgt ctcgaaagag atcttcggcc tctgcctcac    150900
     tagtcaacag gacatctcca aaaaatccaa tcttcacttt ttctacaagg gacttcttaa    150960
     acagttgcac acactttcct ctaacttctc ctataaagga ttgcgccagg cagaatgaaa    151020
     tatagtcaag ttttcgcaga agcctgaaga atcccgcccc atttccttgc atgtacttct    151080
     ttgtgatttc catcgataac cttattcttg gcccatcatc ctgttctccc gaatctaaaa    151140
     catatttctc gcacattgag gctagaatgt gataacagta gaactcttct ttgttcctat    151200
     tttcataacc tcggctttct aagctataca accgcataag agtttccatt gccatcctaa    151260
     gctggcttaa atttaaatcc ttattgaact gaggatgatc atacagctgg tatctaaaga    151320
     caatgtaaaa cctgacaacc ttctcaagta tctcaattgc ctcccttcct ctttcttctt    151380
     ggaccttcat gtctagtaag actgctctga ttctgttctc tacaaatttg tatatttgaa    151440
     tactctggtc atctgcacac agtctgatga catggtttat tactctccat aatacttcaa    151500
     ttggccttat atcttctgca agaactcctc ccgagtccgg aaacgatttc cgatacttct    151560
     ttaccataac ctctgtctcg taaggagata cttcattatt aagaactcgc tcgagacctt    151620
     caaactcagg acaaaacgtt atgcattctc ctatcactac ttttcccttc ttggtatttc    151680
     tgcgtttctc ctgcagtctt ttgtacctta ctcttaagtc ctccattgaa aacaggggat    151740
     cgataactca ttaggacatt ttcaacagca gtacatccgc aaataaatat caagttcaag    151800
     caatagaatc cgcattaaat cctattctct ttcctatgga tccaagaaca cttttgctta    151860
     cgttcagccg atagctgtct ccattcctga ccacaagaag tttaccaaca agcccattaa    151920
     gcttcatctg taggaaaaag ccgtttccta atttactttc gatttctttg caaccactca    151980
     agatatcctt aaacttattt ctgttcttta caacaagcat tattacactt tcaaagtaat    152040
     cgagtccact cccaaaataa ctttctatcg tccattcttc cccttgggaa atcctccgaa    152100
     gctcattaat gtttttataa ctatatgctt ggaccgtata tttgtcccca actgcagcaa    152160
     gcttctcttc cagcgttgga ctgaatacaa tctgaacaaa gtctctatgt cgtctgttac    152220
     caaacagaac atatttccct gggctaggaa gatatatctt tgagtcttca agtatgagaa    152280
     caagatcttc tgactcttcg atcatagagc taaagcactt tttatatacc acctttctct    152340
     cccttaaagc cgcttcaaat gtgtcaagag actccagagt cacaatctgg atcttaaagt    152400
     atctttcgtt tcccaccact tcaaagaaag cccttaggga ctcaaagttg gccggatagg    152460
     tggatccagg ctccatttta cactaggggt ccccgtaaat tgcggaacta aaaaacccat    152520
     ataatgaaaa aggttcctaa aatattactc aagctggtga tttttcaagg aataatagtg    152580
     ctatttcttc ttggaattcc gttttccata tttgcttatc ctctctacat atttaacaga    152640
     ccgctatgta ttcaactatc aagcttcttt gcatacactc tgtggacctt gacaagctgg    152700
     atgttcaatc tatcaagcac tgtaaatggt gccgtttccc ttgggaacga aagttacttg    152760
     gttataagca accacttagg atctgtagat ttcatcctaa ttaatgaaat aaccaggaaa    152820
     agcggaatga tggcccacgc aaagtatgca attaaggacg gccttcggat tttccccata    152880
     ttctaccaaa tcgttgttta tcttggattt cttgtcttga aaagaagctt tgagaaagat    152940
     aagaagaaga ttatagaata tttaagattt ttcgacgtct caaatcttcc gatatggttt    153000
     gttctctatc ctgaaggatc ccgattcaca gaaaagctga aacttgagag ttggagatat    153060
     tccgataaga aaggaatgat aagactcaac aacgtgcttt ttcccagata caaaggattt    153120
     aaactcatat gtgaacagct ccgaaactcc cgaataaaga agattgtgga catcacattc    153180
     tcttattcgg agggagaggt tcctcccctg tggaagtttc ttttttggga tacgaaaggc    153240
     tcgttcaact gtgacatcag aactgtcctg atcaacgaga tagatgacta tgaagagttc    153300
     ctctacaaga gctttgagag gaaagacctc ctcatagaaa agtggaatag cacaggaaag    153360
     taaactgtaa aagaattccg tatttattct taaaggtaca gacttggcag gaatataata    153420
     tccctcttca tggatgcaga tgcatcttca atcttttttt ctagatcttt atctcctatc    153480
     attgcagata tacttatcaa ctccctacaa cattcttcaa gtctcaatat tagccttaca    153540
     aaagtcccct cgagaacatc atatttagat actatcttta ccagtgacga tccattgcac    153600
     caatcataaa ctgcatctac aagggagaaa ttcaagggcg gaaaaggcgg aatagataat    153660
     tcatctaggt ctttggatag tctcgcgaaa tattccttca ttatttcaca ttcgctgcgg    153720
     agactctctc ctggttcttc ttctccgcct tcttcatgta tcattgaaga catcaatgaa    153780
     atgattttac gcccacacat ctctttgaat tcatttgaga atatcatctc aacaaccaaa    153840
     acctcattaa ccgtatgtat ctctgctccc gctctcccct tcattgttat ggtcccgtca    153900
     acaaatcctt tccttctgag gaattccatc ctgttgttat actcatctat catcccaagg    153960
     ctacaagcat tatattttgt gcttatcttt tctatttcct ttcttctgtg aagcatatct    154020
     aatgcactta agtagtgaag atcaaactcc ttgcagtcct tctcttcgga tattaggtaa    154080
     tcataccaac tcttgagttt tcttatctcc agcacatcca ttacatttgt cgtattatag    154140
     ttccagaaag ccctcccatc ttccagtaca cagaaaacat ctgcaagatc aactttactt    154200
     ctatccagag gctttctgat gtttagggga tgagccagaa accttgtgga aattggagag    154260
     ctactctgga attccccttc ttgcttcaga agcacagacg ttcccaaaac cttctcaaca    154320
     gttcctacgg agttattctt caatagaatc tgtcttccct cccccaaaac gttgtatttt    154380
     ccaattaatt tccaattctt agcgcatatc tcctcaacag cattgatgta ctttgccagg    154440
     tctccacata cactgcactc tttcccttgg taacgctcta gttcagacag ttttttcata    154500
     tccttctcat agttcctctg gctcctatgc tccccataac ttcttctcat taggtcttcc    154560
     accctaatgt ttgatcttag tgatataaga ataaggccaa agcttagctt aaattgactg    154620
     gataggctga atggtgcacc ttgtataatc ccttgaatag ttgaaagagg tggcattttt    154680
     ggatctgcta tcatcactgt tcctactgca tccatccctc gtctcccagc tcttccactc    154740
     atctgaatgt actctccaga cgagacatat cggaaggttc cattatcgat tttactaaga    154800
     gataaaaaca cacagcattt ggctggcatg ttcactccca ttgcaaatgt ttcagtagct    154860
     ataaggagtt tgaccaggtt catggaaaag agaagctcca cacattcctt aacaaagggg    154920
     agtagagaac cgtgatgcac tgcaactcca ttaagcacca tcgaagacat gttaagaacc    154980
     tgaggcaagt tcttatcctc ggaagagagg cacttggtgg cctcgttgag aaacatcttt    155040
     acttcctctc tactttttgc atcgttcaag ttcaaagtcc tgaggatctc ggcataatct    155100
     tcgcaccttc tttttgaaaa gcaaaagaat atcgctggag taagcttttt cttgacaaca    155160
     aaattggcca ggtccagtat cttaaacttc cccgtaggcc tattcttctt gctgaaagga    155220
     actaaatctc ccttgaaatt cgatgcattt tctgtttttc ctccttcatt aatggtatac    155280
     acattccagt cgcaatatat cacatgctcc aaaggaactg cccttttccc tgtcgaaatc    155340
     acatatattg tccgatcctt tgtccttcct acccactcac taaactccag gccgttggga    155400
     attgttgcac ttagcataat gaagtttata ttgcgaggaa tcatgattat acattcctcc    155460
     cacacaactc ctctttcaga atcgttgatg taatgaacct cgtcaaacac aacaaactct    155520
     gtgtctctca aaagatctcc atttctgtac acaaggttcc gaagaatctc agtcgtcatc    155580
     acaaggcatt tcgcagtggg gttaacctgc acatcccccg taataattcc aacgtcgtcg    155640
     tacttctgct tgaagtcgtg gtacttttga ttgctcaatg ccttgatggg cgatgtataa    155700
     atagtccttg tcccatgctt ctgtgacaga gagatggcat attcggccac aagagtcttt    155760
     ccggaacttg tatgcgcaga aacgaaaaca gatgagttcc tgcttaaaaa ataaaatgcc    155820
     tgcttctgga aagtatcggt ctcaaagtct atgttcagaa tcctctcgtc aacatactgt    155880
     gaatagtccg agggaatcca gttttgcttc accatcaccg aatacttttt ttccgtgcct    155940
     ttggcttccg ctccagagac attcctacat tccacctctt ccccgttttg gttcatgggc    156000
     taggccccac agaacgtatt tctgaagaat aattccctaa atttctctgg ctcatcgtta    156060
     aatttattca ccaactctat ctccttcggg aagaagcctt ttcattcgaa tactcgtagt    156120
     aacatccagc ccccaaccgg tccttaatct cttcaaactt ctctgtaaat gcatttgcat    156180
     cttcttcatt ggcatattct ataaatccat atcccctatt tcttttgttt tctccgtata    156240
     tcactcttat ctccttcggc ttacattcga cgtctgcaag tattttcctt atttcgacaa    156300
     tcgaatgggc cttgttcaac tttcctaaaa agaatcttgt cttgttttcc caaggcttct    156360
     tcatcctctc tatataaaca ggcttgttgt tcattacaat ttcctctttg atcacagctt    156420
     ttttcttgaa ggttataatc gctttacccg tagatatgtt atccttgttc ttttttattc    156480
     ttattctctc tatctctccg tatttttcaa acacttttga aatagactct tcattttctt    156540
     tataagagag gttggtgagt atgtatttgt tgtccagata tcttccgctg ctttctttct    156600
     tttccttccc ttgctttctg tttgctttca tgtctacaag tgcatgttct ttgctaggat    156660
     acttcaagat aaaatggcct tttccgtttt ctattgactt gaagtttttg aatgcttctt    156720
     ttatgtcctt caaagtcaga cttcccttta taacaagaga acatgtggcc tcatcaaatt    156780
     taatggcttc aatattcttc ttcttttccc tcgatatctc atccttttct ttttttccct    156840
     tagagctttc tttcttctcc ttgcaacttc ttgggatatc ttcccccttc aaacgtttct    156900
     tattcccttc cttgcattca agcttactct ttcctcttcc ttcctttttc atgccattca    156960
     tactatatct tctaatgggt taatatatat ccaaagaaat aagacttcct acatccgccg    157020
     cattaaaaga tttattagat atgctttgta atgccttcac ctacttacag agcactcctc    157080
     cctacccgtt aaaagtggca aaaaatttac cctgaacaga tgagcaagga gcttttagaa    157140
     gcaaatcccc tggttgagat aaaggaagct taccaaaaga aaaagaagtt catccgccac    157200
     cactccgata ggtataaaag agtaaagccg tcctggagaa agcctcatgg aattgacagt    157260
     agggtcagga agagatgccg gggtgaaaga gaaatgccat ccatcaaata caagaagcca    157320
     aaggagatca gacatcttct tccaaatgga ctcagaaagg tgaggatatt caatatcaac    157380
     gaccttactc ccctagcatc cttgaacaga ttttactgtg gagagattgc acatgcagta    157440
     ggagctagaa agagaatagc catcgtcaat cgagcaaagg agcttggaat ttgcttgttg    157500
     aacggaaacg cacgtcttgt tcaggaaatc gaggaataaa acttcagctg ctttacttct    157560
     tgttatccta agggaagatt tatttaatac cgagaaaaat atcctctgac attcaaatga    157620
     atttaatatc cgcttccgat agagatatta tcgtccgcat ggatgagact ttgatagtga    157680
     gggatgtctt cagcggcacc acaaggaaaa tgactgcgcc tcctctgata tcctttatgt    157740
     ctggaaagta tttagttgac aaagaaaaaa atttgcatgt tgttgacgga cctgttctta    157800
     ggaacgcttc caagctaaac agaaacatct tttgtttagt agagcatgag ggaactgcat    157860
     atgttgcaga taggtttgga gacgtctaca gaattgaaaa tgaaggatgc aaatatgtgc    157920
     ttggaactct atcgtatttg acgggaatgg ctatatacaa cggaaggatt ctattaagtg    157980
     ataagtacgg aagaattcgc atcagtgaaa tgaatggaag aatattggac tatcgctttg    158040
     gctgcgactc tatagaatct ttggaatgtg ttaatggact cctgatttca ataagcaata    158100
     agaatatggt tctatatgac gaagagtgtt ttcccagatg tacgtttaag cttcccgaag    158160
     gcataagagt tatgaagacc attactaaag gaaagaacga gcttgtagtc atttgcttga    158220
     attcctattt cttgtttaag atagagaaaa atagcattgg acttgtttct catgtgaaag    158280
     aatccatagt tgatggggcc tgcatcggag atctctttta caaggtgctt ccggatctca    158340
     ccgttgtgga ttgccagggc aggatcttct atgaataaac attagttaat cttggtacag    158400
     aattgatatt ctcgactatt tatcacttct gtcttcaaca ccctatgggt aatagcaaaa    158460
     ggcataagac tgaaagctcc cctaacatcg tggaaagtac agagagcggc acctattcgg    158520
     aatcagtctc cttggaatct tcatccgacg aaattgttta cgaggtggca gatctctcgg    158580
     tatccaactg gacggatgta tctatactta tggaccagtc caggatgttt ccctcttcgg    158640
     aagagtttct ttcattattt gtcaattcca aggtcttagt aagcggggat cttattctct    158700
     ccttttgtgg ttttcttgag gtgcccaagg tccttgaaat gatacacaag aagctcaggg    158760
     aagctcttag ctctttgatt tcgacggcag aaaagaacaa aatcaaaagt agcgaggttt    158820
     atatattcta tatggaaagg gcagccaatc ttcctttgga aatgattttg agcctgtaca    158880
     ggagcctttc cttaggaaga ttcaagtaca tgatatttgt ctcgagagtt aagccgtgtg    158940
     gaaaaagaga ggtaaagaat ctcatggaag acttcaagga gtataaccca gtggacttga    159000
     gccatatccc tgtgcgagga gaagagatct tgctactatc atcccacata gctaagaagc    159060
     agattggaat gaacaataat atattccgac tgtttttgat ggacaggaag atgtttgaat    159120
     cgtttataaa gctcttcgaa aaagaaatct ccaaaagcat atagaataaa taatgattga    159180
     ccaaatacaa ttcttatttt ctatttccct cttgtttccc tgggaatgga tgaagctgtt    159240
     gagaaactag aactagtttt ggagagcaaa gttgaaaatc ttcctgagaa gataatggat    159300
     gcattagaag accttgtgca ggcatctttg gaatgttcat cagaagaaat ggtagagtac    159360
     gagctagacg aaattcttat taatgccttt gataagacat cgcataagga ccacaagaga    159420
     cttatggaga tgcttctgga cctcatgtca tgcatgcgag atcctcgtaa catctatcca    159480
     gcagtagaga agtactttag tcctgagtgc aacttttcga tggatgccgc caaagtaatt    159540
     tttgtgatga agagggactt tggatttgag tttgatggct ttcttagcac tctcctggat    159600
     tgtattagac ccgaaaacat tgaaaacgat actgagagga gactgttttt tattctaatg    159660
     gttttagata atggttctgt cccacttgtt gtaaccaaag catttgttaa gaagctctgt    159720
     aatgtctctc tgcaggtcaa gtcctcatgc tgccacaaga tactttgggg agtcctatgg    159780
     attatgagat tccatccaat ggcatatgcg atggcaaaga gagaaagctt tgaaaaggat    159840
     cttgaatgga atgtgtctgt tacgattaac caatttcaac cgtatctatt tgagcttgat    159900
     atattaagtg aatctctaaa aggaatccaa aaagttgtta gtctcatcaa gcgcgaggca    159960
     atggatgcca aaaacagacc aaagctccta tccctggaca atgttatttt tccaaaacta    160020
     gagatttaga tgtcttccca aaaataaaga attcacttaa tctttttgtg gctgctcctg    160080
     cagcttcctc ataatgtatt ttcttgctct atctttaatt ctcaattttt tctttgtttc    160140
     agatggcctg tctccatttc tttggaggtc tccttggatc tttttgacta ttctcttcaa    160200
     agaagataca cttatgatct ccccaagatt gagccttctg tgggagtctg gtaagttctc    160260
     gtctctaatg aagtatgcta tgcaaagaca gtaggagctc gtacacttgt tgcttttgga    160320
     tattgaaaga aactcctcta gtaaatgatt acctttaaga ccttgtgaga gacaaaaatc    160380
     tctaactctg ctgaagattc tagagagata ttccgaagac agttctacat attcaaactc    160440
     tctcaaaaga attctcttga gccccagccc cgtcctttct gtaagaggct tgagatcgct    160500
     atatgatatt ggatactggt gtcttctaag tacattgtaa gttattgcca gtatcttatc    160560
     gttggctcca attctgtgtt caaaatcctt tgttctcaag aggagtttaa cctcttcgga    160620
     atagcctgaa acattcagaa tcccaagtaa agactctaca tttctgctat atctctctgc    160680
     tttgtctaca acgaaatact tcattctcct tggaattaca ggcctgtgaa aagtatatga    160740
     tgccatgtag ttgtcgcaat ctgattccaa gcacaatcca caggacgtac aagcaccatt    160800
     gtcaatccat gggtggctgc aaccctccat tcagggccat atccacaaag atgaaaaaga    160860
     ataattccaa agccgctggt ctttagcaat aaagaaggtg tttatttcaa accgcaacag    160920
     tcggagcctc ttggctattg atggactcgt cggtaaaaac cagctcttcc ctcagcctgg    160980
     actctccaag tggagttaga aggaagtatg agtgtctcca cacgtgaatt ttctggacat    161040
     atccataaga gatcatggtc ttcataaatg ccttcagttg caggttggga atttcgagat    161100
     ccttatgatt tccaagaaca gtgtcctcaa gaagcaaagc ttttttctcg agtaaacgtc    161160
     tctttatctt gtacttattt actgtcggta ctagcatttc tctacaaatt agccttgata    161220
     cataaccaaa tcacttacct tctttaaagc cctcaagtaa attttttttt attgtttatt    161280
     cggccaagat acttgaatgg cacctctcct gcccccgatg atcaatccaa agctattgat    161340
     ggtgactgca acaacagcat atgtgtttgt attttacaca ctggctataa gagtaagttt    161400
     tgtccacgta atttctagcc attgtttcat agtccaactg cagccgaaga tgtcctaatt    161460
     accttgtctt cgattgtctt gtttagtgcc ctcctgatcc acgctatttt agggtttgaa    161520
     gaggaaaaga caaagcatat gtagacattc agcatataat gcccgaagta ctactagata    161580
     gcatcggtat tgagattcat ccacctcaag tactgctcgg acatagagtg tatttcgatt    161640
     ccgaccactt gaggagcttc atatggatgg tcttccgcca tgaactcttg gattttaaca    161700
     aacaaggagg aaaaggtctt tgcagccaat ttgtactctg tctctctttt aacacttcca    161760
     tcccaagagt aaacggaggt tatcttggat atttggcagc atgcagcaag ccttctattg    161820
     actaactcgt acgaagcttt ttcagctgat tctcgggttg gatatgttgt gaatacaacg    161880
     aatggtttcc tctgtgggat attgtctgga tggtgcatgg ttccctccaa aaagtactta    161940
     atatttgcct tcccaggata tttgaaatgg cgagaaccag gggaattcta ggtcttgtaa    162000
     atcctcagga tcttcttttc aaagctgtat tcatagaaaa aagacttccg aagcatcatc    162060
     taaaagagat atcgatatct gcaattgtgc ttaaggtgat gtctcaggat atttctatta    162120
     gggaaggagg tcttgttgtg attggtctta gcaggatttt ggtaaggaaa ctaaagtatc    162180
     tgcaggatga gtgtagtgat gttgtacata aaatctggag aaagaaaggc gaaaaaggaa    162240
     agggcctcag gtcggtatcc tcgaagggaa taaccttggg acttgactta gaaaggttat    162300
     atatcgacga tcagatgata agtccagaag agtttgtcat tcttcctgag gaggagaaca    162360
     tagatggaat acaagaaata gaagacctaa gctttggggg atttaacgac atttcatatg    162420
     ttgaagaagg aaggtttgga accgaggata gcacaagagc ttctacagcc acggagatta    162480
     ctcaaattcc cttagaggag cgaagagaga aaaggaggaa aataattgaa gacttggaac    162540
     tggagtttga cgcccgagaa tttcgagaaa accttaggaa tacaggggat atagtgttta    162600
     gggagaaaag tctcgatata agagatgagc ttgtttccaa actctcaatt gcacctgaga    162660
     tactatcgaa gatctgtagg agagagatgt accaaagaga aagcatagaa ggtgtccgtg    162720
     atacagtaat aatggaatca tatggagaca tcagttttgg ggacaatata aatgagtcgc    162780
     aagtatcctc cgaggttgta gaggaagact gtcttgatat tgagaagttg cctgaaagat    162840
     ttgtcttcaa tgagatggct gatgggcata gcagatatga aagaagtagg atgtttctgt    162900
     ctcttctaaa tctgcttgga agcgggatgg cgatggcaaa ccaaagagcg gcatattcta    162960
     atatagaatg caatcttttg tgactcctgg ataggacttc aagaattttt gagtcttaaa    163020
     aaatttatcc cttcaatgga aaagaaggag cattttataa tcgatgctac tgggcaagtg    163080
     gcaggaaagc ttgcttcaaa ggttgctaag ctccttcttg aaggagtccg ggtgacagtg    163140
     gtgtgctgtg aggaagcggt gtttgtagga agcttagaaa aggcagtaaa taaattcaag    163200
     gcgtatctta acaaaagatg cattgttaat ccaaggaggg gaccgtttca cttccgagag    163260
     ccaagaatgc atcttgcaaa gataatcaag cgaatgatct cttacaagaa acccagagga    163320
     aaagtggcaa tgagccgact taccacgtat gaggggattc ctagagaact ggaagggcaa    163380
     ccacgacaca aggtcacttg tgcattggta aaatacacaa gtaatccaaa caggtatgtt    163440
     actcttggga agcttctgag tatgtttgga tggaagcatg ccgaggcagc caaaagtctc    163500
     actgatgagc tgaaggaaag agagaagttg gagtccttga aacgggaaga gatgaaccga    163560
     aagattgaag aactaaggag gaataagtct tttgaggacg aggtgaataa gaagctggag    163620
     atgcttgcat aagatattaa aggttcttaa gttgattata taatatttta gactttttga    163680
     acgcccttga tgaaaaaaca gaaattatgc tacaagaaaa atacctacat aaacaagaac    163740
     ataaagttta ggacactgaa gcagctaatc ccagagctta tcgaaaagga ccacaggtac    163800
     atccagattt ccaatagagt atctgtaaga cccggaatga agttatgcga tctcacaggt    163860
     cttccagcac catacacgtg cccaaataca aggctgttct actatgactc ttctgtctac    163920
     aagagaatct gtgaattgcc cagcgatcgt atccagaagc tgtttcaact aagagagttt    163980
     ggaaagactt tggtttcact tagaaggtga ccttctgtaa ataacacaaa aagaaaataa    164040
     aatctagact ttattattaa agaagtctac attgtatata agatcgaaag agtttgtccc    164100
     gcatttcacg ggatttccca cagttatgga ggcagaggga ttagacaatt gatcttcaag    164160
     gtggaatgct gcagctgttt tgaagttgga gtagcagctt tcgaaactca ttttctggat    164220
     aagagagtcg ccaattccaa gtccatgcct actgaaggga gagtagtcgc cttttcttgt    164280
     catatagtca gctacaagaa gaagatgccg agcatcaatt gaaattccat agacatcgaa    164340
     aaccttcact acttcgttga ttatagcatg tcttgcagcc tcaatcccaa gcgttagata    164400
     cacattgtat atatcattag actcggaatt gtagatatct aagagatcta gtagatcctc    164460
     atagacaccg ggagccacct ctatccttcc tgtcaaagag gagatggaag ggctttctac    164520
     aaagagagta tttccggaga tcgaggcctt ttttatgcct ttggtttctc tcaccacaac    164580
     tgtaggaagg atagattcga ttattgagga tatcacttcg ttaaatccag aaggatacag    164640
     catctcaaat gaaagtatgt tttttgactt ccttgtaaag tttatgagat tctcctcttc    164700
     agtactgctt gagttatcgg tatggtcaat ttcgtcaata gtctcgggat gagtagtatc    164760
     atcactgtcc ttttcagtgt tttcattctc gctggtatct acacatatat agtcactctt    164820
     tgaattactt tcctcatcac tgtcactctc atcctcttcc tcgttttctt tgttttcatc    164880
     tagttccttt gaactatctt tatttccctc ttccattcct aacttatatt ttactttaga    164940
     tagcattttc agtttacttc caagtatctt caggaacttt cggtccaaag cctcgcttgc    165000
     aaggtccaca aagttgtcca ggtcaaacac cattctaatt ttcttctgaa agaccccgtc    165060
     aatcatcaca atttcctcag agaccctaaa tttcctgaca caatctttca gtgttatctt    165120
     ctttaagcat gtaccaatat caaaattcaa ctttttcctg ataggaatag taaccaaagg    165180
     cgtctttatg gacttggatg ctaccaatag aatttctctg agcctaggaa ctccaagagt    165240
     cacgttcttt tctcctacac cagctagatg aaaggtgttg agagtcatct gagtggaggg    165300
     ttctcctatc gactgtgcag ctataatccc gacagattct cctgggtcgg ctagagagca    165360
     tacataccta ctttccagaa atctcttaag ctcttcgtca aaaaactcta tctctttttt    165420
     gaaccgagga gacaagaaat cttcgtatct gttgctaagc ttgaaggaag acaaagatag    165480
     ctccttaaag agaaaggcat ttcttcggaa aaactcagga tcgtccaaat agcttgactt    165540
     cgtgcagtca aggccgtcct cgccataaac aaactgaact atctttttcc caatccgtgc    165600
     cgatctgtca tactcaacct ttatcccctc catgtgctta actaggcatc tttgtagata    165660
     tccggaattg gcagttttga ttgcagtatc aataagccct tctctccctg ccatgcaatg    165720
     gaaaaaatat tgtgatggat tgataccatc caaaaagcct tgatatatgt accctccaga    165780
     ggatggatca ggatccagcg gcttgaagca aggcaatgtc tttccactag ccatcaccgg    165840
     gactctccgt ccctccagct cttgctgtcc tagagcacct gaaatctggc tcagattaac    165900
     aatcgaaccc ttggatccta tcgaaacaat caattccata ccgttgtccg gaaaaccttt    165960
     cttcaatcct gaaggaacgg atgcattaac tatctctgag gttatcttgt tcatttctct    166020
     tctcattata gagtccaagt aagctttttt gtcgtcgcat aagtaaaagt ctggattcgc    166080
     ttccatgtac tccttctgaa gctcccttac cttcttgtct ttggtttcca tcactttttt    166140
     tcttttcgca ttcgcatcat tgctaagaat aagatcatct gctcctattg taaacccata    166200
     catttgaaga tatttgttgc aaactcttcc tatatatgtt agtaggtcat tcgaggctgc    166260
     aaacccccta atctctccgc aggcatgggc taaggacttg aaagttggcc ctattgagtt    166320
     cttgtccaaa atccctgtaa ttatattccc ttcactaatt cttagaacgc tttcttccga    166380
     atgctccctc catgcgtctt ttggaacctt ggtttcaatt tcaatattta aacccagccc    166440
     gaggttcttt attattgctg agagcacttg ctttccagaa tagagtctta caggcttgag    166500
     aatacagggc ttatctatgg taattcgtct tccatccaat ccagaattca ctagagtaaa    166560
     gtaatcttct tcggaaaaga acgagttttt catcgtcaag attgctgcag caacaatgtg    166620
     atcttgggta aggcctctta ttggtttccc gtcggtgggg actagatagt tgaagtcatt    166680
     catgacaata tgtctagcct cggcctcagc aacataactt tgtggaaaat gaatgttcat    166740
     ctcatctcca tcaaagtctg cgttgtaaga tttacagttg gcataatgca ttcttaatgt    166800
     cctttctcct ttcagcacct tgcacttatg agccataatg cttggtctat gtaaagtcgg    166860
     ctgtctgttc acaagtacca catctccatc caccaaatgt ctccaaacaa ccttctttcc    166920
     atccaggagc tggtttgcca aggcaaatct cttttcgtca ggcatgtggc ttaaactaag    166980
     cattacatct ccatcctgta ggtataaact tcccggatag gtagatccat tcacaatagc    167040
     ctttttcaat ttgcttacat tgaagctagt tactctctct ggaaatgtca gaacttccgc    167100
     aaacacaaaa ggaactccta tctcccgtgt ctctagatta gggtctgggg atatgacagt    167160
     cctcgccgcg aagttaactc tctttcccat tatgtttttg cggaacagcc cttccttctt    167220
     ttcaagaatc tgcttgtgtc ccggtggcgt tatcaaaccg atattccgtt tccttaggtt    167280
     tgaattatca aacgacgaaa gaacagcacc ttgcagctct ggccagtatg aaaggtcttt    167340
     tttcaccaat tcattgatgg tgagaatgtc gttaaaggaa aaagtctgag gattcggggc    167400
     cttcttctca tttaaaaaag acaccggacg gaatctattg ggtgtgacag gtatacttgt    167460
     caaaaagaac atattcgggt cttttgtaga gaagatggag ccaatcaagt cggcttcatt    167520
     ggaaaacaaa tcttccacaa gctctctaat aaaatccggg aaaagcagct ccgaatcctt    167580
     ttcattctca ctattttcat catccctttg gagggacttt aatatcttta tgtttgttcc    167640
     tttatagatc tttggattgg catgtccaca tctcacacat ttcttttttg aatttatact    167700
     agaaaagaag tggcgcacca tctcctggta cttatctgtt ggaggcccag gtctgttttt    167760
     ccttgaggat tccactctct tactaacaac actgtacagc tcctcttcct ccgaagtagc    167820
     atacagctca tccaagccgt ctatttcttc tccatttcta agaagagaga acttacagaa    167880
     cataataagc cgatcataat ttgttattct aaagtgcctg cactggaagc aacaacacct    167940
     aactaatgag agcagcgagt cgaagaatat cggattgaaa acaggcttaa atagctttat    168000
     gcgtccaaaa tgtcctgggc agtttagaag cgacaaattg caggttttac agttggacga    168060
     gaagtctaat ggccccattc tcaagtcgta caggcctcca cgcacaggat gcccgaactt    168120
     gtcgaaagta gatggctccg taacatccat gcaactagcc tgttctattt ccttttcaga    168180
     gtatactcca aacgatatct tctttggatg aaatttcata accattttga agaagggtcg    168240
     ttttgagaat gaaattgaaa atgcagataa tcctagggag atgccgatct tgataggcca    168300
     tcttaaagca tggtggcgca atggaagcgc gctgggctca taacccagag gttgtgtggt    168360
     tcgaatccca cccatgctag tttcttttca acccctaccc attagagttc cccatcttaa    168420
     atagaacttg actttattat aaaatcgaat caaacataga ctgttgtgac aaactgctcc    168480
     tcagactctt tgcacacctt tcttttcttc ccttccaccc cctttctgca gtttggcttc    168540
     ttcttatatg agtaaactgt attatataca gtcttatggc ctcccttgtt ttttgtttct    168600
     ctctccacag tctttactac tgtttttgtc accgtcttca ccaagtcact tgccatttct    168660
     aagtgagagc tttgcttggg agtttttgtg cattttgttt cttccaaatc ctcaattaac    168720
     acctttctaa ctaatggaag gagctctgct attatgtctt gcctacctgt gttcataaac    168780
     ccttgagtat ccgataatga agcagccaca gaggaaaaga cctctttctt ttccgaagtc    168840
     tcaggaacac tgacggtgag acacttttcc gtacatatta gagaaatcga ggctggcaaa    168900
     gagatactgg cagaaacccc ttctcccttt tgggatccag gattttggct tgggtcactt    168960
     ctagaagctg tctgtgttgt aacttcctct gtctttgtaa ccgtaaggac ggaaacagtt    169020
     ggtttagtta ttgttctata taccacacta ggaaattcag aagtacttgg atcactacta    169080
     gaggaatcta ttgttttcgt actcttctga gtctcttcat tccttttcga tgtctcacca    169140
     gaaataattg gagctctcat ggatatactt tcctccggca ccttcggaat ttcctggcca    169200
     tgcggagcct ttgtagatat gattgtggaa tactgcgtct gtacaactgt ctctgtctta    169260
     acgctactct ctgtcttggt tgaggttgaa atctccttga cagttgttag cttgtaattg    169320
     ataatgggaa cttcactctt gactgttgtt gtcacttctc tgtacaacgt aatgggtttt    169380
     tcgacactga cagtcttata aaacactcgg gtgactgtca caacagtggg ctcgcccttt    169440
     tccttttcat catcttcaaa acctttttct gcttcggaga cttcatctat tttgtcatcg    169500
     tccagtgaag agtccttgag cttggagcgc tttactgaag aagaaataag ggtagagccc    169560
     tccccttcct ttacaggagt cttacggata ttgtcgtcgt attttctttg cttctcaggt    169620
     ctctcagagc gtgtcaattg agaaaccttt tctgaaatca ctggaatctc caccgtcttg    169680
     aaaatagttt tcgtatcctc ttttttagtt tcacaggttt taccatcctc ggtcacgtgg    169740
     gtatctttct tctgctcgtc ccttgagatt gttgccgggt gctctgagac cgtctccgtc    169800
     tttgtttcaa ttactgtgat gcttttataa gatactaatg gtacctcttc ggttttggtt    169860
     gccggtgcag aattactctt atttgtatct ttgtgatgga tcacatgaat gaagggaatc    169920
     ggaggttcgg aattccttct atatgaatcc attgggccgt tagaaggtcc ttctctcatc    169980
     cattcaagct ctttgcactc gtctctacaa tcttccttcc tacagttcat gcatttattc    170040
     acatctttgt agacaacagc catgcacctt cctttgttac aacttgaatc gcgcactatt    170100
     ggcaaattaa agctctgaag atattcatcg tattcccgtt tgggaagata cacggagttc    170160
     aagcagtcgt tcaaacttat tccatatctc tggcatctac tcgttagctc gtcctggatg    170220
     gcatagcatc ccataatcat cagaattatc attgccgaat agaatgtttg tttgttctcc    170280
     cagatgcttg aaatatttgt gaggtaggtt tcacatctgc ttcaggcgtt ttaataaggg    170340
     tagatgtgct tggcgcaatc ataggctcgg tggtctaagg gtatgatctc cgctttgggt    170400
     gcggagggct ccaggttcaa atcctggccg agccctttta ccattctgca ttgcaaaata    170460
     cattttggta aacgatgagt ttggatttca agtctgcaat aatctttctt acatctcaat    170520
     ccccatggaa gaatacacac tctgctcctc aagtaccgag caaggcgaaa taccagtcat    170580
     tcacatcaaa agattcaagg aggcccctcc attgtttcca agaaacaagt ctcagctgca    170640
     gtatatgtat ctcccaaaca agtccctatt tatcgggcca aacaccattc caaggtctag    170700
     tgattatcaa gtaaatgtcc ttacaaccaa gcttaaaaag agactcaagc atgatctttc    170760
     tcatccgttt ctgtgtcttt cgatgaattc cgatagatca ttctttgaag ggaggtttac    170820
     ctttgtctcc acggtccaaa tcccagaaag tgttgaagag atgtgttttg tcaaaggtaa    170880
     ggagaggata gttcatgtca aagaaaaaac agatgtaaat acagacgtga gaaaagaaat    170940
     aaaattcgac cacataaagg acaaacagaa cgattcatac aaagatgtct gccaggactt    171000
     tttgcttgga aagttacttg aaggcattgg ggacaaaaag ataaatatca tcattagaga    171060
     ctccaccatc aataatattc tgtcaaaaga agcatatata cacttttatg taaagaagaa    171120
     ggatgaaaaa ctgtacattg tttttgacga agtttacact agagaagtca agtattacga    171180
     ctatctctcg aagtatgggg aggaggttgt tcgatctctg aaatcttcgg aaacccgtat    171240
     gtattccagt tcggaagcag tggttgttgt gtattcatca actctcttct acgattcctc    171300
     tgggcttcat agactgttta gtggaattga cgtcgaaaag tccatcgaca tggtggtaaa    171360
     tattgaagat gtaagagctg taaaaagctc aggatcctta ggagacgagc tgaaggtgct    171420
     ttttggaatt aagtttgagg agggagaata tgtccttaat gataagaaga tatatgtgtt    171480
     ggagccaagc ggggaaaagt ttaaattcaa tggagttgtg tttactgatt ttatggactc    171540
     ccaggagcct ataagcgatt aatttgtttg aggtttattt attgaggaaa tggaaagcaa    171600
     agtaaaggtg atttcttcgg acaacaaggt gtttgttctt gactatgacg tctccataca    171660
     aagtcaaaca cttcgaacat tttttagccg gccagaaatg ttcctagaat ctatctccag    171720
     ggaggttaag cttccggtca aatcacggca tctgaagagg attgtcgagt ttctggaatt    171780
     taagtatctt tcagactcag ataaggaacc taaggagttt aaagttagtg actcagaagc    171840
     tttggaactt ctggatattg ctgtatatct caaaatctag ggaaatcgaa taaacacttt    171900
     atttctacat cagagacata ataaacctat gtctagacat tgttactctc ttctgaaaat    171960
     tcggtattct tttggttgga aagggaacta aagtccttga attctttgga ctccaatata    172020
     gcctctgtta attcgttctt tgatattatg ttagatacac ccatggactc cactaacttg    172080
     tagatcgact cagggtgttc gtcgaatcca gggagctcat tgtatttcat ggggtagtaa    172140
     ggctttatga ttatccgggc cttccactaa attctaagcc tcaaaatatt ttcatacttg    172200
     gacatctctg gacagtaggg gcatttgaag gagttcaaaa caccttcctg agaaagcaca    172260
     cttgcagctt ctaaagatat tacatggcca cactcaagca tcacaggaat atttccatcg    172320
     atgcagagtg tttttagcac cgggcatatg aagagagagt ggtaatttct tcctttctcc    172380
     atctttatct ctataggaag agctggatca tctttatcga aaagcaaatt tccagagctg    172440
     gaaagctgaa gaaaggcaga agttccagct tcaaatagct cttggagata gcaaccgttt    172500
     ggcatcccgc tcacttccag atacttcgat ttgaagtttt ctataagcct ttctctactt    172560
     ctttccagag actcctgaat atttccagga ttcaccagaa acttaagaag cggcttgacg    172620
     tcttggatat atgttgggac aaacgacttt agtttcccga agcatagttt aagagcttcg    172680
     tcgtatctcc ctccatttat tagtagtagg aactcatggg acacaagata aagttcaagc    172740
     tccttgcttg gatggctctc aagaaactcc tccaaaagcc ctgtggaatt tcccagcact    172800
     tcggaaacag ttcttttgaa tctgacataa tcatctctaa ccttcatcac ctcttctttt    172860
     ccgtctttta tttcggatat gagcttgtca acaatatcac cacagtcgtt ttcaagtaag    172920
     tagtacacta ttaagcaggt tactgtttgc atgctgtttg gatacatctg gtttcctacc    172980
     tgtatgtccg actctgtagg tttggtgtcc gagggaagta aattcttcca aagcttaaca    173040
     agactagctt ctatgttggg aaggttgtta atctccaggt tgttttctcg agacaatgtg    173100
     gcttgtatct cgcttataat atggatggac ttatccctaa gatgctgata gtctattcca    173160
     tgtctatcac ctatcataat gggttgatta ggtctataaa atatggctca ttcccagtcc    173220
     ataaacaaat gtctcgaacc cacactctcg aaattcctaa gaataatagg aaaaggctaa    173280
     tcaacaggtt gatagaagcc atagagagcc tttcttgtaa tgaaatggag gagcatggtg    173340
     acgttatcca tataagtggc ttcaagcaag atgaatggag tgaaacaaag atgaagttca    173400
     tgaggaagta tgggcacatg aagtgactcc agacacatag ggccacaaaa gctgaaagag    173460
     aggggatggg aagggaggag agaccttggt tctatttatt aagccctaag gctaataaaa    173520
     atcaagaaaa aaaaacttaa cccttgaaat aaatattccg aatggacgta ccagatattt    173580
     cttgtgagca tcaggataca tcgattccaa acagttctgg aataattcca accctccaga    173640
     acgttgttgc aacggttaat ctgaactgta agcttgactt aaagaatata gctcttcgag    173700
     ccagaaatgc agagtacaac ccaaagagat ttgctgctgt gataatgagg ataagagagc    173760
     caaaaacgac ggcgttgatt tttgcctctg gaaaaatggt aataacagga gcaaaaagcg    173820
     agaagagctc gaggatggca gcccagagat atgcaaaaat aatacacaag cttggattta    173880
     atgcgacgtt tgatgatttt aagatacaga atatagtttc ttcctgtgac atcaaattca    173940
     gcattagatt ggagggtctt gcatatgccc acagtaatta ttgtagttat gagcccgagc    174000
     tctttcctgg gctaatatac aggatggtca agcccaagat tgttcttctg atatttgtct    174060
     ctggaaagat tgttcttacc ggtgccaagg taagagacga catttaccgg gcattcaaca    174120
     acatatatcc tgtgcttata caacacagaa agacataatc cattcagcaa ttcatgaaaa    174180
     ataacgaaca aataaattct ttattgttaa ttggtaaggc tctctaaagt catgaatggg    174240
     ttcctactat tgtgaagaag gatcttgcct ctagctttat tcctttgact ataaaatctc    174300
     ctgtatattc cttgcttcca tcaacatctg tattgaagat cccaagtgtt cttccttcaa    174360
     aagagctcat cacccctcca actggcaacg tgagaaccac atattctgag gatgctgtga    174420
     cctccacgct tccggtttca caaattacgg tgcccgaatg ctcaatgtcc ttgatagcaa    174480
     acgatagagg gattccgcca agtttatgag agtatatcaa tagttttgat gccatgcatt    174540
     ttgatacagc tttcatagga ttttcaagga actctggtcc tatttctaca gacatttttg    174600
     ccttgacaag cttgaacttg accatttgct gaagtaggat taaaatttct tgagacaatt    174660
     gtggaaggat aaccccagaa atgaacctca ttaccgggta cttcaaacat acaaggaaag    174720
     ttcaggcagt tgagtatgga gagatatccg aggtatatat ctcgagcttg cttgagcata    174780
     atgggcctga ggaatacctt gtgagcgatg ggaatggaag aattcctgta ttcaaatgca    174840
     ttagaaatgc tgacaaagct gagtttgatg gatatttgaa gtataagctc gggaagaaaa    174900
     gccgaagatt ccgacttgct gaggggcaag agggggaagt gtctatactg atagatggaa    174960
     agtactcgta tatactcatg gaggagtcca gtgttccaac aaaatatctt attttttccg    175020
     aaggatctct aaaggaaagg gaaattatct tctctccatc tactgaggat attgaagaag    175080
     agattggaaa gtgtgattca aaagcgcaga accaggtggt attatgtttt ttaaagagcg    175140
     taaaggtcca gtaccactca cagtttttat acttctatgt ttctaatgta gagacgatat    175200
     acggacaggt tctagtttct tggattgatg gcacaatggt attccacaca ctaacatcgc    175260
     tgctgtttct taatttcaac gagctttttt caagcttctc tctactttca accgtgtatg    175320
     ggataccata tcttccacat acaaacttca cgatcagcta caaatggcag aagatctacg    175380
     aatccaatct gtatgagttt agctggaatt atccttctaa atttctcatg gaagtcataa    175440
     ctctgatatt actggaagaa aggatagtat tttgttccag aaaggattct tctttgaggg    175500
     tgttacagat tatagagctt ataaggccct tccgatggcc tcacatagta tgtctacctc    175560
     ttcttccggg gatggaagaa attcttgaaa gccctcttcc ttttatcaca tgtctgaaca    175620
     aaaagccaaa tacagaagat ttagttatca tagatctaga tggtttgagg gtttatcggc    175680
     ctaggaaatg tgccttgctt ccaaataaaa agacaaaagt tggagcgccg aaagaccatc    175740
     agaaggaaat aagggactcc atagaattaa tagcaacaga aatactattg tggagagagt    175800
     acctgataaa gaaatgggga tctaaagtga taacaagaat accaaacaat cctttggaat    175860
     tcataggaaa ggttcatggg ttttatgccg acttctttag gactaggatg tttttagctt    175920
     ttataacgga ggagcgcgat tatttgtgta gatacctgat tgaaatagga gatgactatt    175980
     cggtgatcct tttaccatat gcacaattag atggaagcat gtatacaaag gctttgcgtc    176040
     tgtggataga actatttgaa ggggacattg aacctgtaat tgagcatctt attcgagatg    176100
     agcttctttc agatgtcgca gatatggttt tcaggcggct gagctatagg gaagactaca    176160
     gaaagataga catggttcta tcacatattc tatctccaac ccatgagatg tatatgaata    176220
     tcaatatcgt ttcgaagatg tctaaggtag ttttcaagga tctctactct tacgatgtgt    176280
     atcacctgag ggcttgcgat tgcaggactc tagacctcgg gagacttcgc tgtagagaag    176340
     attctgcatg gagaaaggaa gagaaggcaa tggaaaatgc tcggaggaag gtgagagaac    176400
     taataggagg aatgaaacag gatctttttg accctctgaa ggaaagatgt gaatgcaagt    176460
     ccaagaaatc tgtggtgctt gtttctggtc ctggatatgt atttctttgc tttctccttg    176520
     tacccgagaa tataagtctt atgctaaagt attatggatc tgaaaacctt tttgaaaaga    176580
     atcctcaggt ctactggagc attgtgatgt attttttata ttttagtctt ccattaggag    176640
     gccactctcg actcgataag gaaattgatg tgattattga tgaacctgta cttcccctcc    176700
     gtattgatgg gaaacccaga ctctatcttg atttttgact caggatacct aaccaatgtg    176760
     gtataactgt ctaggccttc tatcttattg cgttagaaga tctcagaacg agcctgtccc    176820
     tcgtagtcag agtctagtct ctctcttttc atgtaagtat atattggaac agtcagaccg    176880
     tgtatcacta cgctcagaaa cactgtgcag cttacaaaat ctatcgtaag agtctcttgg    176940
     attttgtctg taagaagtgc atagtacagc gctccaactc ctacaggccc aaaccatcca    177000
     acaaacagag cttctctccg agacctcagc tctggaattt ggcgatagat taggtagcat    177060
     atgataggcc tcctgacaaa gagaatgaca agtgaaacaa ttacattcga cagcgtaaat    177120
     cttcgaaaat ctattcttga accgaaaaat aagaagaacg aagtgctaag gacggtgtcc    177180
     gttatttctt ggagatttga gttcttagtc tctaatacaa accattcatc aaaggaaaac    177240
     attattcccg cgaagaatat gcatataagt tcacttccac cgatgaactc cataagtgct    177300
     attgaaaaca cagtaagaat cacactgtgg gcaagaaagg attccacacc caccagtctc    177360
     tttgtatagc agtacttcaa gctctgtctt gaaagaattc cggcagaaag tcctatcaaa    177420
     gcggataaaa agactctaat aagcaagttg ttgacaacaa atgggtaaat ccccttctca    177480
     ggtccgagac taagcaagtc aagtccaagg aagagaagga aaattcccat cccatcgttt    177540
     attccactct ctgctgcaag gagcaatctt attctttcgg gaaccatttt cattgcaagt    177600
     ttcccatgta ttatactgga gctgagaatg ggatctgtag gggtcagaga agaagccaac    177660
     gaccatgata ttggcatgtt gtaattggtg aaaaggtata ccaacccaaa ggaaaacgag    177720
     catttgatta tgcctactac gccaacaaga acaaatatcg actgccattt ctcaagtatg    177780
     tagttttttg gaagagacat cgcaacagtc attgtctgga tacaaagaac cattcttgaa    177840
     aagttgtaca ttataacctt cgaataaacg tagtttgtat tgaagacatt caatgcatgg    177900
     tgtccgagga ttatccctac taataccgaa atcaatgact ctgatagaag caggttgttc    177960
     ttaacatgct ttgagactag tccaaagaga agaacaaacg acgaggaagc aagcagcaat    178020
     acgaagatat catccatctg ttctaaatct ctagcttatt atggttgccg tggcttttgt    178080
     agaatgctgt tttaatctga aacaggttcg aagatatctt ctatcagctt tgaagatcag    178140
     gttttagtag taaagattta ttcaagaaat ggaaattagg catgttgatt taacgagata    178200
     agagactgac tttattctga tttcttcttg aaaatgtgct tgactttatc atcgttgagc    178260
     tcggagacgt ctgcattccg taactccaga acattcttac ccacaggtgc aactctggag    178320
     agtccaaagt cgtcttcgat gattaattta aacttcggat tgctcatcaa gtctcggaag    178380
     tcttctagtt tcttttcgca ggtctcttta gaaacgtcag gatttctaag gacctctcca    178440
     cccggtccgg ttgttatgtt tccctttcca cacaagtttt taatttgatc ctttccttgt    178500
     atcagaaagg actcaacatt ctggatgctg ggataagtgc tcgaaatttt gaaagaaagg    178560
     ttttctgaaa tgatttccac tgatgccatc tggcttaggt tgatttctct ggtaagatcc    178620
     tcttttctat cgaaaaagca ttcgattctg acacttcctc ttttatcata tgtcttttca    178680
     agaaacttga ccgatctgtc tccacatttt tcgcagacaa acgcacagat cacgttttct    178740
     gttgtatcgt caagatcaac aatattcatc ttcccaggcc acccacagct cgcacatttc    178800
     atatctgttt ccttagtgtt gtctttcact actctttcgt atccttcttt gtcttccata    178860
     agggtatagt ccttaggttc ttcttgaact tgctttctta atttacgact agtaagagga    178920
     caaattaatt ccgccgctgc aaaatctcca aatagaccaa ttactaccag agaggacgac    178980
     taagtagatc aatgaaagtt tgggaggata accaatcaga tgagaaatag aaaggctgcc    179040
     atcaacatga aaattcaatc tccaatatgt cttatccata ccttgcactc tccactagca    179100
     ctgcaactaa caatacttga ctttctaaat atatttacac tatccaagcc gattatgttt    179160
     gactcgtgaa gcttcatttt cgttaatgat tttccgctat cgaaccagac gctgtgggac    179220
     gaggctgcaa gaaggttttc gtcgatcaga gtggctgtcc tgatattctc gtttacattc    179280
     aggactttga ccttttggat tctcttatcc agccagatca cttgatttct aaaaaccacg    179340
     ataaaacctt ccttaacacg cttgattccc aaggcttggc ccttaagtat ttccatcatt    179400
     tctatattga gttcaaaatc atatacataa accctttgtc tatcggcaaa cataaagtta    179460
     tcttcagata tgcagcatat atgaaggatc tccccactaa ggacctcttc cctctcaaac    179520
     atcccttcaa gattccattt tctcatcatg cctccactgt ctaaagagtg gatcgaatcg    179580
     agaacttcat agctaactat tggcgctgca tgtcccctta aagtccctga cacctccaag    179640
     ctcattccct ccttcacgat acatcttacc agtaaaagct catttcctcc agttccacac    179700
     acaattaata tgtcattaga atgttccttt atcttcatct ctacaacctg ctttccgtcg    179760
     gtttccacac ccagttcttt ttttccagac aatagattaa cagcagtgat tgtcttatta    179820
     gaagatgcaa caaatagaag cttgtggtct tttgccactg cagagcacac cgtcacatgt    179880
     tcattgggta caaatgacat tgcctccttc aacccaaaca ccttgtctcc tactccaaca    179940
     ccagattcaa acagagggct ggaatctcct tgactgggag ccaaggacgg acttactgca    180000
     ttgccatttc ttccctcgtc tcggaaattc ctgggcggta ctttaccaga gggaacattc    180060
     tgttcttcaa acctaggata tcttgaatat ccttgggagg ctctatatcc aggtccagat    180120
     gcccctccct ttctcgggtc atagaaccgt gggcctccat cggctgttgg tgacgcctgc    180180
     ccatacattt catacatttt tctttggtca aattgctggt gttgataata cattgggtat    180240
     tgtttatatg gatccatccc ccctccatat cccatggccg tgggatccat tcttcctata    180300
     tgctgatatc gtctcttttc attttccaac ttcatcatta ttccctctat cctactgaga    180360
     tcctgaagat tcgatgataa cccggaccta actgctgaaa tgtcatgaaa tgctgcatac    180420
     cattgagcaa gaactggcat tccatctcca ggcttaaaat ccccaatccc tgcctcgtta    180480
     ataaataact ttgctgagcc ttcgtacttc atcttcaata ggtagtcata caccaacatg    180540
     tttagtgtgt cgtaaatacc cgaatccttc ttcttgtagg tataatcccc catcacaagg    180600
     ggtcttcaaa ttaaaaactt tagttacact atagaacacc tatctgctat atagagaaag    180660
     ctgatgtcat ttcaggatat cccttttcct ttccattaag aatacataca tccccctggt    180720
     aatatctctg gatcacattt atatgaatca taatatttat tacgtgtgtg gcttctactt    180780
     agtcactaca acagaaaagt cattcccaac atcaaaatct atcacttcag gaaattcata    180840
     tggaatcttc ttcggttcaa acagggtttc ttcttcatgt cccaatgcac cattgaaccc    180900
     ggttccccac gaatatagct catttccaac tttacctatg ctgaagctgt tataagaacg    180960
     aacagcttct actccactaa gcccaagttt ggtgggagat ttgaggtttt ccacattctg    181020
     gatcccaagc tgtccttcct tatttctccc acttccatat agactaccat ccttagttac    181080
     aaacaaactg tgattttctc ctcctactgc ttgagatatg ccgtccaagg gaaccttgta    181140
     tttgttgaaa gtgctttccg ccttatcatg ccccaactgc ccgtataggt tagatcccca    181200
     acaataggct tctccatctg tgttcagtgc tatcagatgg ttcaggccag atgcaataga    181260
     cttgaaccta tggttctgga ggcgttttct aggagtcgta actgcatctg gtataagagc    181320
     tcttaattta tttctttcag atgttcttct tccaagctct ccaaattcgt tcgatccaaa    181380
     ggtataaatc acatcctttg aatcaagtgc agctatgaag ctttgccctg cgctcaaggc    181440
     ccttatgttt ttgagaggaa cctttacggg ttcaaaagaa atgccctcag aaggagttaa    181500
     tccaaaggtc ccgtttgtcg atcgaaatgt tccccacaca tagacatgcc cactggaagt    181560
     caatgcagca gagatggagg ctccgcaatc catatctaca accttttctt gaagacaaac    181620
     tttttcaggt gtggattcgt ctccacctct tcccagagct ccttcgtcat tgcatcccca    181680
     ggaatataga gttccactag tatcgaggac caacgtatgt aatgacccac atcgaacctt    181740
     ggataaagac attccgtcaa aaaaagaaag tctggttgga acatgagtac ttccttcatc    181800
     ttctcccagc cctagctgag atatggcatt tgatccaaaa acaaaaacac tcattctaag    181860
     gactttcttt atttttgaaa atttattctt cctaggtata atcttctact tttttgagtc    181920
     cttatgaagc ttgaattttc caacggcttt gaagacttgg catttgtctt aaaatacttc    181980
     aatgccgatt ccagcctgga aaaggtggaa agcgggttaa ggcttaccga tgggggagaa    182040
     gaatacgtgg gactagacaa cgtattggct tttttgtaca gaacttacga gccaggacac    182100
     aacaataaaa gtatcaaaga aacaaagaaa ttgagggaaa gtccagaagt gaggaaggta    182160
     gaggaaagta tatcaagtct tgtatcattt tatgggctgt atcgtcagat gattacacaa    182220
     ggcatattaa aaaataaggt gtttatcgac caaatggttg agcatattag gccaagaatg    182280
     agtctggact ctgattttca actgctagac atacaggttg gagagatagt agacattggc    182340
     gatgttcaag gacttgataa gctttattct gagagggttg ttgcaaagga agagataaga    182400
     gttttaagtg ggctgaaagg ctatgtagaa aaagaacatc tattaggaaa caaattcctc    182460
     tttgttacca acatgaagcc agccaaattc aagggagaga cttctgaagg aatgattcta    182520
     tgtgggaagg ataaggatgg aaagatcgag cctattttga taccaaaaga gatacagaat    182580
     ggggccaggt taggactaga aggatttgaa atgcttctta atgactttag ttctggaaag    182640
     gttgacatga gaaagagtgg atatgcccat gctctagaat cgtttaagat aatagaccat    182700
     ttcctcactt ttaagggcat aaaggtcact tgcgaaggaa agttcatcaa aactcatact    182760
     tccgatggcc tggtaagttg attaaatcga cttcaagcga tgtaactaaa tagtgttttc    182820
     cttgattcta agataaataa aatttccagc ctggggcgag gaatagatgg aagttaaaaa    182880
     cggcatagat tacgtctttc gaggatctag agatgaggtg aaacaaacct ttaagttcca    182940
     aggatcagct atagttctga caccgtacag aagtaaatgc tctggattag catatttaga    183000
     agacagtgaa gaaattgtga tgacaccaaa gatggctttg gaaagaagtt tcgataagat    183060
     gaaaggcgga catgtgattg tagaggattg tgagttgatg gatgggtttg ggtatatgga    183120
     agatttaata tgtctgaaga ggaaggggat ttcatttatc cttctgaatg cccagaaagt    183180
     tcccaagttt gcagagaatc ctgtctttat atctagcaat agatacttta taaaagcaac    183240
     aaaggatgaa agatatgctg caatttttgc attatgtaag atttataaga atgtgtgcat    183300
     tatatgtaag gatgtagaga ggatgaagat gttttctgag attttcaagc taaatctgga    183360
     tgttgttggg cacggagatg ctgtagacgg tagaagcgtt gttattgtga tggatgggtt    183420
     ggtaaatatt aagtgtgaga agctattcta tgttggggat aaatgtaaag gaatgaaaac    183480
     gatggtttta gacacgagca aaattgggaa atttctgtat agggtcaggg atgtgtgtaa    183540
     tatgctttcc ccgggagttg taagggggaa aaaggaattg aatatcaata ggtttcgcgg    183600
     gattgagaaa tagaaatggc tagaacagtg aaatgacttg cgaagagacc cctatatttg    183660
     atggtgagct cgccggacag caaagtcttc ggcgagaatg ttattgacga aaagttggta    183720
     agaaagctat gctttggagg ggtgaggaac aagtaccgag gagttgcatg gaggattctc    183780
     tttcaggttg ttgggttgaa aaaacaattt cacagagagg aggtcgaggt cgggcatgct    183840
     aaatatgctg aaatggtggc tcggatggga tgttcttgcc aaatgggtga gtatttctat    183900
     gggggaagag atttgaacat agacaaaagc agccttgaaa acctaaacaa gacgaaacat    183960
     catgcactta agttgcctga aaagatagtg catcaaattg atcttgacat aaaaagaata    184020
     gatcttagat acaggactta tctaggagta gatatatcat atatgtatta ccgtgtatta    184080
     tggctgattg catataaaag accgctactt ggatatatcc aaggaatggc tgatattttg    184140
     gttccttttg tctttgtttt ttcgcatgaa gatgtcgaga gagctgaaag caatgcctat    184200
     ttctgttatg ctcggttact agatgagaca cagcacaaca taatggatct acaaacagga    184260
     atgattaaaa gtctggattt tgttttgcag atggtagacc cggacttgca taagttcctg    184320
     aaagacattg ggttagaaat acatatgttt gcattcagat ggtttaattg tttctttacc    184380
     cgagaattca agattccaat tctgctcaag gttttggata ctattttttc ctctgacagc    184440
     atcaatgagt ctttgctgta ctttggagta gctcttctga tgaagttcaa gcctgttttg    184500
     attgagaacg acttttctca taatatcctg tttttgcaaa gcatatacga acagacttgg    184560
     gaagaagcag aaatagagct tgttttgtca tcagcgaaat tttatagaaa agtgacttct    184620
     aagcaactgc tttggtctcg gttctggggt tgactccatc aagaaacgct gctgaaaatt    184680
     gccctttgtc tttatagaga tgtcagatta tagagaattt gttttgttta gaatgacccc    184740
     tgatgaatat agtctttctt ttattaggaa aggtgatatc agatgcattt tcccaattgc    184800
     cagtactcag aaaggaggat atatcgctag atgatgcatt ccttgtatac atctattact    184860
     ctaggccaaa tgttcattgc cccgcttgtg agtcattcaa tcaaagtatc tctgatcttc    184920
     aaaaatacat tcctgtgaag aaaataaatt tctttgagga tccaaagatt gcttcacgct    184980
     tctacacatt cttgtttccg tcttttgttg taagggacaa aggacgcagc taccacctgg    185040
     atgtggatag ttttgaggag ttggaagaga ttataagaga tagaaaatgg acccaattta    185100
     agcctataag attatggatg gatgtggatt catactttat taatatgtat tctcttgcaa    185160
     attgcatctt tttcaaggct atgcaaagat tatatgttgt ttttgacacc gttcccgaat    185220
     gggctataaa ttttggattt agtgctatca ttggatacat ggtttactct atatgcctgg    185280
     tcttcatggt accgccttca gataaaaaga aggaataaat atgtaacctc tgtgtatcct    185340
     tttcatcctc ttaatagaat attttgtgtg atcttactac cctgatggag gatcttacaa    185400
     agatactaaa ggaggctgtg aaagatcata cagaatattt gagaaagttt attttggctt    185460
     tcaaaaacga ccggaaggag ctggaaataa gactggggag aatagtttcc aaagaagatg    185520
     gaaacagaat gaaacttgat acggtggcac ctgttgtgtt caaaaacatc cctgcagaat    185580
     atagatttga gagtgcagtt gatcttgcag attttaattc tctcaagagg cttctttcct    185640
     cttttaagag cgagacaaag aatgatgtgg ttataattaa tgaggatgga agggaaacgt    185700
     atgagaatgg agagttaaag aaggttgaaa aaaaaacaag atcggaaaag cttgacatat    185760
     atattcctgg aaagaagtat gatgtgaggc ttgttttaaa tgaggagaaa gaagtattca    185820
     agcgtgccag taagaagaag gctattatga aaagaacaag gcgaagagaa acatacttta    185880
     tagaacctta cggatttgat tttacagaag ctattctttc aggggaaagg gaggagaaaa    185940
     gaaaatttga ggttgaagtg gaggtgttca gttccgagaa gctagtgtca agtgattttg    186000
     tctctttgat atacaacttc aatgttgatt ctcttgtata ataaattttt attcctagcc    186060
     aattggagag gagtttcggc ttcttctata tagaaatcag catgaactat ctcttctggt    186120
     gaataaggaa gatgttcagg tctggcttag cgacggaagc tgggaagaaa aactgaaaaa    186180
     ttttgtaccc cggatggaga gaagagaact aacatacaag atatgcttga taggggatgg    186240
     aggagtcggt aagacgactt atataaatag ggtgcttgat gggaggtttg aaaagaacta    186300
     caacgcaact gtaggagcag tgaatcaccc ggtgacattt ctcgatgacc aagggaacgt    186360
     cattaagttc aatgtttggg acacagcagg acaagagaag aaggcagtat tgaaggatgt    186420
     gtactacata ggcgcaagcg gtgctatttt tttctttgat gtgacatcca gaattacatg    186480
     ccaaaatctt gctcgttggg ttaaggagtt ccaagcggtt gttggcaatg aagcacctat    186540
     agttgtatgc gccaataaga tcgatataaa gaataggcag aagattagta agaagctagt    186600
     gatggaggtc ttgaagggga agaactatga gtactttgag atcagtgcca agacagcaca    186660
     caactttggg cttccgtttt tgcatttagc ccggacattc actggaaggc ccgatcttat    186720
     atttgtgtcg aatgtgaatc ttgagccgac agaagtcaac tacgattacc atagtcctga    186780
     ggaaacaaaa tatatcgact acatggagca ggcggcaaag atggcacctg aggagtaaga    186840
     ttaaaagtaa tacatcctat gatttgtttt tggtagaaat ggaaagaaat agaacgttaa    186900
     ttctgtcctc ttttgagccc tgaaatggag aagaagtttc caacagttgt gaccatagga    186960
     ggacgaagat atgttaaaaa taatattaac aaaagttctg tcgatggaag aatgaagtta    187020
     agagaagcga ttaagtccct gggtaggaag gtccagaagt ccaagatttc acattgcact    187080
     atcgagagta aaactagttt gcatgcttac aagctggacg attccaaggt cctcttcaac    187140
     aagaataaca agcctattgg attcatagtc actggaaaat cagagactat tgagaaggcg    187200
     ataggaaaag agatttctag aaaaatagat ggagaagatg ttccaaaaga atccgaaaac    187260
     atcgaaagag aggagaagcc ttaaggcctt tattgactaa ttaaatgttt ttaataagtt    187320
     tctagtcctg aaatgactct gtatgttctt cgattgccca aatgttcaaa agactcgaag    187380
     atgaaacaaa ctgagcataa caaggattga agcggacctt tgcattgtcg aagccgtgtg    187440
     ccttatatgt atgcaatctt cttttggttt taagatgata aacgaatatg gagctgtttt    187500
     cgcagcaaag gaagaatttc gagtctgggg taacgcatcc attgctgcct ttctccagac    187560
     ttattgagct ttttattgcc ccatctggtc caaggaagag atggcctttt tcgtcggacg    187620
     ctattatgaa atttccatcc gtagagtaaa atatttcctt ataccttcgc tctggaagcg    187680
     acgaagtatt ttttggtccc tttggatttc ttttatcgta taccttaagg agagtatcat    187740
     taattagtgt ggcatagtca ttagaaaggg acagggaact tatggagtta gttacattga    187800
     tcctatacac tggatttttc tttcttatgt cccagtagct cgtggagtca aaagacgaag    187860
     aaagaatggc atcttccatc ggacatacgg aaagagagtt tatctggctt ttatgtccaa    187920
     taaaggttcg aacatactta ttgtcaaaca cagacaaaag atgtagagaa ttggatgctg    187980
     catggaccaa tgcattagga tacaaaaact tgtacttctg tatgcttgga acatgaatta    188040
     tgttttggac gtttccagac accgacgagt acagcctcaa tatattgttc tgggtggtac    188100
     ttagcaaaag gccgtctgtc gaatattcca cttcttcagg agaggtgtct gggcccaagg    188160
     attttgactg tctaaactcg gagaatgctt cgtcggtaag gatcattgaa gaaggaggga    188220
     gaaaaaggag gctaaaagcg ctctcaaaaa aactcggagc aaaatacaaa gaggatagta    188280
     ttgtgaagtt tatttaaaat acaattgttt tcacctccaa ttaagataag ttatatgctc    188340
     gaagtatact ggctgttctc ttgcttcgag gcctagactt tttggaagct tcttcattga    188400
     atgttttgaa gagttcattc caggctttct gatcaatctt agtctcgagc tgggataaga    188460
     tttccgaaag ctttctgggc tcaaaagctt ctagtaaact tatcaggagc cttgacttct    188520
     cgtttgctgc aaaagaccgt gttatcgaga ccataaactc tgtgataaac actggattcc    188580
     aggtaaatat aagcccggaa attattctaa ctcttttgtt gtatttttct ttatcttctt    188640
     ctgttctcct gaagctcagg actttgatat cctcaaccag cattttctta gaaaagatta    188700
     ttatggactt caatgtccag tccttgacta tccacttcac gacaattatg aagtccgacg    188760
     tcttataatt atcaacatac ttcttcatgt tgtatgcaac tatacgtgca ttatcctcgt    188820
     ttcttatcca ttctccgaag tttgcatcat aagtgtcgtc catgtatgag atagactttt    188880
     ctatcttttc taaacacaag cccatgtccc ttactcctaa gtgactcttt ttatacgaaa    188940
     aggtttctcc tttaaattgc taagtaatcg gccaaatcaa tgcttagaat taattaagat    189000
     atagatgaca cccgggatct taataaagaa gtttataaag aatgggccct ccaatttgga    189060
     ttgccctaag catttcaaga atttctaaag aaaccttata gtctcctatt taataaaagg    189120
     agaaataaat aaaataaagc aggatagatt tattcatttg tactccgtga atagcatcag    189180
     agatgccggg aaatctattt gaaaacttaa tatgggtgga agttgtatga caggaaggct    189240
     tttaataact ttcttaaata gcaagttttg aaacatctac ctcgtacaga aagtctgaat    189300
     acagccaaag tatcttccta tgggaatcat atgcgattgc ctttggagga aaatacaact    189360
     tcacaagtgt tctgtgggag ttcaaggagt acatctctat cccatctgat agtagaaata    189420
     taagtattgt attgaatatc ttgaatcctc tataattttt tccctttctt attgacttca    189480
     atgtttctcc tctgtagaga atcaattcat agttgctctc aagaattaga agatcaagtt    189540
     tgttggaagt tgcagaaaca aatttcaaat ggcttagaaa cccgatagac tttatagaca    189600
     cttctttcct attccgggcc aagtattgaa cgagacacag atgatcttca accagaacat    189660
     atatatcgga cccaacctct gcaaagtcta ctatcttact gggcatagtt acaatatgcc    189720
     agggttgaaa ggtctggata tcgagaaaag atataccaca accatgagaa aaaatcacgt    189780
     tgttgcccac atggatcttc tctattctgc actctatttt tacaagtatc gggttgtcta    189840
     ttttgaagta gtagtgcccg taggtctcga tttcaagaaa tacaatgtcc ttaaatttaa    189900
     gtatttcttt tacttcattg gaaggaagga gtacatcttc tcttattaat ccgttcatgt    189960
     taaggatatg gagtgtattt ccaatgcaca tgagcaagtc ggattccgaa aattccatat    190020
     gcaagatgcc cccgttgaat gaggcctttc tgatcatatc atccatcttt gagatgatta    190080
     tgatgttaag ttgaaagcaa aacatgtttt gagtcccaga agtggcttag gaccgtagga    190140
     tgatatactg cacaattcta gaatttgaag ttttatttct ctccctggga gtacgaaaac    190200
     tttaaaacct gtttatcaac catctccaga accttgagtg tctcttttat ttggtcttca    190260
     ataagccttc tttcatattt gtccgtggtt tcactcattg catcaagctt tcgttttaga    190320
     gtggctagtt cattttcata ggcttttctt tccttaccga gcctttgaag agcttcttct    190380
     gctacagagt gttttacctc taccattaac gggcgtgata tttaaaaatt tatcattttc    190440
     taggcattac ggtttcaggc ctcatttcta cttagcattt atccccagaa agcggaaatt    190500
     aattcggtgt acatacgaag cgaaatgttt ctcgaacaat agttaagcct tctttgtagg    190560
     attgaaaaat atgtcttcta gatgccctta tgataaaaaa gatcattcac agaccaaaga    190620
     aaccgctttt tgtgtttaga agggaggagt ctttgctcta tgggcctaga gtcaagagtg    190680
     caccaccaat tgaaatcaac tttgaaacac ccaccagggt cgagccaaag cctgcagcaa    190740
     gatttacaag acctgatgga acacctataa gagaagagga tttgatagat tcgacagata    190800
     gtgatgcatc aagtgagagt tcggtagagg ctgaaaataa gattgaagac gtaccaccgg    190860
     agacaaatgc aaacgctgaa attcatgaag aggaagaagt ggaatgcaaa gaagaaaagc    190920
     caatacaaaa agatgataga cccagtctcg aggatagagc attaatgctg aataatcttt    190980
     tgaagagatt ttcggaacaa agaatcacag aaagacgagg gccctgctat aagattgatg    191040
     agattcttaa tacaaaagaa agaacagcaa ttcctcttga gctgaaaata aggattagaa    191100
     gggaactgaa aggagtatat aggccagaca gcagccgaaa ggacacgtgc attgaacaag    191160
     caaggcttga gttcaatagg cttacagcca agaacatagg cctcgtgata aagaatctta    191220
     agagcattcg tgttggaacc atcgaagaga tgaaggaagt gtcaaatatt ttattcgata    191280
     aggcgatttc cgagcctacg tttgtaaagt attatgcatt agtggttctc gatctgaaga    191340
     aggaatggca atcagaggag gagaagagta gagatgtaag ccaaactgtg ttctttggga    191400
     cacttcttac tttgacattg aagactctcg agaataaaga aagatgggga gatgagtata    191460
     agaagaaaaa ggatatgaca tttgaagaaa gaatagccta cgaagaaaag cttgaagagg    191520
     cagaaacaga aagatatata aagaaaagga gaacgcttgg aacaatcgac tttctatcgt    191580
     ctctctactc cttgaatgta ataagctacg tgcacatgaa cgcttgtatc aatacactta    191640
     tgaaatctga tgacccagaa aatatcgagg tgttatgcta tttgatcgat aacataggcg    191700
     aaaaacttgt tgttagtgga aaggagcaca ttatatcgat gatatgttcc agccttgtac    191760
     aaaagaaaag caactataca aatagaatta gatacatgat agaaagtctt cttgacaaga    191820
     agaattcttg gaagtcaaag gaattgaaag ctgtaaatgt gttctcctgt ctagaagtcg    191880
     aaaacgacta tggaaacact caagacccag aatctcaaga accacacaaa gaagacgtac    191940
     ttccattttt agcatctttg tccgaagaac tatcgatggc atacgaggac gatgacaaag    192000
     aacttctttc agataatcta caatcaggag aaactaagtt tggagttgtc ccattctatt    192060
     tatcgtattt tcaagaagct atatcgaatc ataagatttc agatctgttt tttgactttt    192120
     tcatctcgtt cagaaataca gcaagcatta ctgaaggcca gttgaaagag gttcttttaa    192180
     gtctcaagaa cgagctggag atcctgaaga ttgactttcc gatatctcca aagaaatatg    192240
     cagagcttat aacaaaactg agagtgtcca agataatatc ccagtctctt ctggaagagc    192300
     taaaaactcc ggactatgat gcaagaattg gagatctaat tctcaaatgg tatagatcag    192360
     ataaggatcg agaaaaggca cttactatct tcccaagaga aacgatagag aatctcacga    192420
     aataaagtat gatatttcat ttaatcttag gaatatctca cctcttatac atttgttgtc    192480
     cctgttactt tctttggtat ttcaagatgg aattgtagtg gtttaaagct agggatagca    192540
     aggaaagttc tcttccaacc tctttcttga acaaatgctt attcagggct tctacaacac    192600
     tttccctccg aacaatattg gcaatctcaa gaaatcttct atcgctgacg tccttgtatc    192660
     ctatcagggt aaacagctta tcgttttcgt tttcatcatt tataaaagtt ctagcaaatt    192720
     ttatggcttc tgtgtgtctt tctgcgcgca gtaagtcaac aaacaccagt ttcgacaaag    192780
     cctcctttac gagagctaca ctttcggttc ccagatcaaa tagtttgagg ctctcgcaca    192840
     ctctaaaggc ctcatccgtc ttttccttct ctataaaaga tagaattctt tttcttgttg    192900
     caatagatga ataaaactct ccatcgttgg tagattcatt gtggcggggg aatcttttgt    192960
     tccacaacat tagtgcctta tctgcacaaa cgaatctcat gtgatcggct atgatccttt    193020
     ttgcaaggga ttctagatct tctcttgagc gttccaagtc gttcttggcc atcttcgggg    193080
     cattatccat ccctcaaatg ttcactctca gtaaacaaac aactatcagt aacttctctt    193140
     cgagagtgaa atgattttct ccaaagagga aggtggcata tgtagtacta gtttatcgac    193200
     aacactatgt aactaaaaag taccaatatc aagaatttga taatatttcg tgtctttttt    193260
     tcaaatgaat tcatgtcttc ttgaagacag cagtatttct acattatttt aaggagacct    193320
     caaccaatga aatacgcagg atagggtaaa gggaacttca tctcacatca ttgaacttta    193380
     tgattttgtc caatgtactt tttgagtgct ggtattctgc agaaaccctg gaagccccta    193440
     taatcatggc aacaaatata aattgcaaga agaagtggca tccaagtaga tacgaaacac    193500
     agataagagt gaaagaagcc gaacaggcca tagaaaaaaa caaaacccag gaaaatacaa    193560
     gaaaagaact tggaagaaga gaaacccttg agtttgaagt tcaaaaggaa aaagccgaga    193620
     gaatgcagtg gatgctttaa gatcaaacgc ctgtctctgt tcatgaactt caagcttgca    193680
     ttgaggtttt ctttatagtg tatcttagat ttgtaggaag agctaataaa attttgttat    193740
//

If you have problems or comments...

PBIL Back to PBIL home page