(data stored in ACNUC8465 zone)

HOGENOMDNA: ENINT1_5

ID   ENINT1_5; SV 1; linear; genomic DNA; STD; FUN; 233397 BP.
XX
AC   CP001950;
XX
PR   Project:42703;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Encephalitozoon intestinalis ATCC 50506 chromosome IX, complete sequence.
XX
KW   .
XX
OS   Encephalitozoon intestinalis ATCC 50506
OC   Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-233397
RA   Corradi N., Pombert J.F., Farinelli L., Didier E.S., Keeling P.J.;
RT   "The complete sequence of the smallest known nuclear genome from the
RT   microsporidian Encephalitozoon intestinalis";
RL   Nat Commun 1(6):10-10(2010).
XX
RN   [2]
RP   1-233397
RA   Corradi N., Pombert J.-F., Farinelli L., Didier E., Keeling P.J.;
RT   ;
RL   Submitted (22-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Botany, University of British Columbia, 3529-6270 University Boulevard,
RL   Vancouver, British Columbia V6T 1Z4, Canada
XX
DR   StrainInfo; 819376; 0.
XX
CC   Linear chromosome is missing portions of the telomeric regions.
CC   Contains unresolvable sequence gap.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..233397
FT                   /organism="Encephalitozoon intestinalis ATCC 50506"
FT                   /chromosome="IX"
FT                   /host="Homo sapiens"
FT                   /strain="ATCC 50506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="nasal tissue"
FT                   /db_xref="taxon:876142"
FT                   /culture_collection="ATCC:50506"
FT   gene            complement(<1..>1063)
FT                   /locus_tag="Eint_090010"
FT   mRNA            complement(<1..>1063)
FT                   /locus_tag="Eint_090010"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(<1..1063)
FT                   /codon_start=1
FT                   /gene_family="HOG000215104" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090010"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU06_0090"
FT                   /db_xref="InterPro:IPR022115"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z7"
FT                   /protein_id="ADM12131.1"
FT                   /translation="MIWIYVVELLGLINVVWSSLEIGIEDIERRIGRKMNDAERKAGRE
FT                   VFENSPKILNYRKVILYPFAIHDNSFLVFPTTKYSEIEEGKREHVKKIIEGLPRLTLWC
FT                   MGFLNVPFCRESTMMLSDEVLQKSGLYKHFDSLSKKYEEDKMTFGDLAKKILEGCKGTL
FT                   EELGKLFVSKASEEIRKLKDLPNPDSEENKKKKEEFKEIKKHGELICNKREEKQIFEVL
FT                   NMAYDRCLSLWEREEYRENFIMKMRLKKLYVKEIKMEIKEPLSDYANNQISSIGYLDHD
FT                   LLIKIDREHGGEAVGELMKETFLEYKSDYKNEINRAVLEVEERKRREEKEKRKEKRKEK
FT                   EEKERKEKKANQNA"
FT   gene            complement(<2147..>2899)
FT                   /locus_tag="Eint_090020"
FT   mRNA            complement(<2147..>2899)
FT                   /locus_tag="Eint_090020"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(2147..2899)
FT                   /codon_start=1
FT                   /gene_family="HOG000149676" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090020"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0030"
FT                   /db_xref="GOA:E0S915"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:E0S915"
FT                   /protein_id="ADM12132.1"
FT                   /translation="MWIIDTVFSLRGREKYVCLNYSGRRERNVPREVFESIMRGEKIIE
FT                   LDISRNNIDRLPPYFEKLSFVKVLDASNNELKYISDSILGLASLEKLNLNNNNLLYLPK
FT                   EITLLEHLEELSVRNNQLRMLPEEIHNMDSLVRLDLGNNELAALPFGIGALDNLRILNL
FT                   EGNLFNTLPLILGYLENLEKIIFTKNKRLRKIPRKLIEILADSKSLVLLDLRGNNRLRE
FT                   ESSGDNVGWKELKNILGNKVKLSQEEEN"
FT   gene            complement(<3061..>3741)
FT                   /locus_tag="Eint_090030"
FT   mRNA            complement(<3061..>3741)
FT                   /locus_tag="Eint_090030"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(3061..3741)
FT                   /codon_start=1
FT                   /gene_family="HOG000149675" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S916"
FT                   /protein_id="ADM12133.1"
FT                   /translation="MNFKKNKMSVLANSLGLASMLVPTAIHLSDKLTGTNTILQFVAAV
FT                   SSSSFTAFMLIYWIVRNWCVNVSSNGAKESFLYLTFIVLCMTGLFTCIGEVFLYGLYNS
FT                   NVNILKVFATFSSVSYIRFKSLGLLPRPVYRCSSIGKIISIGAIVMITSAIAFHAKTGN
FT                   ALVVSWSFVLSGIALVLLSLWEETIPSETRDLWDISKAQLQAIDFIQLILFTLAYYWPD
FT                   RSKF"
FT   gene            <3937..>4716
FT                   /locus_tag="Eint_090040"
FT   mRNA            <3937..>4716
FT                   /locus_tag="Eint_090040"
FT                   /product="hypothetical protein"
FT   CDS_pept        3937..4716
FT                   /codon_start=1
FT                   /gene_family="HOG000149674" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090040"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S917"
FT                   /protein_id="ADM12134.1"
FT                   /translation="MEKTSTLNLEFQLFNLMAKSQSIEVLIVFGVIFGNMVFNNMKMES
FT                   LSFHLFGVVTVVLLTAYLLAIIGSTEFSENDDNTIFKSMAICSMVVTSIIAVIQSVCSL
FT                   MDLRKDRAKLFYSERGERLIIGGYAAIISILFLLIQISKMVSMKKIKKSVFVSVCIMMV
FT                   ASVFYFLLSEEIDQEQILSLIIGLALIVGIIVLINIGGSKEIDMKEKGTLPYVMSSIIV
FT                   FFITSALGAKVVGDKVKLVEKLASVFTVIDKCILTKK"
FT   gene            complement(<4796..>6091)
FT                   /locus_tag="Eint_090050"
FT   mRNA            complement(<4796..>6091)
FT                   /locus_tag="Eint_090050"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(4796..6091)
FT                   /codon_start=1
FT                   /gene_family="HOG000149673" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090050"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0060"
FT                   /db_xref="GOA:E0S918"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="UniProtKB/TrEMBL:E0S918"
FT                   /protein_id="ADM12135.1"
FT                   /translation="MTKTLSEVELFAATSITQLSILVYYLMLPRSAFLEFVFSAIPLYF
FT                   VVVFIGYSGLIYAGFSFMLIAYLLFTMFLEWKQRKSVWPWKSYAPSQYKQISSSVFQEK
FT                   DLNTSIAIDRTRSLIITSVAITIFASDFSFYDGRKLGKSMDYGLKLMDIGVGSFVYNAG
FT                   FFSVKASKQRKIKNILSSFFFGALRYLSKVILKLDVKDAEFGVHLNFFFMLGILNLASL
FT                   FIDTYANFLVGFAMCLFHEIFLKFFGLEEVIYNSTRSNLITANIEGITFLLPQMGMFLM
FT                   ASDISKAIFKRKNTNIIMFYNLLFFTIFLMTRTYSVPCRRIHNLSFAMIIMFLHTTQGI
FT                   TFGIFNKAFRIEELKMHRFTSKYLLFILVWSNLLVFINKHFFSPKNIPNYLAHGLCIAY
FT                   LFLVFYVPYVLKNMGFRRNTNQKDIKLFSHRD"
FT   gene            complement(<6106..>7998)
FT                   /locus_tag="Eint_090060"
FT   mRNA            complement(<6106..>7998)
FT                   /locus_tag="Eint_090060"
FT                   /product="translation initiation factor IF-2P"
FT   CDS_pept        complement(6106..7998)
FT                   /codon_start=1
FT                   /gene_family="HOG000105770" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090060"
FT                   /product="translation initiation factor IF-2P"
FT                   /note="similar to ECU09_0070"
FT                   /db_xref="GOA:E0S919"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniProtKB/TrEMBL:E0S919"
FT                   /protein_id="ADM12136.1"
FT                   /translation="MKMNGENERNLKSAKETVEANTTNGENSEFKSPICCILGHVDTGK
FT                   TKLLDKLRESNVQGEEAGGITQQIGATFFPVSELFKKCGRKESKLPGILVIDTPGHESF
FT                   ANLRTRGSSLCNLAILVVDIVHGLEAQTLESIELLKKRKTPFVVALNKVDRLYGWKSTS
FT                   FGEIKTTLKKQSKPTIDDFKRRVNNTVLAFAEIGLNVKLFYENTNQKRFVSLVPTSAVS
FT                   GEGIPDLVSLILELSEKYMGSKMKIKDEVECTVLEVKSVEGFGVTLDAILSNGVLKEGD
FT                   KIGVCGFHEPIVTTIKALLMPQPLKELRVKNQYVMVKEVRASLGIKIAAGGLEKAIAGS
FT                   RVLVIKNNEEEVKNTLAADLESVFSSIELHQEGVHVVSSTLGSLEALVSFLKASNVLIS
FT                   GVSIGTVKKKDMIIVASMVKKQKKYAAILCFDVVLDKEMKDMASSMGVRIFEAKIIYHL
FT                   LDSYLRFVNEEKEKDKKIHMEQAIFPVELSIVPKCIFNSRSPLVIGVHVKEGILKIGTP
FT                   LCVFKESETVKLGIVTSIENNKEAVQEAPKGLKVAIKIEAKPNIPPRMFGRHFEQSDIL
FT                   YSVLTKESINVLKKHFSDELTEDLTDLLNRLENKFGIFYLLFHSINTSLFYLFY"
FT   gene            <8275..>8691
FT                   /locus_tag="Eint_090070"
FT   mRNA            <8275..>8691
FT                   /locus_tag="Eint_090070"
FT                   /product="hypothetical protein"
FT   CDS_pept        8275..8691
FT                   /codon_start=1
FT                   /gene_family="HOG000149671" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090070"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0080"
FT                   /db_xref="UniProtKB/TrEMBL:E0S920"
FT                   /protein_id="ADM12137.1"
FT                   /translation="MNQDMISKMVPFLSKKSILMLYGITRDPKYPVYIIRRYKARLNII
FT                   PTGKAAMLIQRAVDMERNDLVMEYLCHVPPGRMTRILLKLAENIEPEKTQHMISDLKKS
FT                   NFCLMCSSNNRCEVIVARIENIVKNIRSYAYHCK"
FT   gene            complement(<8780..>12184)
FT                   /locus_tag="Eint_090080"
FT   mRNA            complement(<8780..>12184)
FT                   /locus_tag="Eint_090080"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(8780..12184)
FT                   /codon_start=1
FT                   /gene_family="HOG000149187" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0090"
FT                   /db_xref="GOA:E0S921"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S921"
FT                   /protein_id="ADM12138.1"
FT                   /translation="MKVIQQRNVYFLDLGKCVYRGFSETTIQREAGEDVLVYKSKDLAV
FT                   LSVDIIASSKLKTVNYTIKDATDAIDECERSFSRNMWKNINVDGTFEVRVPEEVRENTF
FT                   TVRILYEIGENNDSVEFYRPISPEDRHREVVACNRMFDSSSIFPSLSTPYKNKWELVYI
FT                   LPSSEEVKIISPGILKSIREEENVILYSYSVEMAHSGALNFCIGTFDSYEISTGDDRKA
FT                   VCIPKGSEGYKDCIREFCCDVENLIRYSEYFLQREYPFKALSIAFVFGDADKVYGQNTA
FT                   FLALSNLTSLNDIEPMFLLKRIVCDILSSQIFYFYFSIVEKIDFWIAEGMKGYFQDYCA
FT                   RHFLGNNEFLYELKKDRDYVLDRDVAEYALYDPRRTFFSMRDKFFKTKAKVFFHLLEGN
FT                   LSRAFMEKILNYTIKRKGDVKEDYSFEFVKLVKDVTGKDLRFLFETYVFKPGVVKVRLG
FT                   FTINKKSNRVDFTAEQTPTSIFSNGNKTICGPVTICSYEMEGIFEHVFMLDRENHFYYH
FT                   PKTKKKKKSEEEEEVMPLLWIRADIKGEHLARIVIEQPDYMFIEQLLDKNVVGQMEALE
FT                   NLSIKPSVQVCEILERMLENTHIFYKIRVHILYILSRTTIGSYYGFQRLIQYFVKKYCV
FT                   QTSTIVKPNDFSFIPYFIQKHLVRALSLADPFIFRNYSGREVGSASIISAFIINILKFN
FT                   DNSFNSYSDGWYISSVIESLSFPLSSMSFPEFYSGEHMKSKNKEHTLHRPGKTEDDIND
FT                   LFRAEGNSSKDFEKHGGLSLDDLSAGSDKGNMNSFDMNERYENRKSPYLSIDKEEGKRQ
FT                   DGDLSSVYKGGQSIRTESSENPDYLQLSVSEIERFRILDMVFPSHRNLVTKSCIYALGR
FT                   LSLFGMMSLKKNALIQLSKHPNFCSVRVAALEVLLSLFYEDEEVVNSIFEMLLQGTFTI
FT                   KCVAFDVMTALGSSPKFNFKKVLKGKRKEIFKLLRLNQGNAIVKEKIANLIYLIEDMEL
FT                   TRDEYHKAVVRIYERTLPNDLRKTINRLGREFMGDKRVTLRLNSIDTLKRKLLQAEYLI
FT                   RIPFSRTKKILGGFLERKEHIPSNPKPEADPTKKSFYRKTPNRKGVDDLKKTRKWGTQD
FT                   SPMDTSSVGSVIRIPNTCKIRLRHPEK"
FT   gene            <12255..>13835
FT                   /locus_tag="Eint_090090"
FT   mRNA            <12255..>13835
FT                   /locus_tag="Eint_090090"
FT                   /product="hypothetical protein"
FT   CDS_pept        12255..13835
FT                   /codon_start=1
FT                   /gene_family="HOG000149670" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090090"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0100"
FT                   /db_xref="GOA:E0S922"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:E0S922"
FT                   /protein_id="ADM12139.1"
FT                   /translation="MKKIKVDCGSFANSKVVEQLWEMISREDISLHQKSSIFLEMTEYK
FT                   KMNEKLVKRNNELIEENASMVSILEAQKENPNNASSLGEEAKFDAGLKISELNYEIRRL
FT                   DSVICEMQKRIARDLLQKETKDTPELERTEEKKHVVADSTTVTNEVYKKITEDYGDLKA
FT                   KMAGLESKHNEELCERDQKIAKLQRELKEVMSNAKDMGERFTILNTESGKWKEGLQTFI
FT                   GKELVLNNEISGCVPRLEKIEKDMEEIAAGLDVWMKKIEQLDAEKKELWKITENYKSYE
FT                   RVRNGSGTCDQGSLEDEIINLVESLDKSLGENKALVLRLEAAHKKNRELESEMISLKMA
FT                   SSDLRSRNAKLESDIKHLGMENRYTTQGDLGDHGLKIRKLESSLAEYNKVATDYKKRLY
FT                   TLSKEKEETEKILESIKKQNREMRDEMSRIAKTNSQIEAENKRLSGVLRAIQNGGSEED
FT                   TDLAVQLERYRGLLRCTLCDTRFKDTAITKCMHCFCEECINSRIRMRDRKCPSCNEPFA
FT                   PNDVKKIYL"
FT   gene            complement(<14074..>14586)
FT                   /locus_tag="Eint_090100"
FT   mRNA            complement(<14074..>14586)
FT                   /locus_tag="Eint_090100"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(14074..14586)
FT                   /codon_start=1
FT                   /gene_family="HOG000149669" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0110"
FT                   /db_xref="UniProtKB/TrEMBL:E0S923"
FT                   /protein_id="ADM12140.1"
FT                   /translation="MGLSFPSGDVGSLYSSLRRRIEQKKRQGAMYKDFIRKIYDLEDEL
FT                   DFISSEEQKNMVEGTKRRRRSTTLDVDEILYITGDEIAKDLRRILEGEDLDVFVENNTL
FT                   NVKGSMFTKGDKIKATINGDEFVGTIISMSEEDIVLKTKHYKRLRILLEDMRLAKSSIV
FT                   AIGRTNH"
FT   gene            complement(<14690..>15229)
FT                   /locus_tag="Eint_090110"
FT   mRNA            complement(<14690..>15229)
FT                   /locus_tag="Eint_090110"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(14690..15229)
FT                   /codon_start=1
FT                   /gene_family="HOG000149668" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090110"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0120"
FT                   /db_xref="UniProtKB/TrEMBL:E0S948"
FT                   /protein_id="ADM12141.1"
FT                   /translation="MLIKYYIEKSKSILLDEREVKRSKFDLLSDLCAVGGEGTDNIMND
FT                   VLDHKILQIRALILDLVDDDYTSDRKVIGRPEKWIKQITRDAEETFNFDDEFGKEVFSI
FT                   YNRKLLSEFCKIFISENRKFGASGNQLLLNFCYYERFVRSKMEFNFQGFFNKITSFFKG
FT                   HCYKSKEELERILDKR"
FT   gene            <15696..>16928
FT                   /locus_tag="Eint_090120"
FT   mRNA            <15696..>16928
FT                   /locus_tag="Eint_090120"
FT                   /product="protein transport protein Sec61 subunit alpha"
FT   CDS_pept        15696..16928
FT                   /codon_start=1
FT                   /gene_family="HOG000231249" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090120"
FT                   /product="protein transport protein Sec61 subunit alpha"
FT                   /note="similar to ECU09_0130"
FT                   /db_xref="GOA:E0S949"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniProtKB/TrEMBL:E0S949"
FT                   /protein_id="ADM12142.1"
FT                   /translation="MRAMMASNRGTLMDLGTSPVVTSSLIMQFLTMSEILKVDWSIKED
FT                   KNLHNATQRLISLIMTVGQAFVQVYTGFYGSPKSLGTIYCLLLVVQLIFSGIIIILLDE
FT                   LLQKGYGLGNGVNLFIATNVCESIVWKAFSPKVLFTGRGIEFEGSVIALFHLLVVRKNK
FT                   FAAIYEAFFRQNLPNLFSLLSTVFLFAFVIYLQGMRVELPTESSQVRGHVAKFPIKLLY
FT                   TSTMPIIAQNYIVGHISSISSFLYKRWPQYLFVRILGVWNTSKTGRYTPISGLSYYITS
FT                   PESLLEGLKDPLRFVIYLSIMLLTSAILSTSWLELNELSPEKAAQKLKESRMRLKGVRE
FT                   TNTVHVLSRYIPTAAFLGGILTSMVVIMSNLFDTIGSGTNIFLATSIVNQYLEMFAKES
FT                   IQKNSEIGFIE"
FT   gene            <16999..>17985
FT                   /locus_tag="Eint_090130"
FT   mRNA            <16999..>17985
FT                   /locus_tag="Eint_090130"
FT                   /product="O-sialoglycoportein endopeptidase"
FT   CDS_pept        16999..17985
FT                   /codon_start=1
FT                   /gene_family="HOG000109569" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090130"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="similar to ECU09_0140"
FT                   /db_xref="GOA:E0S950"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="UniProtKB/TrEMBL:E0S950"
FT                   /protein_id="ADM12143.1"
FT                   /translation="MGLEGSANKLGIGIMKDNEILANERLTYAPPPGEGFIPAKTAEHH
FT                   RSKILGLIAMSLEKAGINLNDIDIFCYTKGPGMGQPLAVVATVARTMSLYCNKPLVPVN
FT                   HCIGHIEMGRFITKAKNPVILYVSGGNTQIIAYYNKRYKIFGETLDIAVGNCIDRFARA
FT                   LKLPNFPAPGLSVERYARLGKNYIELPYVVKGMDVSFSGILSNIKSKIVDDEQLKYDLC
FT                   YSLQETVFSALVEVTERAMAFSNSKEVLIVGGVGCNLRLQEMMNIMARERGGTCYATDE
FT                   RFCIDNGLMIAHAGMLMAKSGASFSLDECFVTQRYRTDSIDVVWRDD"
FT   gene            complement(<18016..>20367)
FT                   /locus_tag="Eint_090140"
FT   mRNA            complement(<18016..>20367)
FT                   /locus_tag="Eint_090140"
FT                   /product="HrpA-like helicase"
FT   CDS_pept        complement(18016..20367)
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090140"
FT                   /product="HrpA-like helicase"
FT                   /note="similar to ECU09_0150"
FT                   /db_xref="GOA:E0S951"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S951"
FT                   /protein_id="ADM12144.1"
FT                   /translation="MRKMKAAGLSVEETYSDEDNHLAPDLVYKESIDEFLGRKILDSTL
FT                   KNRVEVEKPDTEIGKVAKRESVFLNMHPRSNTIPLIGEEISQEIPKKLPIESFRSDLMK
FT                   FIREHQVTVLVGETGSGKSTLVPKYLYQEGYGEKGIIGCTQPRRAAAMNLASTLGSDMG
FT                   SLVGYSIRFDNTVTRNTKIRYMTEGILLQELLGDKLLKKYSVVILDEAHERSTNLDISM
FT                   GLLKCVLKERKDLKLVIMSATIEAQKFSNYFGCSVFNIEGRSFPVEIRYLSVNVDDYVE
FT                   WAVKKILYIHENCDEGDILVFMTGKEDVEGVVGIVNHYAQNKRLSKEKEDGREMDLKAL
FT                   PFYSQLSEEAQSQVFLRERNVRRCIVSTNIAETSLTIPNIGYVVDTGLQKISIYNYDTG
FT                   ESLVKIPVSRAGADQRAGRAGRTRPGVCYRMYTASTYENDLLPSSVPEIQRTNIHDVIL
FT                   LLLKHGVQDIFGFDFLDSLSRELIHNALFLLYRLGAVCQKGLLTKSGEEMSELKLEPPL
FT                   ARMVINSINYGVVDEITSIVGMLSIYGLFDKDFDKSSSLYHQSCDFITLLNIFNEFISS
FT                   KNRNEWCNKVKVNGDALKKAMEIKKAVLMTLKGRGIEISRARSLEQIQRCIVSSIYYNI
FT                   AKRSNKGYVSLSNFRKCAIHPSSALKDNPCQYVLFYKHLSTRAEYMYCCSDISPQVILE
FT                   EAGDYYRDRNEILGAQKYPAYKSLGCEVYGEENLEYDLLGSLSSRARILDKKEISLGGS
FT                   LYDRFEKWTEPEEDKEETVELPRKIRKPRL"
FT   gene            complement(<20449..>22992)
FT                   /locus_tag="Eint_090150"
FT   mRNA            complement(<20449..>22992)
FT                   /locus_tag="Eint_090150"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(20449..22992)
FT                   /codon_start=1
FT                   /gene_family="HOG000149667" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090150"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0160"
FT                   /db_xref="UniProtKB/TrEMBL:E0S952"
FT                   /protein_id="ADM12145.1"
FT                   /translation="MKNNGSEKDEDDFWKILSESDSEYEQEIGLLFRPRTEGVNPESKI
FT                   EGEGQKVEASNTSSEELEKNPGEIPWAEEDISDRSGKKEEEKKDPEETSSWEAKTQEKS
FT                   FSGDKLENKEEVMEMKEVRNESKFSRLEVSTKSEPVADSEVKISSVDEMDFLWDDDEEF
FT                   ILEGVSNVKIEKEASNGKEDLQDTPLQEKPCIEEETIIKEEETPESCGESKQIDSTNLF
FT                   IGSPTGLQSTKMDPMKPKPLSKFVCGNLITVFMSSQKRFNIQGEAIQSYINVSEWYRPD
FT                   YILPDIKPSNFVSSLERNGDVKYMHVYELVQLKTISIDNISRIVSDTKPVYCSKDINRS
FT                   ISAESMNKLIELCIEDPDKAFEYAMENEIWEVGILLPKWSKGVGNKFLEKFCNSSCVQL
FT                   ISLALGFSKCSFKLNGNWKAYIREVLSTKSININNDFILQVFDRSIPDALFVIIASHLL
FT                   GIGDINKYLWMFSKNFEALRVLCYVEHIFGHIKDLDLLKYEFVSVGIEFDRQKAEEYFK
FT                   ANRKCFRKELGSSLESVFDTRWSFGLKSVFDFGIKKILNVDSFEDDLEKNGVSAPKETS
FT                   LGPIPSEPSRKDESISETASFDKKNRVTCIDSHETSVNTKEERGVLESRAPEIKENDGV
FT                   LNREEWIKKSDARKKDGMYRLSQEETLLKYDNQELETSDRELSVNSAPCEIKERSNLYM
FT                   DTKQSKSFADFFESNKKEEEIRSEDDTSLFLSKFMDDELPTSESKKKESKKSGSFFGFL
FT                   NMFKKETVHKANIDVDDDFRYDPVEKKWVGGSSNEGKSGDSPAVKPREIPKPKIGVGRP
FT                   AKNELDTNVTSMYANRKSAGNKRIPGVLGKKNNEN"
FT   gene            complement(<23117..>23713)
FT                   /locus_tag="Eint_090160"
FT   mRNA            complement(<23117..>23713)
FT                   /locus_tag="Eint_090160"
FT                   /product="GTP-binding protein"
FT   CDS_pept        complement(23117..23713)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090160"
FT                   /product="GTP-binding protein"
FT                   /note="similar to ECU09_0170"
FT                   /db_xref="GOA:E0S953"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015600"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniProtKB/TrEMBL:E0S953"
FT                   /protein_id="ADM12146.1"
FT                   /translation="MRSTYKIVFLGSSNVGKTTLMSQYLHQEVQRSYGPTIGLDFVSTT
FT                   IVVSGHRVRLQLWDTAGQERFNSIIPNYTRNSFLAIIVFDMKDKASFERIDHWINTLTK
FT                   ANDNPGSKVRILIVGNKKDLADEETQEWYKEVGSKKAKKHGGEYVETCAMKHEGIEDLV
FT                   KAVDRLIEEDLEDPAEDESTVRLESIKYVKGRRCC"
FT   gene            <23877..>25346
FT                   /locus_tag="Eint_090170"
FT   mRNA            <23877..>25346
FT                   /locus_tag="Eint_090170"
FT                   /product="hypothetical protein"
FT   CDS_pept        23877..25346
FT                   /codon_start=1
FT                   /gene_family="HOG000149666" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090170"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0180"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E0S954"
FT                   /protein_id="ADM12147.1"
FT                   /translation="MFLKKLLAIAAKNETLVHTTSAYTMYNTTFENKRATKLAFTQPPV
FT                   AYSFLRKIKHDNIVGIYKLNVEKGYLITKRLFPFCSVFRKETREFNKYISFKIAQAIVF
FT                   LHTQCGVVHGNIVKDSLFFNEEGGIVLGGFEKSRNSSVFDQDNIMFSNLVKELTNVDTT
FT                   LVKVAGDERFCSDIFLDLDIAFFGYKSFTTEQKLDFISKARKSKNEFVDIHKRRISWMI
FT                   LGDINSSTQKDFKILAVDFVLGFGVSDMEEFLPPLFSILDTGIRLYLLRNSDKYISRIV
FT                   SLDPIIKSLSLGIKCKDKELREETIVFIKENINMISKKQQSEILETMHGYILDDQGMQL
FT                   VLKFLCDVRPVFKKTDVVYRILCKYLIQSKSKVKVLAAMEIFYETFDNFKMTTELLPLL
FT                   CGYLSNRHAQPAVFSLIEKVLEHLKEHKTEIVDKEWKIGNIKNIFKPRSPEGQGTIPSG
FT                   KVETPSEKSENELSQDHKEWKSPEDGWDDPW"
FT   gene            complement(<25462..>26724)
FT                   /locus_tag="Eint_090180"
FT   mRNA            complement(<25462..>26724)
FT                   /locus_tag="Eint_090180"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(25462..26724)
FT                   /codon_start=1
FT                   /gene_family="HOG000149665" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090180"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0190"
FT                   /db_xref="GOA:E0S955"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniProtKB/TrEMBL:E0S955"
FT                   /protein_id="ADM12148.1"
FT                   /translation="MGNTQSSMNRDPVIARSNPSAPGVLRLYNLEDHVFPYKVAKSVES
FT                   YPSVHLATSLSSFERLVSRHLPLSPRLEEITGKEMDIYHNVVNKEETAWEILTSGERVT
FT                   NIRHNSKEDRSQVYMCRQFVVEITEGIGEIRDLKILQACCNYLTRLPQHIGCLTNLKVL
FT                   VLSKNRIQKLPEEIGLLKNLRELNLSQNLLSSLPKGISALKALNALHIDNNLFVVLPSV
FT                   IGRLYGLKYLNVSNNKIQNIPLEILKLPFLIELAATSCNFTPEETVEYIGHVTLKETCS
FT                   RHLVRNNLNVRRSIDKPLIRYLLSVEECSFCGGPLFENYYLHRSMQTFDSERFPIVYKL
FT                   CVKHYVRHEDRITTLFLGPLKTYPQRLIKSNMPLVSELFNHFGYNDEQKRIFNQGWSSE
FT                   ETDQMPLICLSKYAGMYIEKN"
FT   gene            <26976..>28175
FT                   /locus_tag="Eint_090190"
FT   mRNA            <26976..>28175
FT                   /locus_tag="Eint_090190"
FT                   /product="leucine-rich repeat-containing protein"
FT   CDS_pept        26976..28175
FT                   /codon_start=1
FT                   /gene_family="HOG000149664" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090190"
FT                   /product="leucine-rich repeat-containing protein"
FT                   /note="similar to ECU09_0200"
FT                   /db_xref="GOA:E0S956"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:E0S956"
FT                   /protein_id="ADM12149.1"
FT                   /translation="MTEVTSADYSKQGYHEIPKTAYTTPINWLILSDNKIREVPESIKE
FT                   LKTLSRLALNDNRIEEIHPGIGSLVGLTWIDLTRNRLRSLPDEMSNLKRVSGLGLSENN
FT                   FSEIPRCIFKMTNLRKFGFFSNKIRTIPKDIRFLINLIKIDLSNNEISSLPDEFCELKN
FT                   LNWLNLSNNKLQKLPDGINNLVQLEELGLGANCLTELPDMSNLRKLRILPVFKNQLTHI
FT                   NQSISRLSSIEKLDFSDNNIIEFPGHVIGIPTLRYLNLKSNKISKIDPSTFRSRVSSVS
FT                   IIDVSDNLLSCIPLKFFKTFSNVTVIRVGENPFVYHESKPAPSPALTELCYNKCLNMQY
FT                   KCESWIRKRYPNVKSCDACSKLFTTQPHLGYSLSSVGDGSTFVVEKMLCSYGCYKNEYK
FT                   "
FT   gene            complement(<28199..>30349)
FT                   /locus_tag="Eint_090200"
FT   mRNA            complement(<28199..>30349)
FT                   /locus_tag="Eint_090200"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(28199..30349)
FT                   /codon_start=1
FT                   /gene_family="HOG000149663" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090200"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0210"
FT                   /db_xref="UniProtKB/TrEMBL:E0S957"
FT                   /protein_id="ADM12150.1"
FT                   /translation="MENLKRTKRTETQNKTFRMYLKLKEMPQGSCVDEDVLQHLVRNME
FT                   LRKEVLDTLLGVIEVLRINAPRCFLSKEEKRRFFKLLIEVLPKEKINLETFITYRIPSL
FT                   LTDKDLISKLSGLIGVVSGTAKKYLKEIIIILIEEGTEDTTREVIRSVLLHIPKDPEIS
FT                   SIIEVTKEISMPAVALIMENFEDKVYADVYSNLSFREHLCVRNIRGQGKLKYLTAAMTE
FT                   ENFEKLCNFYIGDKDKRVIKILAENCSPKHDEIFHKILSNCNEDIRATLLEKTSFKDII
FT                   EYSLDIYERILDTSHKVRAVAFNIFRSGMDLCRNLLLEIVESSEENQKNYTKAGSEREC
FT                   LLRLIEFILRGVFTSQRKEYIDLLNEFDLPWEFYFRIKSFKGTDVFLEQSLEKIKKEKG
FT                   EPPECREKRRFYLKYFFCGELSKQKINELIRTDIQSALVYLQGKDIKEYRDLLVGRALA
FT                   NNSTEEVLMIVDMIKAHLKDQVWPSCPKSDAELLVYAHSKHSSIFVRQVLDFDVTFPML
FT                   YFLSYMRIPVDVLLPLLLKYKGSSKEHVEIQLGYNDKRLLQEFIEYFMEISLDEDSKIK
FT                   LVRSRTFVGSMIYFVNTGYVNIKNIDFFISSIYFICTSSNNEAKVKHIYEIYSMKVDQG
FT                   TFNRFYTVCLKLKGMSLNKEPYEIDDGTVLIKRNDRILFLICETVLGVREGNVVDEKFN
FT                   LQAFFHPISENVQSMISSGRVV"
FT   gene            <30410..>31207
FT                   /locus_tag="Eint_090210"
FT   mRNA            <30410..>31207
FT                   /locus_tag="Eint_090210"
FT                   /product="hypothetical protein"
FT   CDS_pept        30410..31207
FT                   /codon_start=1
FT                   /gene_family="HOG000149662" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090210"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0220"
FT                   /db_xref="UniProtKB/TrEMBL:E0S958"
FT                   /protein_id="ADM12151.1"
FT                   /translation="MPNSRGLKRLYDSFFCSRTIYLREEETLAIKSFLHSKRPVLHICG
FT                   NPGTGKTHVTVNTIEGSFLYLNYYSESDIFSKIKNSNSPVVVIDEFDKYYNERRNECMQ
FT                   AMHYLRSRQKLITISNDLRMSGDVLFFRPYSSSDMEKILAQKTLKESAEAILSPIAIKI
FT                   VSKRIGPSGDLRQLFRYVQEIVGRKIMEGGSLEIDLEDIPLEKENLDSKPNNVHHSIIT
FT                   SLISKNKKASRMEIYSKYLRECQEMKISSHDRTDFNIIYDIYT"
FT   gene            complement(<31231..>32058)
FT                   /locus_tag="Eint_090220"
FT   mRNA            complement(<31231..>32058)
FT                   /locus_tag="Eint_090220"
FT                   /product="DHHC zinc finger domain-containing protein"
FT   CDS_pept        complement(31231..32058)
FT                   /codon_start=1
FT                   /gene_family="HOG000149660" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090220"
FT                   /product="DHHC zinc finger domain-containing protein"
FT                   /note="similar to ECU09_0230"
FT                   /db_xref="GOA:E0S959"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:E0S959"
FT                   /protein_id="ADM12152.1"
FT                   /translation="MGKIRPNFRMTLLISSLAFTYIAPLSEIILPAHFTFKGTYVVLLL
FT                   LSSTLSAIYLMLSILYRGHVESNSEAINLIDHDEIKRFCKKCRNHKPERAHHCSSCGHC
FT                   IKKMDHHCFWINNCVNYDNQGHFIRFLFFTALANWLIFLYMSIEFIAVLLFNKPLRHRR
FT                   DYYILVISGISSLVFLVMTSFFFYLQLRLALMNMTFIEEMKQEDMNKIQGLTTLRSPYD
FT                   RGIINNLIDTLGPPYALFLIGPFGDGMTFAKRHPIEHWKLQYDYHCIEDLIVI"
FT   gene            complement(<32150..>32968)
FT                   /locus_tag="Eint_090230"
FT   mRNA            complement(<32150..>32968)
FT                   /locus_tag="Eint_090230"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(32150..32968)
FT                   /codon_start=1
FT                   /gene_family="HOG000149659" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090230"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0240"
FT                   /db_xref="UniProtKB/TrEMBL:E0S960"
FT                   /protein_id="ADM12153.1"
FT                   /translation="MEGTWNHNVKDEDGGKLNRSSGIDEKIDILSKVSDNPFDVLSRSL
FT                   YKKIKISNEECPVGDNRMEDAIFEELLVRNKEKPKVEDEKILYGIFTSMVLMADIEIQA
FT                   QEQKMYKFPFELETKNDGSPLFRRMYSEYLIAIKSAFREYKKNNTKFCVKLKNNFLLFD
FT                   SCLKATAGLKKELIRNEIVFEEEGSFLIIKGLEIALVFDYIVNIPISSSFCIPFILSQN
FT                   PFENGILFSVKLQKKRAIREGKRILYSYELLGPFWADDYKDLIPFCTKIT"
FT   gene            <33061..>34317
FT                   /locus_tag="Eint_090240"
FT   mRNA            <33061..>34317
FT                   /locus_tag="Eint_090240"
FT                   /product="hypothetical protein"
FT   CDS_pept        33061..34317
FT                   /codon_start=1
FT                   /gene_family="HOG000149658" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090240"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0250"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="UniProtKB/TrEMBL:E0S972"
FT                   /protein_id="ADM12154.1"
FT                   /translation="MPGLVGGILEDYGNIPQKIGFFLGKRNGSTIEYIVQNTSLTYSQV
FT                   MHGLSLMIQRRLVRYFQYEKKVHYVLDVDMVYRRMYFGIYCNLIEDMFGADAAEKFMEV
FT                   LIDGFSKADIFLEEKIREIIDAGMIIPIGRKEASLLVAGARDPTEWMRRARMEKEEEKT
FT                   ERKNRKTEEIQRFYIVDFGLLDSILINNMLLSFVRKRYLSKAEKIYRSILKCNLVSIDS
FT                   IIGSFEEETSISRGDITSCIKYFSNCGLLQKSLDCSETYFKDEDSVKEILVVDILNRIL
FT                   SENSKEGQRIFNMMLEYKTLEDKDIVIKSLIPSYMVKKSLIMLHSKGFVVLKRTESGES
FT                   KPVLQWEVNTGRASKVVREEIKEMLEVSWASVNQRWKYIGLNGDGEDEGYKALDHMLGL
FT                   SLDFFILGVRNMDFKSEMF"
FT   gene            <34353..>35555
FT                   /locus_tag="Eint_090250"
FT   mRNA            <34353..>35555
FT                   /locus_tag="Eint_090250"
FT                   /product="hypothetical protein"
FT   CDS_pept        34353..35555
FT                   /codon_start=1
FT                   /gene_family="HOG000149657" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090250"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0260"
FT                   /db_xref="UniProtKB/TrEMBL:E0S973"
FT                   /protein_id="ADM12155.1"
FT                   /translation="MAKSLEQALLRISELEEKIENQQIIIDALVARMKKMAGSDTSIAL
FT                   EKCCKEQEECNPRKEISQDMVRLEFRKEEGKKDRKDGLSFEEEIEDLFRRDKVPKQFKD
FT                   TFTIEALISYSKESHSFSLNSRVDVKMKKSFHTNVKQQIDKISRHIMVNLNTYDLNTIC
FT                   STLNLISGDLEYQHKLVTAHDIILFIDDFSRIPFIISALFNNQGIRNDVLGETIKEILL
FT                   HQCMVDSDIHKNHPHIVSYYNKIVSNFELHPKEKSLKDICANLVVSFDVFENGAFNPMI
FT                   FPSMYSVRALCHYMDWDYAYNEFICTVLYPRLRETRDPLCAIYMSTVALNAMRVFGAIE
FT                   SVELVFEKLKEFMNDASDLSITIYLFIKQIDPQRANVWYESQVERINHVDGEYLKNLLL
FT                   Y"
FT   gene            <35613..>36530
FT                   /locus_tag="Eint_090260"
FT   mRNA            <35613..>36530
FT                   /locus_tag="Eint_090260"
FT                   /product="TAF4 transcription initiation factor TFIID
FT                   component"
FT   CDS_pept        35613..36530
FT                   /codon_start=1
FT                   /gene_family="HOG000149656" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090260"
FT                   /product="TAF4 transcription initiation factor TFIID
FT                   component"
FT                   /note="similar to ECU09_0270"
FT                   /db_xref="GOA:E0S974"
FT                   /db_xref="InterPro:IPR007900"
FT                   /db_xref="UniProtKB/TrEMBL:E0S974"
FT                   /protein_id="ADM12156.1"
FT                   /translation="MNKEAFERLPQEKKKIIETAYFSAVRKEISASQFFGVCKEALTKD
FT                   QFESLFSNNTPNKEQQEEMKTEHLQDIIQYSGVDLKEEAEHIVRETETNINFGEYEEED
FT                   LNNQIGSLLNIPLFREFVARIGNSRRVGISEESFFLLFQVVKRKILDIVEKMEESSKWR
FT                   VEYNLSEFIIRINNDLSRQLWCLEQIEKAELEKFTIRKGEEEGRKKVKKTIQEREDLVI
FT                   KKRLSNTVALAALGIQQKSWMSAEDVRVNEESTTFNSIYSPFDEKALERKVVNRTITMK
FT                   DFLYVLERDRRYNKSIFTIQHYFR"
FT   gene            <36982..>38016
FT                   /locus_tag="Eint_090270"
FT   mRNA            <36982..>38016
FT                   /locus_tag="Eint_090270"
FT                   /product="hypothetical protein"
FT   CDS_pept        36982..38016
FT                   /codon_start=1
FT                   /gene_family="HOG000149655" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090270"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0280"
FT                   /db_xref="UniProtKB/TrEMBL:E0S975"
FT                   /protein_id="ADM12157.1"
FT                   /translation="MEDYIGIRLLFETSKGVISGMLRAVDENSGKLIIEDMNEMKDVLI
FT                   EDIQRLEIAEESSPNLSVGHNSKEEKRLENTPSIDVDSKGMAGKVVSGKHLVGYSSRKE
FT                   NLDLVSEKSKSGQTDESRTSYENDDNVRSSSKVGSDRRRDGYNLETSEEDYYRMMGRAF
FT                   SYFGPLEEEFCSIAARQTYRIFSTYFNNSSLRVEVFVAGDDVFSSIGFILGRLLLHTGK
FT                   MSSIICNENLLRNTRYRQSYLNSGGVITNRPAPEPSIHIYSCNKSLVPAWARNNIRGSI
FT                   YLDMPGHNSEEKETKIGLCFGSIPAYHRRFNGIVYFVDIEYPAPLYEEFGLQKPTRSKI
FT                   HKVK"
FT   gene            complement(<38022..>39722)
FT                   /locus_tag="Eint_090280"
FT   mRNA            complement(<38022..>39722)
FT                   /locus_tag="Eint_090280"
FT                   /product="Ca2+-binding actin-bundling protein
FT                   fimbrin/plastin"
FT   CDS_pept        complement(38022..39722)
FT                   /codon_start=1
FT                   /gene_family="HOG000149654" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090280"
FT                   /product="Ca2+-binding actin-bundling protein
FT                   fimbrin/plastin"
FT                   /note="similar to ECU09_0290"
FT                   /db_xref="GOA:E0S976"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="UniProtKB/TrEMBL:E0S976"
FT                   /protein_id="ADM12158.1"
FT                   /translation="MTQQEEKEWQEVQKKTFTKWVNEKLVKGGHKEIGDIFEDLCDGVK
FT                   LAHLLTALQKDVVEYNPAPCTRIQKMENVERILSFIKGKKVKLINIGPADIVDGNPKLI
FT                   LGLVWSLILRLSIAEITEAGELSIRNELLRWCKEVTNGYKNVNVVDFSRSWQDGLAFNA
FT                   IIHRFRPDLVPNFHELKPSKKAYNLSQAFRIAEKSLNIKKLLDVEDIAEVSIPDEKSIM
FT                   TYVSGYYRKFKEYEKEKLALNRVKGVLEAVDWSIQARNLYEVKARSLRSLIQDLSNQKK
FT                   EVCKMIRSLNKAFELMLETNSKAMHESTEIHSLFGSINAIHDLYRIKRYFPPEDVSLDK
FT                   LEFPSLHPESIANSIEIKKLFDPSFQSEFDALNRIFEFFKHVFAKGENMKEQMQGTSEL
FT                   KSRLMEMTFTHPLTKTQKEGFKNIAAKKLETLEKILSKREKEDKILESATALFNKAVKK
FT                   NECGISPMDLCWCLSQLGLSVDEGMVPFGNPEGRISLEDYLLIVKEMHNTLFDSVELKK
FT                   AFEMFSVDDILDLKSLNIEGKDLRNLYDSNGEEEPSLSVSKFFENFIEN"
FT   gene            complement(<39830..>40864)
FT                   /locus_tag="Eint_090290"
FT   mRNA            complement(<39830..>40864)
FT                   /locus_tag="Eint_090290"
FT                   /product="RhoGAP domain-containing protein"
FT   CDS_pept        complement(39830..40864)
FT                   /codon_start=1
FT                   /gene_family="HOG000149653" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090290"
FT                   /product="RhoGAP domain-containing protein"
FT                   /note="similar to ECU09_0300"
FT                   /db_xref="GOA:E0S977"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:E0S977"
FT                   /protein_id="ADM12159.1"
FT                   /translation="MMLRDFPKKRKIFNIAEMKEIEETYSRTDESLPESRVSSSTCSQE
FT                   CSPQVILQPISENDRILGKSLKDNSFPGSIRSFNARLYEDLFSSTTIQGRRKSSIFPFI
FT                   GVEGESREFRYDLLSTAQKIELNRFCCNAFRKRTTNTLFAWMNCFQKKRRIGHCRQINP
FT                   MVFDVIESLKRRAISTKFIFRYEPDKLSAAKIARQLHENKCTDIESIDVLVLANALKNY
FT                   IREHLDGLVPIEAFERIRSCIISNDRHAREALFSYMPFIFTDTERKLLVSLFELLSMID
FT                   RNSGVTEMNIDSLLGLFSLVLHPQAAFTTLDDLEYVKTITRELYRLDFETIPQAVVVHE
FT                   LIFV"
FT   gene            <41038..>43482
FT                   /locus_tag="Eint_090300"
FT   mRNA            <41038..>43482
FT                   /locus_tag="Eint_090300"
FT                   /product="telomerase reverse transcriptase"
FT   CDS_pept        41038..43482
FT                   /codon_start=1
FT                   /gene_family="HOG000149186" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090300"
FT                   /product="telomerase reverse transcriptase"
FT                   /note="similar to ECU09_0310"
FT                   /db_xref="GOA:E0S978"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003545"
FT                   /db_xref="InterPro:IPR021891"
FT                   /db_xref="UniProtKB/TrEMBL:E0S978"
FT                   /protein_id="ADM12160.1"
FT                   /translation="MPKLLKNFGFSSLRKFLAAYDIPDLPNIVDRVYIKADRKPSISSF
FT                   DCKLKEIELISKAIRMLLSRDKENHLCAGYKRWSSGPHDSDFRILCYSPSASSKILRSH
FT                   EWSHLMKSIGDELAFFILTECLVIQMLNGSYIFLAGDFKSLSKMAIERGSNAINRSVIF
FT                   YKHNQKISFSSLSAFEYVFEAHNSEKYKTIQRDTRDILESIEKRWKKIPIHSMFRSFFK
FT                   DELTLEGKGNILECSVKQSKLVNFLFLISKKLLKDAFDSHAFRILKSKLSLLVHRNRYE
FT                   TVSKNEIAKYFRISRFKFFRAYRCRRSEFIFRSKISSRFLVYVMEKLMIPIISRHFHST
FT                   ETSFSKFKVHYFPRPIWQHFSDIYIERFLKRFEQVEENKTYPYSELRCIPKMSGARVIS
FT                   NMSRIRNGRPSINRNIYPEFCVLREETRGMLGNSILNHSGMYEKLIPYLIKSTKPLYIL
FT                   KVDLSGCFDNIPQDEVVNLVKRLLSKSRYCTRSFSTLGEANGELKNRYVCKTTDVTEAI
FT                   DRLTMESSVFGNRIVKENSNQRILSREEIEGTMINIIKRNYVRYKGKFFIQKTGLAQGC
FT                   VASTLLCSLYYKRIDDLYFDKVFKEGILTRYADDFLVVSPSLDEIMKFLEVSQSISHLG
FT                   VNFSKEKIESNFGLEEYFKNTSNISELSEHKNKMKITDKPIKWCGTKIYPNKFSIKSCT
FT                   MDPYLPFSTAHSSTRPGKALELRMRKLLRNRMSRIYIDPNNKKAYENLYDTFLFCGKKA
FT                   CLLLKRMDFINCSFAQRILECSKHFAFKVCRKNGISITKKKIEDIASKAFKKSGISKVI
FT                   SA"
FT   gene            complement(<43564..>44808)
FT                   /locus_tag="Eint_090310"
FT   mRNA            complement(<43564..>44808)
FT                   /locus_tag="Eint_090310"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(43564..44808)
FT                   /codon_start=1
FT                   /gene_family="HOG000149652" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090310"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0320"
FT                   /db_xref="UniProtKB/TrEMBL:E0S979"
FT                   /protein_id="ADM12161.1"
FT                   /translation="MPVNYIYTSARKYVQKCISSYEDHEEKAREKYTMEDENNYKRRAG
FT                   HDTMARMNIERILFVKTNGWERKIRINYNIFKSSLHFVMGFSDFLKELAILSEGLMVQI
FT                   DGVDKSLFLGFLLDSFNLFGDVEEMIDGFRPVRLTPVQRSGLTSQEMLRTLFLLQNPDD
FT                   RMRLFLSFNVFAISIYHGDRYIGYLLDGLYRKIVAKILFEKKDFDGCLLEGGYRDSLHS
FT                   GVRLDMKRYMGAKSLLNALYLLFDIFNVDDISLRNILHIVLMFMSKEKGTGLVNFLGLN
FT                   DLFICAVRSICGDSVPSHLLMMACRDKLNMKYKVGAMKLSIDYVYNWIYKPHLTIMMPR
FT                   WFLHSRDGRRGVPVLGRPIETVSNKITMELTSDDKEHSNARGPAYSPLSRRLSGGLRDK
FT                   SPERFRSKQRLDFES"
FT   gene            <45127..>45855
FT                   /locus_tag="Eint_090320"
FT   mRNA            <45127..>45855
FT                   /locus_tag="Eint_090320"
FT                   /product="proteasome regulatory subunit alpha-3"
FT   CDS_pept        45127..45855
FT                   /codon_start=1
FT                   /gene_family="HOG000149185" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090320"
FT                   /product="proteasome regulatory subunit alpha-3"
FT                   /note="similar to ECU09_0330"
FT                   /db_xref="GOA:E0S998"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:E0S998"
FT                   /protein_id="ADM12162.1"
FT                   /translation="MSNLDFCTIYTTTGQIDQLSYAQKAADSGDTCIGIKSRNGIVLLA
FT                   EKPRISPLYVLESDERIKRAGNSVAVVSTGLTPDVFYVGCAVKDHVFHHKENFNEDPTP
FT                   EIMKVYLNDIFHYFTRSINLRVLGVNSLASVYKEGRFSLLHTDCSGKTLSYKAACIGKG
FT                   TRRIKTELEKLDIDNMTIEEMVDTGVKVLYMAHDPSKDKEFDIEVGIVSTETGGKLRKL
FT                   ESNEIQIFVDKHKHMSVDED"
FT   gene            <45907..>46689
FT                   /locus_tag="Eint_090330"
FT   mRNA            <45907..>46689
FT                   /locus_tag="Eint_090330"
FT                   /product="RING zinc finger domain-containing protein"
FT   CDS_pept        45907..46689
FT                   /codon_start=1
FT                   /gene_family="HOG000149651" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090330"
FT                   /product="RING zinc finger domain-containing protein"
FT                   /note="similar to ECU09_0340"
FT                   /db_xref="GOA:E0S999"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR014891"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:E0S999"
FT                   /protein_id="ADM12163.1"
FT                   /translation="MTSVINYRFRSNKNFSRIVFQGTGLPLWELKYEIINQRKMVSKDF
FT                   DLLFFDGETDEEINDEYQIISMNSHVIVNRIPLWMSKGGYNVKEKRLESQTHHHNTQRH
FT                   GKTVPESYVCFRCGQKGHYIQNCHTNQDKAFDILRIRKPSGIPKDFLVPVSGESVPTNA
FT                   AMLVTPEGGYVKAQPQVQEWKKYKQRTKMTVEIPDRLKCPLCHCLLVNPMRTNCGHTFC
FT                   DQCVGIDRKCYVCSKVVENFTQDIAMKVEVEKAIEQRR"
FT   gene            complement(<46785..>48137)
FT                   /locus_tag="Eint_090340"
FT   mRNA            complement(<46785..>48137)
FT                   /locus_tag="Eint_090340"
FT                   /product="nuclear pre-ribosomes export protein"
FT   CDS_pept        complement(46785..48137)
FT                   /codon_start=1
FT                   /gene_family="HOG000149648" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090340"
FT                   /product="nuclear pre-ribosomes export protein"
FT                   /note="similar to ECU09_0350"
FT                   /db_xref="InterPro:IPR011501"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A0"
FT                   /protein_id="ADM12164.1"
FT                   /translation="MDKMDQQKSKIGSICTKIIENPQENLDMMEGIFEMLRNGSFEGKA
FT                   KGMVYLSLFKVFKAVIPLYKVRSLKDVVKDKRDALHLKDHDKNLLKWYTSYVKTMVDDI
FT                   SNESYISLCEVLQHFDHFNATDKIVSGVLRGSLGKGSVPMMCCNTIKLKLRSDCSGELI
FT                   ATILDQMLDFEYNPLILEYLLDIPFVNNSLKSDEEKAKEYWEANRGVSRRDKNSIFHRK
FT                   RIFNKKLKKMEKERLSLQSEVKDEEDIEGRIEEMKSCKRIYDAIQRLYFTVLKGDRYEC
FT                   YKYVFMGLVKYRKILRPGFMEGLYFLLNNSLSKIPSDAKVQGILSILTLYEDECYDFNG
FT                   LVDLLYSMIHPINPEIVDNDELVKVIRFLFIKIRQPIHRAHVLLKRLILCCCSRSVPEF
FT                   RSLIKDISAYYDIEFSDCTNPRCREFDQDSTHVDSIPDNPFFEYFLYKNIL"
FT   gene            complement(<48258..>48611)
FT                   /locus_tag="Eint_090350"
FT   mRNA            complement(<48258..>48611)
FT                   /locus_tag="Eint_090350"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(48258..48611)
FT                   /codon_start=1
FT                   /gene_family="HOG000149647" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090350"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0360"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A1"
FT                   /protein_id="ADM12165.1"
FT                   /translation="MEENTAENSIPNTEARPGDIRIGEVSGEDTLVLYLSQGTGNTGEQ
FT                   CNQNGRCESDISKCKKHKASNCICLSKIHYEIDGDVLCIREMKPFIYISKISILCQCSP
FT                   SKQKIDNEARIEP"
FT   gene            <48771..>49448
FT                   /locus_tag="Eint_090360"
FT   mRNA            <48771..>49448
FT                   /locus_tag="Eint_090360"
FT                   /product="putative nucleic acid-binding protein"
FT   CDS_pept        48771..49448
FT                   /codon_start=1
FT                   /gene_family="HOG000149646" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090360"
FT                   /product="putative nucleic acid-binding protein"
FT                   /note="similar to ECU09_0370"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR014881"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A2"
FT                   /protein_id="ADM12166.1"
FT                   /translation="MIAVIDTGYFIERQIPTDKVIRGYVTDSVINELKTAESEEYLKFF
FT                   SFMIEVRNPSEEYVEKVRRDLRKEVNNLSNTDIEVVALTLELKDEVSEMWVGPESQNQE
FT                   EVVCFTNDNGIKNALLRYTIYESSMFSSRKYKVRCYGCFSLFSENLDFCKKCGHRTLTR
FT                   IAVGDTENGEVMFFKKGYEYRKPKTLKNAKGVELRSADQREYVQYQKNLKSKSNRSQRG
FT                   LDF"
FT   gene            complement(<49458..>49772)
FT                   /locus_tag="Eint_090370"
FT   mRNA            complement(<49458..>49772)
FT                   /locus_tag="Eint_090370"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(49458..49772)
FT                   /codon_start=1
FT                   /gene_family="HOG000149645" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090370"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0380"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A3"
FT                   /protein_id="ADM12167.1"
FT                   /translation="MGYRNNILTVCKKIKVDGGKQAPAKILDLQNVSDIAALINLSTEE
FT                   RRMKLISKYVSILSEFILNKAKEISGKRQKQEVSADDIKKVIVSEGLFFLYDIISLNKQ
FT                   "
FT   gene            <49934..>50806
FT                   /locus_tag="Eint_090380"
FT   mRNA            <49934..>50806
FT                   /locus_tag="Eint_090380"
FT                   /product="hypothetical protein"
FT   CDS_pept        49934..50806
FT                   /codon_start=1
FT                   /gene_family="HOG000149644" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090380"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0390"
FT                   /db_xref="GOA:E0S9A4"
FT                   /db_xref="InterPro:IPR012580"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A4"
FT                   /protein_id="ADM12168.1"
FT                   /translation="MFGNPTKRLACIGMNWRNINVKDLFKIFNSILLGSSPLSVKLCKT
FT                   KIGRERLGDNNIFVKSCEEGRIDECYTAVAEFEDVDDSKHIYTACDGVRLGNSGMVFDL
FT                   RFVPDSLDLQNVCDEAFNDDGCEEKDFVVREKKEEEDDSEIESRLEKLFKEKEINFDLV
FT                   SELVDMSDDENISGLQDHLPISSENEKSKFLESSSDDFNDEISEDKEIENKKAKKKESS
FT                   KKDIETIPRGKPIDECDGFMFDPKDKRFEAIFEDEDFAIDPTHPEYKRKGGLKEILDEK
FT                   RKRIKDNID"
FT   gene            complement(<50871..>51060)
FT                   /locus_tag="Eint_090390"
FT   mRNA            complement(join(<50871..51026,51058..>51060))
FT                   /locus_tag="Eint_090390"
FT                   /product="60S ribosomal protein L39"
FT   CDS_pept        complement(join(50871..51026,51058..51060))
FT                   /codon_start=1
FT                   /gene_family="HOG000230627" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090390"
FT                   /product="60S ribosomal protein L39"
FT                   /note="similar to ECU09_0395"
FT                   /db_xref="GOA:E0S9A5"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A5"
FT                   /protein_id="ADM12169.1"
FT                   /translation="MGSRKTALVKTRLMRALKRNREIPAWKRMMKEHKGEYNKARRHWR
FT                   SKKLKIY"
FT   exon            complement(<50871..51026)
FT                   /locus_tag="Eint_090390"
FT                   /number=2
FT   exon            complement(51058..>51060)
FT                   /locus_tag="Eint_090390"
FT                   /number=1
FT   gene            complement(<51128..>52228)
FT                   /locus_tag="Eint_090400"
FT   mRNA            complement(<51128..>52228)
FT                   /locus_tag="Eint_090400"
FT                   /product="mRNA capping enzyme subunit alpha"
FT   CDS_pept        complement(51128..52228)
FT                   /codon_start=1
FT                   /gene_family="HOG000149184" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090400"
FT                   /product="mRNA capping enzyme subunit alpha"
FT                   /note="similar to ECU09_0400"
FT                   /db_xref="GOA:E0S9A6"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A6"
FT                   /protein_id="ADM12170.1"
FT                   /translation="MELLHLGNKVPSEEAEALRIGIYQKLCIAGAKKRERFPGCHPVSL
FT                   TLDNIDLLLSKDFLVCEKSDGIRALLLVTEKMGISKGYFYDRKNDFYELDMNFPFSSTV
FT                   LIDGEIFLEDGTVTTYAIFDCLIYEDAPQILKNLYKRLGYAQMFVDRMKGSVEKTKALK
FT                   KEDEDGFEPKRIPIGAEGQEPGCISIHFYVKQMMKSYGFWEVYKKIPDLKHGNDGLIFT
FT                   PTDEPYSVGKRGVILKWKPTFLNTIDFKITKAKEFGHVYDLVCSGKRGKDVVFGHFFCE
FT                   DEEVDGKIGEFLYDNDGYYWDLDEFVLRKGGWKLYRIREDKDTPNNIRVVCSILESLKD
FT                   SLTIEKLCTFYNAMRENSKKREQMKK"
FT   gene            complement(52281..52430)
FT                   /locus_tag="Eint_090410"
FT   rRNA            complement(52281..52430)
FT                   /locus_tag="Eint_090410"
FT                   /product="5S rDNA"
FT   gene            complement(<52494..>54560)
FT                   /locus_tag="Eint_090420"
FT   mRNA            complement(<52494..>54560)
FT                   /locus_tag="Eint_090420"
FT                   /product="DNA repair and recombination protein"
FT   CDS_pept        complement(52494..54560)
FT                   /codon_start=1
FT                   /gene_family="HOG000149183" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090420"
FT                   /product="DNA repair and recombination protein"
FT                   /note="similar to ECU09_0410"
FT                   /db_xref="GOA:E0S9A7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A7"
FT                   /protein_id="ADM12171.1"
FT                   /translation="MDCKAEDYEKSFVEKYLERAASSKIDELKKKIEAHKGKGDMGKVK
FT                   DLEREIEEVKSRLAADKSIMCKKDSRKEEVEEKRNIDFEWSGMEDDKDIEVFNERCEKS
FT                   IEKYCNHMGIMKNEFQENLRKESSICEGFEIPDFLWNSLFEYQRDGVAWMLGLYKREKG
FT                   GVLADDMGLGKTIQMIVFLAVLFHNKSIEKALILCPATIVSQWMAEWKRFYPFVRVFFG
FT                   FPAEDCRGVYLMSYEKFKARAKDLLWDTLVLDEGHKIKNRNAQITLSVKKVRSRSRFVL
FT                   SGTPIQNNLGELWSMFDFVNPGLLGSHTSFHEEFEEIIRRGGYKSASNLQVEKAYRHSL
FT                   MLRSLIEPYILRRTKSQISHKLPSKEDKIIFCTLTPIQIELYNRILESKHIMKVLIGKA
FT                   NLLSGISMLRKVCNHPRLFIPRKEDGSEDLSEEASGEKNNEETLGLLKKEESQYGLVSS
FT                   SCKIKILMDLLKKWKSEGNKVLVFSQTIRMLDIIEKCVEKYAYLRMDGRTSTSSRSSLV
FT                   DRFNKDDSIFMFLLTTKVGGLGLNLTGASRIVIYDPDWNPSTDTQAKERAWRYGQRKGV
FT                   EIYRFICKDTIEEKVYQKQIFKDLLGKKVLSNPGLSRFFNKSCINELFSFTATRGFAEV
FT                   KTHEEDNDGEETGVLKKIRDRDFEVFSRIKTLNEKRILSGSEVLEYIRLREKE"
FT   gene            complement(<54615..>55397)
FT                   /locus_tag="Eint_090430"
FT   mRNA            complement(<54615..>55397)
FT                   /locus_tag="Eint_090430"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(54615..55397)
FT                   /codon_start=1
FT                   /gene_family="HOG000149643" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090430"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0420"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A8"
FT                   /protein_id="ADM12172.1"
FT                   /translation="MESLVNKLNKWYELKKEHTRLMHERREREVRRIVEEAKKTQNIEM
FT                   LLEILTTDADKCKDLEGFLTSEFKRSIAFNSKERINQIIKCMCILGLKREKPRLMMIDH
FT                   LESVYSKTRKPSTVSRIELLKKLQEYDETNGLKIHEYIENRIDEEVDEYVRKIPLEAPK
FT                   ELDRWLNEMVGVGRYRPRLLQMYKDLEIKYFTMCLGIVMLGDKESAVEDIVYLVNKIRL
FT                   RSNTVGVSIDNEVMEKLNECKMLWEEEIKALFHHCEQL"
FT   gene            <55786..>58665
FT                   /locus_tag="Eint_090440"
FT   mRNA            <55786..>58665
FT                   /locus_tag="Eint_090440"
FT                   /product="DNA polymerase catalytic subunit delta"
FT   CDS_pept        55786..58665
FT                   /codon_start=1
FT                   /gene_family="HOG000036616" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090440"
FT                   /product="DNA polymerase catalytic subunit delta"
FT                   /note="similar to ECU09_0430"
FT                   /db_xref="GOA:E0S9A9"
FT                   /db_xref="InterPro:IPR004578"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9A9"
FT                   /protein_id="ADM12173.1"
FT                   /translation="MSDSGLSYPHPVFAIFGNIESGEPIQVLVKNFFPYFYIETVNGKE
FT                   YKEEDIKDSIQRLDIKATVVEVEATMKQTILGYTEGKSRFYKLTLNTPHVSGALRAFLE
FT                   SGITIRREKVRFRVYESSFPFVLRFMCDLGIVGMSYLKVRKYEVLDGKYLTVSTSYESL
FT                   EPLPPVGVYAILPPLKVLSLDIECVSIGNAFPSSKTDPIIQIGNTLTMFGSDKYLSQDI
FT                   FCLKETTGIPGVNVHWYETEKELLESWKKYFMELDPDIIIGYNVKGFDLPYILGRGEVL
FT                   GIENFSILGRSKKKARTRDTTMSSNMFGSIMTTEVEIEGRLIIDMMVVIRRDFKLRSYS
FT                   LNSVSIHFLKEQKEDVPYSSIGELQSKDKDTRRRIASYCLRDTVLPLRLFSKLNVLINY
FT                   AELSRVTGVPIEYFFTRGTAIKIFALIYRTASKEGFVVPETDPFESGKKYEGGFVIEPK
FT                   KGFYGKPISVMDFTSLYPSIMISHNLCYTTLLTKDQYRILGGIRTPTDNYFCSPERKKG
FT                   LLPRILVDLLDSRKKIKEELKKEKDPAVKACLNGKQLAVKLCANSLYGFTGASKGKLPC
FT                   FEISQSVTGFGREMIMLTKKLIEENFSKKNGYTHDSVVIYGDTDSVMINFDEEDIKKVF
FT                   EMSKEISEFVTSKFMKPVSLEFEKVYYPYLLINKKRYAGLLYSNPNTASKIDTKGIEAV
FT                   RRDNCGLVKETVETVLEMILHEKNVEKAKQFVRDVVRDLYLGRIDLSLLVISKSLTKSG
FT                   EKYGSRQAHVELAEKLRKRDETTAPVLGDRVPYVIVKKGKGIAAYEKSEDPVYVLENNL
FT                   PIDTEYYIEQQLSKPMERIFEPVMDNVDELFKGDHTRVVQRASLKGPMNTFLKLADVCV
FT                   GCRAEGKIICSNCRKDFHIHLQKMQQEVENKKERLNSCWVECQRCQGSIHNQVLCVNRD
FT                   CPIFYMRTKVRKELIPLNEKLGKLRSFEW"
FT   gene            complement(<58797..>59108)
FT                   /locus_tag="Eint_090450"
FT   mRNA            complement(<58797..>59108)
FT                   /locus_tag="Eint_090450"
FT                   /product="histone H4"
FT   CDS_pept        complement(58797..59108)
FT                   /codon_start=1
FT                   /gene_family="HOG000234654" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090450"
FT                   /product="histone H4"
FT                   /note="similar to ECU09_0440"
FT                   /db_xref="GOA:E0S9B0"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B0"
FT                   /protein_id="ADM12174.1"
FT                   /translation="MNTQSISAKGKSKAAKGIAKRHRKQSGLTDSISKPAIRRIARRAG
FT                   VRRVGGGCFKEINNAAREYIRDTLSIACIYSTHAKRKTITCSDILHSLKRMGIKYIGY"
FT   gene            <59436..>59858
FT                   /locus_tag="Eint_090460"
FT   mRNA            <59436..>59858
FT                   /locus_tag="Eint_090460"
FT                   /product="histone H3"
FT   CDS_pept        59436..59858
FT                   /codon_start=1
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090460"
FT                   /product="histone H3"
FT                   /note="similar to ECU09_0450"
FT                   /db_xref="GOA:E0S9B1"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B1"
FT                   /protein_id="ADM12175.1"
FT                   /translation="MSRTKQTASKALGGKAPRKGMSMKSVPSSGSSSAVPKGTRFKAGA
FT                   LALKEIRKYQKSTDLLIRKRPFQRMVRELCKSGEGIRFQASAIVAFQEAVENFLTNLVE
FT                   DAYRCVLHAKRVTLMPKDICLVYKIKYANILYAALD"
FT   gene            <59939..>60595
FT                   /locus_tag="Eint_090470"
FT   mRNA            <59939..>60595
FT                   /locus_tag="Eint_090470"
FT                   /product="hypothetical protein"
FT   CDS_pept        59939..60595
FT                   /codon_start=1
FT                   /gene_family="HOG000149642" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090470"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0460"
FT                   /db_xref="GOA:E0S9B2"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B2"
FT                   /protein_id="ADM12176.1"
FT                   /translation="MGDVVYIVHRQLERIPTIPEHARTVDLRRNNISVMALNKAESVEY
FT                   LDLSDNRIKVISDLENVPNLKVLDLSYNLITEISIPRMGLSELYLISNDISTIHGLDLP
FT                   CIKKLDMAVNDICQIENLENCATLEELYLGSNRIRTVEGLSELKDLKVLDLQNNELEVV
FT                   DCSAVPCNVEVLLLGENRNLQMIENLESLKNLRILGLEKTRVPSDLFEGCFTVWR"
FT   gene            <60906..>61235
FT                   /locus_tag="Eint_090480"
FT   mRNA            <60906..>61235
FT                   /locus_tag="Eint_090480"
FT                   /product="hypothetical protein"
FT   CDS_pept        60906..61235
FT                   /codon_start=1
FT                   /gene_family="HOG000149641" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090480"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0470"
FT                   /db_xref="GOA:E0S9B3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B3"
FT                   /protein_id="ADM12177.1"
FT                   /translation="MIGGRSILKFPFVGIRKGISGNAVPGLALSMAVLKPISVVMPKVL
FT                   TDNLYKGAMALATRPFCVGDKIKIDKYDGLVRDISFWYVTLERGKGYVFIPMSHVYNTV
FT                   VELFK"
FT   gene            complement(<61298..>62824)
FT                   /locus_tag="Eint_090490"
FT   mRNA            complement(<61298..>62824)
FT                   /locus_tag="Eint_090490"
FT                   /product="T complex protein 1 subunit beta"
FT   CDS_pept        complement(61298..62824)
FT                   /codon_start=1
FT                   /gene_family="HOG000226736" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090490"
FT                   /product="T complex protein 1 subunit beta"
FT                   /note="similar to ECU09_0480"
FT                   /db_xref="GOA:E0S9B4"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012716"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B4"
FT                   /protein_id="ADM12178.1"
FT                   /translation="MNIFSHANLGTTEEKGDDAKRTILAGTDIVGDILKTTLGPKGMLK
FT                   MLKGQSVHVTNDGAFILKNLMIDSPSARILINSSTGQDWEEGDGTTSVAILASLLVKEA
FT                   SKLEMHPTKILKGYRMAQARCSEVLKRISFNPSKEDLVKLARTTLCSKVLKYDLEKFCN
FT                   ICVNAIENLGGRNDLNLVQVIKCSGKLEDSYLDDGFLLKKDVRIEEVNDPKILIANTSM
FT                   DQDKIKIFGAKINVSSVGELEEMEKVEKGKIQEKVERISQNGINMFINRQLIYDYPLQL
FT                   LKIKGIQAIEHADFDGVERLSNVLGGKILSTFDSMDETCYGTCKNVKNVYIGNERAIKF
FT                   SGVKSGASTIVLCGSSKEMLDEAERSVHDALCVLSKIKQDPRVVYGGGSSEMAMAVDLN
FT                   TYAMEVPGIESEAILAFSNALQQIPKILADNGGYDGEGIRASLRAEHNSGKTSYGVNVR
FT                   SGSVGCMKESGVVDSFRIKHRVVTAASEAAQMIIKCDAIVKCKPRERTRE"
FT   gene            <62858..>64669
FT                   /locus_tag="Eint_090500"
FT   mRNA            <62858..>64669
FT                   /locus_tag="Eint_090500"
FT                   /product="hypothetical protein"
FT   CDS_pept        62858..64669
FT                   /codon_start=1
FT                   /gene_family="HOG000149640" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090500"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0490"
FT                   /db_xref="GOA:E0S9B5"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B5"
FT                   /protein_id="ADM12179.1"
FT                   /translation="MNEELPVAPLVMKPTRIYNYTQLIACLKAKQQKLSRYKASIPPSP
FT                   FKGILGPKQCQFDVEDIVNGFLHEKLRARQREHEKSMDKMFSQCVRRHIKELKRENDLF
FT                   VVGNSKIGGRIKALEDVFDKDFEDKEGANIAEMEGKGKFFDDAFLLDMYMFLKRLKPSD
FT                   SFDQEIKFLGDEYLRYVERFLKENADKIKEPLWGEEDKISVFTKLRYSKEEYGLEVYEG
FT                   RYMFAELYTLFRCGLLDSAKGLLERFHVFFEHISHRFKTSFGSWITTRTKPAVPVKIGG
FT                   SDDLFKAFLLGLMDEKSRRMDERIIGSIEDFVWMNLISINEGRSASEILKMFRNYQNPK
FT                   GLFLAYVMLKDYDKAMSLMFKGDFSIIPSYFIMKALCPRCKNKKVFVDFVFLAASRFSS
FT                   TTRKVEIISSLKSVIEGYYEIVPEMIVKMGLYDVLGIDSGACLYLDKKVNQKVIEILKG
FT                   KNEKKKLIKLYYLIDDETLVVDLINEAVTEAILSDTDIDEYLEIIEYYERVECTRQTRM
FT                   MSALKSFYLFKRNPSPSTLGETPLLDSDFDLTNFRYVVEKIFKPACDIVEKMGDNEMAR
FT                   TLFKLCGVLGLGDEMSSYANRHLVLLI"
FT   gene            <64723..>65733
FT                   /locus_tag="Eint_090510"
FT   mRNA            <64723..>65733
FT                   /locus_tag="Eint_090510"
FT                   /product="hypothetical protein"
FT   CDS_pept        64723..65733
FT                   /codon_start=1
FT                   /gene_family="HOG000149639" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090510"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0500"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B6"
FT                   /protein_id="ADM12180.1"
FT                   /translation="MKFNSADFPIMKRMLVAREEGIYYEMEKNSLADTWDRLLEYYSEK
FT                   ILEEHKEEIEEEELYRILCKARVEAETGRRVYELIDKDVLETHKVKPRSVDRCEFKTYI
FT                   LDSCIRILRKGISELKDGIEKESRVWSKVEGASMPVRLVRGKVQVYVTETEYLVVNEEG
FT                   DYVYPSDWNAQGVTCKIRYMDVHLECSVLPRNSMDKIEMVKEYFLERSIIQKFIRNDIE
FT                   IEITPMENPSEREDIICKYVVCHLKRGKSIKEIFEKVNLYLSRKLVDIIVSGSKKCTVL
FT                   RYSGHVLEDGLPEVFFVLTDNKVVKAMRQQPGKFEIFVNEVPIRSFRNYISREEP"
FT   gene            <65901..>66248
FT                   /locus_tag="Eint_090520"
FT   mRNA            <65901..>66248
FT                   /locus_tag="Eint_090520"
FT                   /product="hypothetical protein"
FT   CDS_pept        65901..66248
FT                   /codon_start=1
FT                   /gene_family="HOG000149636" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0510"
FT                   /db_xref="InterPro:IPR018838"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B7"
FT                   /protein_id="ADM12181.1"
FT                   /translation="MIRCVYTMQKHKKLKTWMDGFIEQKGKRIHLYNTDMVKIDSLVAS
FT                   CLDNEMETPKYLLYIESFEDPEENEIKHQENPPSTSRTLKDRPEKDIEGNVKCSSPQGR
FT                   SEEEIINLFQG"
FT   gene            complement(<66262..>67011)
FT                   /locus_tag="Eint_090530"
FT   mRNA            complement(<66262..>67011)
FT                   /locus_tag="Eint_090530"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(66262..67011)
FT                   /codon_start=1
FT                   /gene_family="HOG000149635" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090530"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0520"
FT                   /db_xref="InterPro:IPR005343"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B8"
FT                   /protein_id="ADM12182.1"
FT                   /translation="MTQTDNGVELEESYLSKIYTSQALTLPEDIQNYVLNPKDVDAEIF
FT                   YLEKYARTKNPDLSKITFMIEVLSKCLKKHSDFRDYIKLLVGIIETYKDYRYSIFCLRA
FT                   IKSVAGSKFYVPLSFYIIRILKNAISVKNLSVEGRKISYDMVNPDPSRTKSEEHQMFVI
FT                   EEAGSLLLQHMSVFSKSIGFPELAAVVVSELKKLRIGVFKEVMDNVISNINAQREHVLE
FT                   KRNNLKLNGIDGKVVSSFESSIEKTLR"
FT   gene            <67530..>68315
FT                   /locus_tag="Eint_090540"
FT   mRNA            <67530..>68315
FT                   /locus_tag="Eint_090540"
FT                   /product="hypothetical protein"
FT   CDS_pept        67530..68315
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090540"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0530"
FT                   /db_xref="InterPro:IPR012468"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9B9"
FT                   /protein_id="ADM12183.1"
FT                   /translation="MQEKVSNFDDHMCDLEKKIKDIETAFQPILLSKESHKRSLPEDSF
FT                   LKNIYLVLIIVLCIQGVLWYTDNEKSSAGTVWNMVVYSVAVVGTILYMAWVWGFGGRRW
FT                   TSVASMVPMMVGFLNLGKRVSCEYGMEMAGLGFMMVCMESLARHGMSSWEILAGLIGNG
FT                   IVVMGWVSWATMRDRYGERMGQWMCGGLIVFGILMAVMMYMKEGRNVERSTGSYMVFIM
FT                   TVVVGTAVSYACGEDYRQLATKRLFQRPRIVESKCQNPI"
FT   gene            complement(<68361..>69281)
FT                   /locus_tag="Eint_090550"
FT   mRNA            complement(<68361..>69281)
FT                   /locus_tag="Eint_090550"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(68361..69281)
FT                   /codon_start=1
FT                   /gene_family="HOG000149631" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090550"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0600"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C0"
FT                   /protein_id="ADM12184.1"
FT                   /translation="MRGFGGSEVLSGDDEDDERLGKELGRLRQENMRLTGEIMILRQNM
FT                   IALETQNFAMKEQKSRTVLDGLKRMEKLKKEVDVLRIESRIRENQSRVFKRQKANAGID
FT                   IKWALSKSNCGIGFTLLPFEFNRLKFLKDFFYSDFCQLDSSSVIREMGKRISRFKEFLD
FT                   FYILFSCKAEVFREFFGMVLMNPLFPEEKMKVFNTLPLDWILNFNNEEVISLVKEYIDK
FT                   NYKQMVFFLLRVVEERPFLLNILVSKEMFTELAKTSSRATKKLTSEICRKGGLGLIDHT
FT                   NIHYISQDDLKILYKDLYFEVYFDV"
FT   gene            complement(<69304..>70305)
FT                   /locus_tag="Eint_090560"
FT   mRNA            complement(<69304..>70305)
FT                   /locus_tag="Eint_090560"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(69304..70305)
FT                   /codon_start=1
FT                   /gene_family="HOG000149630" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090560"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0610"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C1"
FT                   /protein_id="ADM12185.1"
FT                   /translation="MDFEIWPCDAYTGGVFKSCIKWRKCKETSKRPDFLAARIAGIVRM
FT                   DRKEIRFLESEPVELSMKEDSETVYRCIIPRDALPSMKLRSLEVVYTIIVEVYYGVTRE
FT                   VRTKMFSVHPFGFKPLKKMENIIVHSDMIRVGNTDDTAFGEIVDFLRNKAGQDYGTTEE
FT                   MVGRKMHFLEDFPRFMREVVERYKLESKGDIYFYVSMEGSEVEEDRYKVTVQDDEEEVA
FT                   TVEYGKLLVKEDTMMIWYKRNSKKTRIILEVTEFISGEVSNGEERLLKEFNSDMCLYKA
FT                   VPLRVEHDCFTFDCKLFSVKFSYRIELDNLVFVLPISKASPRASLSIGGECR"
FT   gene            complement(<70406..>72349)
FT                   /locus_tag="Eint_090570"
FT   mRNA            complement(<70406..>72349)
FT                   /locus_tag="Eint_090570"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(70406..72349)
FT                   /codon_start=1
FT                   /gene_family="HOG000149629" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090570"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0620"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C2"
FT                   /protein_id="ADM12186.1"
FT                   /translation="MAGFYERIKEAWNSVKDALQPGKKVDLNSYKELCSRFESEKPIEV
FT                   SELDRIKELCKAISEPGCRKKLDEGFEELKRVEIERSERKAGAKWKGDLGAGDTKGGEG
FT                   KPKKHRKRGYQKKYALKKENDVSWGVLPKKYRVEGKTPMETIEKAICYDAEDNLFLQLG
FT                   EVSTDEEEEYFCERNIKKLNSEVVERKVRCNFGGEYNCKRCVEYEIRKEYERKENERRK
FT                   EERERAEKRRQMAKDRWESRVPKSYFYLEKDFGVERAVARYVTDDKFDMDDLEDEERKK
FT                   LTRVLSEARKEQLFDIEKIKSRKASFDESRNEVTEIGGIKDDGEKNDKEAEPEQVLNGS
FT                   GQEDRKEVGIKTSNESESLPSKPYFILEPISETKENGSDDREAVEMSEDAKKVEDAVQM
FT                   QEPFVFGGEINESLENEKKEGPAVEEEPKKFGFWDGRTPNVQGDTSMFLFNSGAPLPPA
FT                   QDSPSTVNHENISSPFASDGKAPETKPFVFGGGSFPAQSGMGQESVELHSPTPGSSLLK
FT                   RKLGGYGEAVQDSGANFSFGEGGNIFLSGSSGIPGLQSFPVPGSTGQEQARPQQQIDLT
FT                   GSMGNIFGNGKSLFGGLFEGGSSQQPAKPSIGYVDSEERNDKGLGGLFGGGGIFNAADD
FT                   DPFERSKLDRRR"
FT   gene            complement(<72408..>72671)
FT                   /locus_tag="Eint_090580"
FT   mRNA            complement(<72408..>72671)
FT                   /locus_tag="Eint_090580"
FT                   /product="zinc finger domain-containing protein"
FT   CDS_pept        complement(72408..72671)
FT                   /codon_start=1
FT                   /gene_family="HOG000149628" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090580"
FT                   /product="zinc finger domain-containing protein"
FT                   /note="similar to ECU09_0625"
FT                   /db_xref="GOA:E0S9C3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C3"
FT                   /protein_id="ADM12187.1"
FT                   /translation="MELCGICHWKISVKHETRCGQSFCYLCIKRHLKSDDRCPGCRRRS
FT                   CVTDVLRCREDNERFGGNDLEILNSLCRLKRYIKEEAKECKD"
FT   gene            complement(<72708..>72995)
FT                   /locus_tag="Eint_090590"
FT   mRNA            complement(<72708..>72995)
FT                   /locus_tag="Eint_090590"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(72708..72995)
FT                   /codon_start=1
FT                   /gene_family="HOG000149627" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090590"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0630"
FT                   /db_xref="GOA:E0S9C4"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C4"
FT                   /protein_id="ADM12188.1"
FT                   /translation="MLGSIVKSKVGIDYGSYGASMVGNLVVVEYLPHSQIAVIRCDAPA
FT                   CKYVLFTIATIGEISGLKCSMSILWISGILKRAMRRILKYVKMEKELERR"
FT   gene            complement(<73094..>74476)
FT                   /locus_tag="Eint_090600"
FT   mRNA            complement(<73094..>74476)
FT                   /locus_tag="Eint_090600"
FT                   /product="pyruvate kinase"
FT   CDS_pept        complement(73094..74476)
FT                   /codon_start=1
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090600"
FT                   /product="pyruvate kinase"
FT                   /note="similar to ECU09_0640"
FT                   /db_xref="GOA:E0S9C5"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C5"
FT                   /protein_id="ADM12189.1"
FT                   /translation="MSILWIGPYLQRTYHVSQNKIDKFGKDLSHSSMKASLTKIVCTIG
FT                   PSSSSKEKIKDLIDAGMSVARLNFSHGSREEHLEVIRNIKDAICSLGRYVSIALDTRGP
FT                   EIRIRTPGDKNIEVNGGDILRFSSVSSGKSIWIPWIDFRSLGMGDRISVDDGRIDLKVV
FT                   DVEEDGFGCEVLSSGIIRSNKSMNFPNIDVGIKFLSDEDRSDIVFGLENGIDMIFASFV
FT                   NSKKDVEEIRKVVGNRIPVVSKIESCLGMKNLEEIVLCSDGVMIARGDLGAEVGLVDTF
FT                   SAQKKILLETKRGKKPAICATQMMESMTSRDTPSRAEISDVGNAVLEGCDCVMLSGESA
FT                   VGMFPIETVKFMRNICIKAETYYQETKKDLGFHKMFPYVKGIVVCTDSMEDVERLYLGR
FT                   PGVPIILISEDKWILRRFSIWRGVFPMDIKPPTDVDDVLRGLGLKGTFLVACKEEMKTI
FT                   NV"
FT   gene            <74656..>74973
FT                   /locus_tag="Eint_090610"
FT   mRNA            <74656..>74973
FT                   /locus_tag="Eint_090610"
FT                   /product="hypothetical protein"
FT   CDS_pept        74656..74973
FT                   /codon_start=1
FT                   /gene_family="HOG000149626" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090610"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C6"
FT                   /protein_id="ADM12190.1"
FT                   /translation="MLESEKTLRMEQKLHRKAVVEHLEKAAQAVKKLNFKAEVSKLVIN
FT                   GDEKYKIEKCLACLEVQAVMFIGRHKKKRFYECFVQSLEDYVFEAMKIPIIKIPASKHR
FT                   S"
FT   gene            complement(<75007..>75675)
FT                   /locus_tag="Eint_090620"
FT   mRNA            complement(<75007..>75675)
FT                   /locus_tag="Eint_090620"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        complement(75007..75675)
FT                   /codon_start=1
FT                   /gene_family="HOG000149625" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090620"
FT                   /product="hypothetical membrane protein"
FT                   /note="similar to ECU09_0660"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C7"
FT                   /protein_id="ADM12191.1"
FT                   /translation="MYVCIECGNRAKHLFLKNSSAKQISRCQLCSKKMDRYFELNSLMK
FT                   LVDLLLLKRRIFRHYLFNNKKDLTRSALFMLIAKVLTGPILHHHGALRILFFGESSGKV
FT                   NLIATIATICRDALESLVETVLLLVLAFTVFHRHVRFLKLSSSLLLSSFYYLFIFIMIM
FT                   WKYQWEEYLLVIEFLCIASNSIVISEICLVRNEIAVGCICGCKLITALMCKRILGSIRL
FT                   "
FT   gene            <75747..>76778
FT                   /locus_tag="Eint_090630"
FT   mRNA            <75747..>76778
FT                   /locus_tag="Eint_090630"
FT                   /product="histone deacetylase"
FT   CDS_pept        75747..76778
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090630"
FT                   /product="histone deacetylase"
FT                   /note="similar to ECU09_0670"
FT                   /db_xref="GOA:E0S9C8"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C8"
FT                   /protein_id="ADM12192.1"
FT                   /translation="MAVAYIFDEEVGMFHYGPRHPMKPFRMVVTHSLVKSFGLDKKMTI
FT                   VKPALFPLTYHPKEYLENLGKNETPDCPNFIGLSRFCELYGSASINSAMILSEGRYDTV
FT                   INWSGGLHHAHKAVPSGFCHVNDIVMAILELLKTYQRVMYIDIDVHHGDGVEEAFLECD
FT                   RVLTLSFHKYGDGFFPETGTLVTTGHRAVNVPLLSGIDDASYRYIFEPIVESCVKKFSP
FT                   DAIVLQCGADSLGEDRLGCFNLSIEGHASCVRFVSSLGIPLLCLGGGGYTLTNVARCWA
FT                   YETAVLCGEDPITDIPADNPFYTYFSPSYVVNPVFKRKYVNRNDREYLDMVMSFILDKV
FT                   DKF"
FT   gene            <76835..>77725
FT                   /locus_tag="Eint_090640"
FT   mRNA            <76835..>77725
FT                   /locus_tag="Eint_090640"
FT                   /product="small RNA-binding pol III transcript
FT                   stabilizing-like protein"
FT   CDS_pept        76835..77725
FT                   /codon_start=1
FT                   /gene_family="HOG000149180" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090640"
FT                   /product="small RNA-binding pol III transcript
FT                   stabilizing-like protein"
FT                   /note="similar to ECU09_0680"
FT                   /db_xref="GOA:E0S9C9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002344"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9C9"
FT                   /protein_id="ADM12193.1"
FT                   /translation="MPVEKLEKIKSQVEFYFSDANFRVDKFLREQSLVNDGYIPIKTIV
FT                   SFNKLRNLEATVEDVKKALEDSKVVELKDDMIKKVETEEYLSYVMEKDINKRVVYIDGF
FT                   EKDATLEDIKEILSPHIIPVLIRMRRDKGKNFSGSVFAELKSEEEAQKALEEKIPVKKQ
FT                   AEDEERSKKQKSEEKYLLIMAKDEYLKEKEKISGEKKEIEARKALEKEFVPKLFKYECS
FT                   EDLDIKTVKSLVKNTAFVDTKQKVIRMKHAEDFKEKKFEEEGKSLTLVKMEEDEALEYC
FT                   KSIKIAPKGSKPGKK"
FT   gene            <77775..>78227
FT                   /locus_tag="Eint_090650"
FT   mRNA            <77775..>78227
FT                   /locus_tag="Eint_090650"
FT                   /product="putative peptidase"
FT   CDS_pept        77775..78227
FT                   /codon_start=1
FT                   /gene_family="HOG000012722" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090650"
FT                   /product="putative peptidase"
FT                   /note="similar to ECU09_0690"
FT                   /db_xref="InterPro:IPR008580"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D0"
FT                   /protein_id="ADM12194.1"
FT                   /translation="MTKYNVTLRVYPLGDETLKRFVASALKREEVHIWHTSIEVYGIEY
FT                   FFQNGIVKAVPGSTSHGTPLKTHDLGTTEIPEIVFEDFLLSITEDFAPHKYHLLRNNCN
FT                   NFTNIVALYLVEKSIPEYILELQNTALESEAVSSLVDMFFGSPGKI"
FT   gene            complement(<78230..>79363)
FT                   /locus_tag="Eint_090660"
FT   mRNA            complement(<78230..>79363)
FT                   /locus_tag="Eint_090660"
FT                   /product="splicing factor"
FT   CDS_pept        complement(78230..79363)
FT                   /codon_start=1
FT                   /gene_family="HOG000149624" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090660"
FT                   /product="splicing factor"
FT                   /note="similar to ECU09_0700"
FT                   /db_xref="GOA:E0S9D1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D1"
FT                   /protein_id="ADM12195.1"
FT                   /translation="MEAKDAKVDYEVLVAPDGKTYYYNKKTGKSSFRKPDVLKDSDEDF
FT                   DVDPWIECRSRQGKVFYHNTITKESRWERPGEKRKGKTLIKGIGMNMRITDHETSKYLL
FT                   YRLMEQYKVENMKDVFYKLSTEPIFRAIRMDVRESLVRKYFEDKEENNREEEVQRQKYY
FT                   VDEVCKVDVGVSDFFGFNSVFSRHPYYSRIKDKFGCYEVYIEKHMGGTTAGKLEEIFRA
FT                   CGIDLNSSASDVLKMKEMEGFDRKVVLFSFIRYFRRLEREFLLDIEKKKTSMAEKIPHY
FT                   REEFRQVLNSLYSRGLIYYKMKFKDAFYLFKNSEPFWNLLGSMESPKEVYFEFVNDLEN
FT                   KLKRYEKERTEEISQIDKRAVDKYFEVVWEEKEEGEI"
FT   gene            complement(<79437..>79937)
FT                   /locus_tag="Eint_090670"
FT   mRNA            complement(<79437..>79937)
FT                   /locus_tag="Eint_090670"
FT                   /product="putative integral membrane metal-binding protein"
FT   CDS_pept        complement(79437..79937)
FT                   /codon_start=1
FT                   /gene_family="HOG000149623" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090670"
FT                   /product="putative integral membrane metal-binding protein"
FT                   /note="similar to ECU09_0710"
FT                   /db_xref="InterPro:IPR019273"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D2"
FT                   /protein_id="ADM12196.1"
FT                   /translation="MFLASCVVIVLSMAYSYADDQNMVLFGVGSALGCYIVRCVLIYLY
FT                   EIRIQRLESSVEALKEIQKEQIALLKKEESFEATKKVIDKYESESMRRHYFGSIKQRRR
FT                   GMMDSVTDIVLGDDPSTMYALICKRCNHHNGLVHPSEYDLNEFYCYNCNELNARSKNRN
FT                   SNK"
FT   gene            complement(<80108..>80791)
FT                   /locus_tag="Eint_090680"
FT   mRNA            complement(<80108..>80791)
FT                   /locus_tag="Eint_090680"
FT                   /product="proteasome subunit beta type-7"
FT   CDS_pept        complement(80108..80791)
FT                   /codon_start=1
FT                   /gene_family="HOG000182856" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090680"
FT                   /product="proteasome subunit beta type-7"
FT                   /note="similar to ECU09_0720"
FT                   /db_xref="GOA:E0S9D3"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D3"
FT                   /protein_id="ADM12197.1"
FT                   /translation="MITKTGTTIVGMKYKTGVILAADTRSTQGPVVSDKNCEKIHRISD
FT                   KIMCCGAGTAADAERVARMASRELRLFERKYFRAPLVSHFRKVCVNHLHKYGGQIGAAL
FT                   IVGGIDSEGCHLLDIHPHGSSNSTLFTSLGSGSLAAIGVLESKYRAMDKNEAIELACDA
FT                   VQAGILNDLYSGSNIDVCVIDYSGVEFLRNYKRVGVCENTDTLVYPLDSVQIKKEEVFD
FT                   VVEEY"
FT   gene            <80892..>81695
FT                   /locus_tag="Eint_090690"
FT   mRNA            <80892..>81695
FT                   /locus_tag="Eint_090690"
FT                   /product="hypothetical protein"
FT   CDS_pept        80892..81695
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090690"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0730"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D4"
FT                   /protein_id="ADM12198.1"
FT                   /translation="MVFKEITISLAYVAQITILLSLDVLFLLFTVQRSLYFFGKGMKRK
FT                   PDAIRVRLIPKSQSDLYLIDGISGIDLIYLPGNFVAVEEHIEFCKYLSKIFECNVISMV
FT                   YRGVAGNGYSPSEKGIVEDLSPASRWLSRRSTRKVILGFSIGSAVGIRLAEKCRVDALV
FT                   LINPFISLREVVGNVSFGRILKHLVIDEWNNLNRMKNINVPVYFVVSSNDEIVSPSHTD
FT                   ELIKRTKHPKKIVIRNADHNEPMRNFTTHLCSLMDEVLRKTPSGG"
FT   gene            complement(<81724..>82677)
FT                   /locus_tag="Eint_090700"
FT   mRNA            complement(<81724..>82677)
FT                   /locus_tag="Eint_090700"
FT                   /product="putative divalent heavy-metal cation transporter"
FT   CDS_pept        complement(81724..82677)
FT                   /codon_start=1
FT                   /gene_family="HOG000149622" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090700"
FT                   /product="putative divalent heavy-metal cation transporter"
FT                   /note="similar to ECU09_0740"
FT                   /db_xref="GOA:E0S9D5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D5"
FT                   /protein_id="ADM12199.1"
FT                   /translation="MNSQVVLFAAMVFSSSLIICLSPKVITSLKVVKRIFPFLTLLTAG
FT                   FLLGVQLLELSPHMVSDCHGGKEHDHNHGHHSHESPILGFFTAGLSFIFLLAIDSIVLK
FT                   HKHCEENEKKEHAHGGGCHGKDIHHVVDAKKNIKSPQISAKASSAHDSKKEGERLGCCD
FT                   PSEAIKNTSSKTQVFIYILGISIHSFFEGLAFNSIDKIGSMEMGLILHKILESFALGVP
FT                   LFTSGFNFSSGLILAVFYSSLTPIGIMIGSAPGFFNQTIRGIFKGLALGSIMFMVSIEM
FT                   IPPMFNHPKVNRIHGILTLLAGYLTSAAVIHCSHPH"
FT   gene            complement(<82728..>83069)
FT                   /locus_tag="Eint_090710"
FT   mRNA            complement(<82728..>83069)
FT                   /locus_tag="Eint_090710"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(82728..83069)
FT                   /codon_start=1
FT                   /gene_family="HOG000149621" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090710"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0750"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D6"
FT                   /protein_id="ADM12200.1"
FT                   /translation="MLPFDREERALIEREYVKHRKDIKKAKMRERHFKMKDKGYCLSID
FT                   LLGDSRDVVSMFLGYIEGLGISRRDVYEYIADAVLCGNNGISENLKRIVKLGIRDKNSI
FT                   GKEIAKTCS"
FT   gene            <83152..>85122
FT                   /locus_tag="Eint_090720"
FT   mRNA            <83152..>85122
FT                   /locus_tag="Eint_090720"
FT                   /product="5-3 exoribonuclease"
FT   CDS_pept        83152..85122
FT                   /codon_start=1
FT                   /gene_family="HOG000149179" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090720"
FT                   /product="5-3 exoribonuclease"
FT                   /note="similar to ECU09_0760"
FT                   /db_xref="GOA:E0S9D7"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D7"
FT                   /protein_id="ADM12201.1"
FT                   /translation="MGVPSLFRWLQLSHREAVHSIMEKPSVDCLYLDFNAIIHTCIKPG
FT                   LGSEEEIERDLYKTVGDFIDYILLRTRPRKLLYIAIDGVAPRAKLSHQRARRYKSALGK
FT                   KEGKAPVSTGKTDPTASSISEKTEEATDVEFTGESSLYDKFIAEDLSESSSLAMDVEAE
FT                   KFDLNCITPGTPFMERLHNVLISYIQYKLSKDPEVSHLRIIYSSYLVPGEGEQKIMSFI
FT                   RNQIPAAKNDVHMIYSPDGDLIFLGLSLYKSRVLIMRDYFSPSKARKKKICTKCGRTGH
FT                   SNDECGVFDNYHFVYVNIAELRSRLIREFRKHTTQRFNEERLLSDWIFLCFLLGNDFVP
FT                   SIPCLDIRFHSIDTLTEIMMKNFSETKSYITCNTSINYQVLRNFYTILARKEDGLYHRK
FT                   SQSLDRLREELKDMPNIIYEKIPIHTKTGKIQYYTSKLNAKTDSDIKNICYEYIKALYW
FT                   VYSYYILGYTGWDWYYPHHFAPLAADLSKLSISEIRINSGLPLRPLEQLLVVLPPMSKG
FT                   MVPRELQPIFNNYKDYYPEDVETDMFDKVYLWQEVVLLPFMDFRSILSENASRFNSLGY
FT                   EDLSRNLRSLDLFFTVDKKSTETILNMYSELKPMCFIKDPGYTGNLSPYSSASFPGDMA
FT                   EYNGTQFVNRTIAGLIEPKKN"
FT   gene            complement(<85140..>86417)
FT                   /locus_tag="Eint_090730"
FT   mRNA            complement(<85140..>86417)
FT                   /locus_tag="Eint_090730"
FT                   /product="DNA polymerase delta regulatory subunit B"
FT   CDS_pept        complement(85140..86417)
FT                   /codon_start=1
FT                   /gene_family="HOG000149178" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090730"
FT                   /product="DNA polymerase delta regulatory subunit B"
FT                   /note="similar to ECU09_0770"
FT                   /db_xref="GOA:E0S9D8"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D8"
FT                   /protein_id="ADM12202.1"
FT                   /translation="MDDLASVSYEHQFNRTYDARLAELKPYIIRSVRAQNGVPILDTIL
FT                   GVEEELDTSTCVIVGTLFVASDLKPSIFDKIDRKSKKLKEVETKTYYTEDIKYLLEDGS
FT                   GRIELEFLDVGDIYRKHFVLCTGMCVGVQGRRAKKGKFLAEDIIFPFSNPRSLPLGFSE
FT                   VRPGKRLCFISGLSLDDGSKNKERMMVLCDYLRIVGVSEYVVIGSFFGESKEVSRQMLS
FT                   ELDDVLGYAKAKINLVPNTGDFGSKILPLMPVHPKLFTFAVASHANPCRLDIDGRKVLT
FT                   TTRFVIEDILRYLPQDLKDVQGEAFEYKMHLDMEKIEDIRPKSMNSERNIINAMRVLMK
FT                   AGHVCPTAPDTVPSVPFSGKDLFVVADPIDYFCVGGTDEFLDGQSEDNSTLFFTIPKFS
FT                   KRHEVVVLDTGTRELEVVRFDMKDFD"
FT   gene            complement(<86509..>87372)
FT                   /locus_tag="Eint_090740"
FT   mRNA            complement(<86509..>87372)
FT                   /locus_tag="Eint_090740"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(86509..87372)
FT                   /codon_start=1
FT                   /gene_family="HOG000149620" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090740"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0780"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9D9"
FT                   /protein_id="ADM12203.1"
FT                   /translation="MALTYKERLEFLESLRKAPIDLSVADRMVLYAHDRTLMRPTIQSL
FT                   VRELTNLDAYISVMHGILTQDEWDEVVSDYDTPIEGGHAKLREKIKLFLFAYENLDNAI
FT                   YDFKIDEVFKAFETSMLSRTRNIQFLLFKLCHRNPQAVFGFLLELVRKNPIAFLPYLSS
FT                   LIVRCKVDEGLKAMYVQDYQAYVRSYGKSLSIQSVAAHQCLLYISCFRRESVADAKDII
FT                   ERIFSSGMARYMNKNVVEMFCELFDYECKEFSSHDHDCLYFFPFDLPILEEVAGSIHEF
FT                   YIHFRR"
FT   gene            complement(<87441..>88493)
FT                   /locus_tag="Eint_090750"
FT   mRNA            complement(<87441..>88493)
FT                   /locus_tag="Eint_090750"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(87441..88493)
FT                   /codon_start=1
FT                   /gene_family="HOG000149619" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090750"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0790"
FT                   /db_xref="GOA:E0S9E0"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E0"
FT                   /protein_id="ADM12204.1"
FT                   /translation="MNQDKEISKDAFDVIIRTVQDRKDFGSKSMEDLPMNLFSYRFFHL
FT                   EEISLADGISAAIKTILRDSRFSLLGVSPETLDSFFSFSFFHMLPHKYHNLDHLINTLY
FT                   FGDFILQRLEKKYSLPIMDKMCLMIALVLHDIGHPGEKNREKIERLSSLYGNSDETMSF
FT                   ELIHATICKRIISKYRHALFGDLEDEEMREKLNFIKEMIFATDLKMNKEIIEEFNTKYF
FT                   EERKGRKIRNKAAGEISEIELKMIVKIADLGSCYKDYRIFNKNSIAFWSEMYDDDNYRR
FT                   TLQDISEDVNLLEKISIPLADSFSLVFEDFRFLYNQALSNLEEHKKYYKRLEEEWKSGP
FT                   PPGRDKMSLK"
FT   gene            complement(<88624..>89193)
FT                   /locus_tag="Eint_090760"
FT   mRNA            complement(<88624..>89193)
FT                   /locus_tag="Eint_090760"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(88624..89193)
FT                   /codon_start=1
FT                   /gene_family="HOG000149618" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090760"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0800"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E1"
FT                   /protein_id="ADM12205.1"
FT                   /translation="MRTGFFVSCRLNKETKGLKEVVGKLEGLIETPKKDTAGKSIRKIL
FT                   EEEIEEYKSSTKFRKHDGYRCILFLENRSSESSSALFSKLRESETRFEYVLPIRPLEEF
FT                   FRFDEGKVLESIRGLDENKSYKIMYEGRMCHPDTKEKVFDLITGNLSLKVDLKTPHYII
FT                   AVQAFKNNLGISVIENERENFNFSAT"
FT   gene            <89588..>91093
FT                   /locus_tag="Eint_090770"
FT   mRNA            <89588..>91093
FT                   /locus_tag="Eint_090770"
FT                   /product="FusA-like translation elongation factor"
FT   CDS_pept        89588..91093
FT                   /codon_start=1
FT                   /gene_family="HOG000149617" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090770"
FT                   /product="FusA-like translation elongation factor"
FT                   /note="similar to ECU09_0810"
FT                   /db_xref="GOA:E0S9E2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E2"
FT                   /protein_id="ADM12206.1"
FT                   /translation="MTLLDTPGHADLIPETIKTLEQVDTVVMVLDICRDLSLQYELLFG
FT                   AIEASKKPLIVVFNKMDLIGKEGIAVAASRIKYLRDIIEAYLNPRCWFVSSFKESKLSK
FT                   LDTTIGRLIEEYVDDFDSFIERIISKEPITHGDRDKMECLTGFLWVGGVLLCSLVPKTD
FT                   IGVGFQVEVYGTTLTIERLYLPFPGCLVKTQQIQSKIGVLAKFPEDMLQKVVIPGFQRD
FT                   PRLMKEVLKRKGVEYGNPEFLEVEDPLVRVQVSPDNEDHFSLGTWKLRLMYPSLKIDGK
FT                   ILYGDGELFMDTVLYDLRNSLGIKFEVLSVSSNLKEIFGVSFTEEVDTGRGLVVVKGGP
FT                   TRTMGKIHDFGAVEKRILDRGLLAKDPFVHSYLEVSPVSEEVELECLKRLENSVIGHVS
FT                   LLEPLYLVEIVYTSDSEDLVNEVITSSFGEIISRKPSPFNELKNILCYIPVPESFGFET
FT                   DLRVYSCSRADCVKIPFYWRPVADKDRTHRLARFIRKAKRPEP"
FT   gene            complement(<91130..>91933)
FT                   /locus_tag="Eint_090780"
FT   mRNA            complement(<91130..>91933)
FT                   /locus_tag="Eint_090780"
FT                   /product="septin"
FT   CDS_pept        complement(91130..91933)
FT                   /codon_start=1
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090780"
FT                   /product="septin"
FT                   /note="similar to ECU09_0820"
FT                   /db_xref="GOA:E0S9E3"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E3"
FT                   /protein_id="ADM12207.1"
FT                   /translation="MIIRRQNRRFTIMAAGPKGSGKSSFFNTLIGKEIITSKGQEGIDL
FT                   YMLNLDCEGIMQRITLIDTPGFGETFDDTEIQETICNFIKAQLDMFITEESKIRRNPKY
FT                   EDTRVHCLLYFIPSTSFGLKNRDIVFLKKISGLVNIIPVISKADGLSISERIEIKKQVI
FT                   RQLKYYKIPTFNLDDPELYSSPTAGNDLNSLVPFLIISADGENLDSRARNYQWGKVSID
FT                   NPEHCDLPALRELLLSTHIYGLIDHTAGEIYESYRAAVLESGMKK"
FT   gene            complement(<91990..>92619)
FT                   /locus_tag="Eint_090790"
FT   mRNA            complement(<91990..>92619)
FT                   /locus_tag="Eint_090790"
FT                   /product="ribonuclease"
FT   CDS_pept        complement(91990..92619)
FT                   /codon_start=1
FT                   /gene_family="HOG000149177" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090790"
FT                   /product="ribonuclease"
FT                   /note="similar to ECU09_0830"
FT                   /db_xref="GOA:E0S9E4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E4"
FT                   /protein_id="ADM12208.1"
FT                   /translation="MLVSEQGFREDGRKPKELRRVEARRRMVGDEGIVEIRQGNTQVSA
FT                   ACRGSREVGKISIGVEFYVVSRQEPINERRALEYEGLLLDIFSSVLLPEGSADIKVIVR
FT                   EDGGSLLSAMINCITLCLSYFGIPLRDMCYSATVSEGCIDLTSTEESLKTPVVTVAYLM
FT                   NKKNIAYLSLNGRIVQERLQSSILEGVDACHAISKCFKDFFSPCLE"
FT   gene            <92702..>93346
FT                   /locus_tag="Eint_090800"
FT   mRNA            <92702..>93346
FT                   /locus_tag="Eint_090800"
FT                   /product="cyclin-like protein"
FT   CDS_pept        92702..93346
FT                   /codon_start=1
FT                   /gene_family="HOG000149176" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090800"
FT                   /product="cyclin-like protein"
FT                   /note="similar to ECU09_0840"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E5"
FT                   /protein_id="ADM12209.1"
FT                   /translation="MGPEYAQCKDLLNSKNVRDIVNISRLLGMPQKATYFTLAIYYKYI
FT                   FMLKDREAIPIGAACILLSGKVNGSLRSLGQILRTSYKYYGMDPERFFQEDYKDAIDIE
FT                   LHACIAMDFNFEMEDPYGFLEKMCMDNDIDRSRAQTIWVMLNDTMYLPFVLSFSIKSIV
FT                   VSCIFISDIVRGNGEEDINGFKDKYKLAEIDSAEIGFISNEIVSFYERVLK"
FT   gene            complement(<93385..>93636)
FT                   /locus_tag="Eint_090810"
FT   mRNA            complement(<93385..>93636)
FT                   /locus_tag="Eint_090810"
FT                   /product="Elf1-like putative transcription elongation
FT                   factor"
FT   CDS_pept        complement(93385..93636)
FT                   /codon_start=1
FT                   /gene_family="HOG000159293" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090810"
FT                   /product="Elf1-like putative transcription elongation
FT                   factor"
FT                   /note="similar to ECU09_0850"
FT                   /db_xref="GOA:E0S9E6"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E6"
FT                   /protein_id="ADM12210.1"
FT                   /translation="MSRKRVKRKINAPKRQSKLEKRFNCPVCNHENVVQCTVKRPLMKG
FT                   FANCSVCDASFTCEANKLTTGIDVYSAWVDECCKNTMS"
FT   gene            complement(<93985..>94683)
FT                   /locus_tag="Eint_090820"
FT   mRNA            complement(<93985..>94683)
FT                   /locus_tag="Eint_090820"
FT                   /product="ubiquitin activating enzyme E1-like protein"
FT   CDS_pept        complement(93985..94683)
FT                   /codon_start=1
FT                   /gene_family="HOG000149615" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090820"
FT                   /product="ubiquitin activating enzyme E1-like protein"
FT                   /note="similar to ECU09_0860"
FT                   /db_xref="GOA:E0S9E7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S9E7"
FT                   /protein_id="ADM12211.1"
FT                   /translation="MFTKEDQGKYKSEKAAEFINKQYGGRASFLVRRIEEVPINVLNQY
FT                   DVIFGALDNIEGRMNLNLMFRKSECKLLIDCGISGYRAHAKAVYRGSSCLYCIRELYRE
FT                   DGPEICSLGSLPKKITPENREKTLRSLVELRREEPGSREEKIKKIINEFNALAEENLKV
FT                   NAFDVVGMFDEIIPNVCFINSVCASLACGLIDATNLHYDFIFYSGEKNITLEKLILDRD
FT                   EKCIVCNTDA"
FT   gene            complement(<94910..>96340)
FT                   /locus_tag="Eint_090830"
FT   mRNA            complement(<94910..>96340)
FT                   /locus_tag="Eint_090830"
FT                   /product="putative mitochondrial translocase"
FT   CDS_pept        complement(94910..96340)
FT                   /codon_start=1
FT                   /gene_family="HOG000149614" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090830"
FT                   /product="putative mitochondrial translocase"
FT                   /note="similar to ECU09_0870"
FT                   /db_xref="GOA:E0S8U6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U6"
FT                   /protein_id="ADM12212.1"
FT                   /translation="MVGRKTSAFLAVTVMSGAILVWQGVRAWRRNRREKSIREYMDRGL
FT                   LLLKEKMYSEAAVLYLKCLNLMEECDERLVSVYNNLTICLAKIKAYKEAVAYAGRSLQI
FT                   NILNNEKALRLRYECHRALEMRRETLCDAFLCGLVTKDEKYRKLAQEILKLEAEAEARK
FT                   MAGTREACPSKISYENFFATFPDLFESESFVNDELVRLIRGGKYDEAFEKAEKRDDSIS
FT                   RFVVAGIVHVRGKDMEAVSLLENEKMIFSISLREYLKTLHGDTPMDIEDFVSKNSKSVS
FT                   VLFYASKIHLNLKNHELYEKFIDMALECENHDFLYVDRIIYEVGHGRSERAQEFLNRAL
FT                   EAHPLSISILSIACEYYIRNKDARLEMVMSTFEEHFQKDPRFLLLKGIAAQTKNEAELA
FT                   EKYFRLAIEADRRFFKPYVYLGGILLGRNDKDGRHVYEEALKCAVSYDELFLVYQALIL
FT                   IDVQEKIMKMYPDVLKTF"
FT   gene            complement(<96375..>98183)
FT                   /locus_tag="Eint_090840"
FT   mRNA            complement(<96375..>98183)
FT                   /locus_tag="Eint_090840"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(96375..98183)
FT                   /codon_start=1
FT                   /gene_family="HOG000149613" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090840"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U7"
FT                   /protein_id="ADM12213.1"
FT                   /translation="MKELKAFFKEFAEAEKIVEVDFDQKMSEFVKKAIIPVGMEDFVGC
FT                   ISELGLSHIDLEYYRGYFGYSQTYSLYKSMIKRIFSCGFSHKEIGLVMLLLDNETMCFK
FT                   RLLPMFSRLTTYVTRNLLDKNIVACCIVLQSVLKYIPDTMNGRDEYVLSLISYLVDIVS
FT                   RHTSFMFINEKDAGEIISTIDLLSRFHFTTSVSKTSSGILKEVIFRLESLSSGSMSLYE
FT                   EVFAVVCVLETIPSICRLLEGSAGFNFSSAYSSLQGLTLQRVEQVGLDEWDRIHNRFLV
FT                   AKYRSLESLHPWKTSFDRIMFYNDIERARHPSKVLRVLESLKRDISWSDMIVFACHPGL
FT                   QEEWLAFMFDSLFVKNPEHLVYIELFVESIGSQPDLLLYSGYLLIKIFGHIETEKKWNI
FT                   LVDLFLRNIQSLDQRTIRLRCIISDYISSLGSEEEKSIFLNAFVGRLQKDFVCFNASVI
FT                   GILHRLLNGVQRVSLETSRMVCLYIRGCAVCEWRREEASKDLEAMYMCVGSRAMILSGA
FT                   TVDFGQTSSHLERYYELIISCLSWIEGRFPEEYVDRIKETMLYFLLDADREQVHELGLL
FT                   IRGECSRFRDKFKELYGNQKSERTGI"
FT   gene            <98489..>99025
FT                   /locus_tag="Eint_090850"
FT   mRNA            <98489..>99025
FT                   /locus_tag="Eint_090850"
FT                   /product="hypothetical protein"
FT   CDS_pept        98489..99025
FT                   /codon_start=1
FT                   /gene_family="HOG000149612" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090850"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0890"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U8"
FT                   /protein_id="ADM12214.1"
FT                   /translation="MSRIGDKSLGLEKKIHKAALLETVTVLNDVADGKKKRKSREDTSV
FT                   AEVREKKNKKDTRKKTDSQGIRPSKQKRNAARKNGEITKKKVEEKTNEDKDSTECLKKM
FT                   TRKERRLEKLRSKGKGLPSKEYFEKFIKKYKDDSPQEKATRGVLPSKRKEDFPKGDGNK
FT                   RKKGSFSKKRKGRDQ"
FT   gene            complement(<99019..>100872)
FT                   /locus_tag="Eint_090860"
FT   mRNA            complement(<99019..>100872)
FT                   /locus_tag="Eint_090860"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(99019..100872)
FT                   /codon_start=1
FT                   /gene_family="HOG000149611" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090860"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0900"
FT                   /db_xref="GOA:E0S8U9"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U9"
FT                   /protein_id="ADM12215.1"
FT                   /translation="MLPGLQIFDLHEPSKCKILNTIGKDFEDCSPKPISKYHSSECTSE
FT                   CNDHHLIVYLENALCRGTQVEYEDISRMLLHRNSKVRRISLMLHYRNFPDIIPPSFQDD
FT                   PDHSVRAVYLSQRWNLRISSLIKQAEDENPDVRIAALHQLMRFSEDEKYKIKILRSVCH
FT                   RIHDRELTIRVFVSRAIGEFKDLSDEVVEKLLSKQVTSLDDQKLCGALIYGVEDEYSDV
FT                   RRNTISSVYSLVTPGIVSRAFDFIVDSLNDEDGDLRELSTLCLKKMSIKYTLVIDREIV
FT                   RQICESLKERRSKVKANILSLLANLKYEDVEIFDILVSHMDVNVRSRDVFRCIRKIVSR
FT                   NRKLFFANMDRFYKHTSIAQVESSLEDTFYIARLVVLRELKKANPGIRMSEVIENHFLF
FT                   LEIMECSEPDGCGGGYVFFRDILHQFLEELDGGEQREKNYRRLFRRMKKENDHRYWFIY
FT                   YIYKGMAELLRKGKSNILQRIPFLFANTGFDPSMANNTKNIAEYIRSLDFGSIRFLKYD
FT                   VDVPSRVKVCGRMPVRFSASLLFEKDHQDVHLKVWSSDKTPIYFKARKTIEVCILEDVS
FT                   SIYCSVVKLHSGQDIPLSHTKAISIERKKPRKDLIPGIDLY"
FT   gene            <100919..>101920
FT                   /locus_tag="Eint_090870"
FT   mRNA            <100919..>101920
FT                   /locus_tag="Eint_090870"
FT                   /product="deoxyhypusine synthase"
FT   CDS_pept        100919..101920
FT                   /codon_start=1
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090870"
FT                   /product="deoxyhypusine synthase"
FT                   /note="similar to ECU09_0910"
FT                   /db_xref="GOA:E0S8V0"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V0"
FT                   /protein_id="ADM12216.1"
FT                   /translation="MDGPKNVRDLCRKVKDELSFRKEVKGIDFEKEWDFMEIIKSFETT
FT                   GFQGTNLYKAIEEIERMRGSKIFFGCTSNIISSGLRDIIATLVKRKYVHVLVTTGGGIE
FT                   EDLIKTFKPTFCGDFNLKGKDLRDNGLNRIGNLVIPSENYEDFETWLNEVVNDITEGYT
FT                   KEHPRILTPSSFIKILGERINNESSVLYWAAKNNIPVYSPAVTDGSIGDILSFHPRRNM
FT                   LKLDIVEDTYRMNCEAVFNGETGAIILGCGIVKHHILNANLFKNGLNYCVLINNAQEFD
FT                   GSDAGANIDEAVSWGKIKSEAKGVKVFGDATILFPLVVAATFMKQDKACPER"
FT   gene            complement(<101943..>102401)
FT                   /locus_tag="Eint_090880"
FT   mRNA            complement(<101943..>102401)
FT                   /locus_tag="Eint_090880"
FT                   /product="ribosomal RNA methyltransferase"
FT   CDS_pept        complement(101943..102401)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090880"
FT                   /product="ribosomal RNA methyltransferase"
FT                   /note="similar to ECU09_0920"
FT                   /db_xref="GOA:E0S8V1"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V1"
FT                   /protein_id="ADM12217.1"
FT                   /translation="MEGVVCIKGDITSDSCLRSIVEALEGVLADLVMCDGAPDITGIHE
FT                   IDEYLQIELLMSALSASLRISKPGSSFVGKCLQGKYTEWMINHFRRFYNGVVLLKPRAS
FT                   RTESMECFLYCVGMKSTGDSSETDGAAYNASMKLCGYGKSFGLEYTVD"
FT   gene            complement(<102967..>103581)
FT                   /locus_tag="Eint_090890"
FT   mRNA            complement(<102967..>103581)
FT                   /locus_tag="Eint_090890"
FT                   /product="Rad52-like DNA repair and recombination protein"
FT   CDS_pept        complement(102967..103581)
FT                   /codon_start=1
FT                   /gene_family="HOG000149610" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090890"
FT                   /product="Rad52-like DNA repair and recombination protein"
FT                   /note="similar to ECU09_0930"
FT                   /db_xref="GOA:E0S8V2"
FT                   /db_xref="InterPro:IPR004585"
FT                   /db_xref="InterPro:IPR007232"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V2"
FT                   /protein_id="ADM12218.1"
FT                   /translation="MQEGEPRSWRPGTFSKKKAKKISKLLRQKLGPEFISYRPGFNMSK
FT                   IAYVEGWMAISLANRIFGFNGWSSEIRSMTIDYEEGGDKKIGLGVSCLVRVMLKDGTYR
FT                   EDIGFGSSENQKSKAIAYEKAKKEAATDALKRALRQFGNSLGNCCYDKNYIKEIQRIHK
FT                   INEKALDSNDLFRNNAVVSEESDKDGDASFEIDCHDLSDTL"
FT   gene            <103651..>104166
FT                   /locus_tag="Eint_090900"
FT   mRNA            <103651..>104166
FT                   /locus_tag="Eint_090900"
FT                   /product="ER to Golgi transport membrane protein"
FT   CDS_pept        103651..104166
FT                   /codon_start=1
FT                   /gene_family="HOG000149175" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090900"
FT                   /product="ER to Golgi transport membrane protein"
FT                   /note="similar to ECU09_0940"
FT                   /db_xref="GOA:E0S8V3"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V3"
FT                   /protein_id="ADM12219.1"
FT                   /translation="MDPLMSAFKARESKTFYSPIPHKYEQMFKPKKYDLEHFGLTFFQR
FT                   AVCFSACLGAGILSFLYSMIKIVRLSPSGFILPYTISNFLFFIMFGFLLGFRSYLEGLF
FT                   SKKKRIHSSWFIGCTLLTLYVVLKYDRYLLNLVFCFVQVTSFIMFSLTFIPGGTSGMSS
FT                   MVNMFFKK"
FT   gene            complement(<104239..>104502)
FT                   /locus_tag="Eint_090910"
FT   mRNA            complement(<104239..>104502)
FT                   /locus_tag="Eint_090910"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(104239..104502)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090910"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR005609"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V4"
FT                   /protein_id="ADM12220.1"
FT                   /translation="MVKQISNRNQIQQYKKRQSKLNELLYNQPSRLLISPMQVLVISLI
FT                   FIANVFLLHILGKLVPSSSLPQAAIALMVVLLSIAFSFLSSK"
FT   gene            complement(<104574..>105623)
FT                   /locus_tag="Eint_090920"
FT   mRNA            complement(<104574..>105623)
FT                   /locus_tag="Eint_090920"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(104574..105623)
FT                   /codon_start=1
FT                   /gene_family="HOG000149609" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090920"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0950"
FT                   /db_xref="GOA:E0S8V5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V5"
FT                   /protein_id="ADM12221.1"
FT                   /translation="MFKITGTRRTDKSFLDEIQGIPGKSGVDEVIGRLRKLKIFSAVAK
FT                   TCDGLSVTEEKRSISFSGDTTGKVPKGYLKMKLPNLFGRAENLEVSVSTSKDMSFQFSK
FT                   PVLAKSLSFLRIFGSRDTMKSPHEEYPHTRASLEVERETQRICVGRERIGYLDQAFIEL
FT                   RKKLGAIDIKSKIGIFDSRPCRLFLKTQAEMILRKAFPRNLFTDIHLSTGTILGEPHIA
FT                   ERYYLGENIRGYRGMSISPSNSGLKIGGNSFFEVSHRMGVSRWDAKGFFFWSLGYVSED
FT                   RNITRSFKSIMESHSYKDSECLGASVGLGASVPVMKAKDGPVVGISFAIPLTNNKQIQR
FT                   LQFGFDMDF"
FT   gene            complement(<105716..>106171)
FT                   /locus_tag="Eint_090930"
FT   mRNA            complement(<105716..>106171)
FT                   /locus_tag="Eint_090930"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(105716..106171)
FT                   /codon_start=1
FT                   /gene_family="HOG000149608" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090930"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0960"
FT                   /db_xref="GOA:E0S8V6"
FT                   /db_xref="InterPro:IPR007653"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V6"
FT                   /protein_id="ADM12222.1"
FT                   /translation="MKTAGKRLSALVSFTFNPTVILLLSVFLFSFFVTKAPPVSDLRIR
FT                   EYKAYGRTQVVLFEPSIDLSSQFHFNLKQVFVYVRAIYGGRTDKSEIIWSRIVGWNDPQ
FT                   KLRGVFRSTYDIAGDLSDKPCFELRGCYFPRVGWVKDILFCKTAVEI"
FT   gene            complement(<106316..>106714)
FT                   /locus_tag="Eint_090940"
FT   mRNA            complement(<106316..>106714)
FT                   /locus_tag="Eint_090940"
FT                   /product="Homeodomain-containing transcription factor"
FT   CDS_pept        complement(106316..106714)
FT                   /codon_start=1
FT                   /gene_family="HOG000112863" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090940"
FT                   /product="Homeodomain-containing transcription factor"
FT                   /note="similar to ECU09_0970"
FT                   /db_xref="GOA:E0S8V7"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V7"
FT                   /protein_id="ADM12223.1"
FT                   /translation="MKDSRWMMEGEAILGLIKLRRLSDKSYLGLSGYKYKTRVQVYVLK
FT                   QVFEITPYPPHDTRQNLAILLNMSPRTIQIWFQNSRSVSKDLKKDNSSKDQESQRPSRI
FT                   KIVSNWNVPIKYILWLVLSYISYPQIGN"
FT   gene            <107021..>107929
FT                   /locus_tag="Eint_090950"
FT   mRNA            <107021..>107929
FT                   /locus_tag="Eint_090950"
FT                   /product="serine/threonine protein phosphatase 2A"
FT   CDS_pept        107021..107929
FT                   /codon_start=1
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090950"
FT                   /product="serine/threonine protein phosphatase 2A"
FT                   /note="similar to ECU09_0980"
FT                   /db_xref="GOA:E0S8V8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V8"
FT                   /protein_id="ADM12224.1"
FT                   /translation="MKELVSKLLNLELLTEIEVENICNKVSEILICEPNIPNKKSPVIV
FT                   CGDIHGQFFDLVSLFRIDGVPSKKRYVFLGDYVDRGRNSLECILFLFLLKILYPENVTL
FT                   IRGNHEQSTINRVYGFYEEIMEKYGTPRIWRMINEVFNLMCIGCLIDGRILCVHGGISP
FT                   KITSLNQIKRLDRLLPIREESEFADILWGDPYDGKGFQPSPRGSGYLYGEDVVIRFLEL
FT                   NGLTSIVRSHQLVIEGYKFHFPGRNVITVWSAPNYMGKCGNPASILRINETLDISDKDF
FT                   CIFKATPQRKEFLTKLEGLDL"
FT   gene            <107967..>108755
FT                   /locus_tag="Eint_090960"
FT   mRNA            <107967..>108755
FT                   /locus_tag="Eint_090960"
FT                   /product="hypothetical protein"
FT   CDS_pept        107967..108755
FT                   /codon_start=1
FT                   /gene_family="HOG000149607" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090960"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0990"
FT                   /db_xref="GOA:E0S8V9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8V9"
FT                   /protein_id="ADM12225.1"
FT                   /translation="MFSRLKSPEEERGVDVLKGYAVRTSKHEIKRFLRSMEYRRLPRHL
FT                   KRIKTWNEDLLVLVDIVEECDPIDSVANLVEEMVKEGFGSKLSGRRQESLIETVSIPKY
FT                   QPLTDSQYVESAKLWPCIRSCRFEEELDDDYIGSMVRVLKTKRSMAICTGACIIADGKQ
FT                   ELSIHEDTDNVLGHSILKAVEEVSKAQILYLCTGFDAFILKEPCLSCSMALVHGRIKRV
FT                   FCLKRDPEGPFSRIKINYNKNLNHRYPVYFMDETCADCPM"
FT   gene            complement(<108841..>109992)
FT                   /locus_tag="Eint_090970"
FT   mRNA            complement(<108841..>109992)
FT                   /locus_tag="Eint_090970"
FT                   /product="60S ribosomal protein L3"
FT   CDS_pept        complement(108841..109992)
FT                   /codon_start=1
FT                   /gene_family="HOG000107319" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090970"
FT                   /product="60S ribosomal protein L3"
FT                   /note="similar to ECU09_1000"
FT                   /db_xref="GOA:E0S8W0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W0"
FT                   /protein_id="ADM12226.1"
FT                   /translation="MSCRKFNAPRHGSLQFCPRKRSKTIRPSVGAFPADDISQPVHLTG
FT                   FMGYKAGMTHVIRTKTQVAKNKQLSREVMDAVTVVEAPPMVVYGIVGYERTVTGLHRLP
FT                   IVTVSYVNDGVLRRMFGNKYMEKEAAAQFCRGEVTESRVEEIKKRAECVRVLVQTQPEM
FT                   VKTLGLKKAHIAEIQLNGGSICEKVEWALERLEKEIQIAEVFGENENIDVIGVTKGKGF
FT                   QGTVKRFGVRKQPRKSRKGIRKVACIGAWHPSRVMYSVARAGQMGFHRRTEKNKRVYMI
FT                   GNGSTKIKTEFDLTEKAISPMGGFPHYGEVKNDFIMVKGAVVGPRKRVVTLRKSLTQQR
FT                   PSEELVIKFVDTSSKIGHGRFQTSAEKKAFYGAKKAETVAEVH"
FT   gene            <110124..>110405
FT                   /locus_tag="Eint_090980"
FT   mRNA            <110124..>110405
FT                   /locus_tag="Eint_090980"
FT                   /product="hypothetical protein"
FT   CDS_pept        110124..110405
FT                   /codon_start=1
FT                   /gene_family="HOG000190740" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090980"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1005"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W1"
FT                   /protein_id="ADM12227.1"
FT                   /translation="MSFHPEYKEYFKQGSTAKIYNGVFEDAGFYDEVDIKEFKYNKENK
FT                   TFYYPCPCGDNFEISLEDLKNGEIAARCPSCSLIICTVYEAEDLKMYL"
FT   gene            <110499..>111248
FT                   /locus_tag="Eint_090990"
FT   mRNA            <110499..>111248
FT                   /locus_tag="Eint_090990"
FT                   /product="CCCH-type zinc finger-containing protein"
FT   CDS_pept        110499..111248
FT                   /codon_start=1
FT                   /gene_family="HOG000149606" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_090990"
FT                   /product="CCCH-type zinc finger-containing protein"
FT                   /note="similar to ECU09_1010"
FT                   /db_xref="GOA:E0S8W2"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W2"
FT                   /protein_id="ADM12228.1"
FT                   /translation="MAKKQQETKQKSIRDIRKELEEKAFGLKNKKQKAAILKQIESLNL
FT                   KEQLEKKEKMKKEEKNVPVKQVIPVGVDPKTIQCVNFLNKICPDGDACKFAHKEVKKVE
FT                   KPKEENASEGPKRICQFLIDALNSGEYGDNWKCPFPKCVDIHRLVEIKENAQVELSLEE
FT                   YIELSRQSLPEKLTPLTEETFKQWKLRKQKEEKEHARKVKAIATGMKGIELFEARRELF
FT                   KDDEEAEDLDYTERCYSESEDEEDHSK"
FT   gene            complement(<111263..>111649)
FT                   /locus_tag="Eint_091000"
FT   mRNA            complement(<111263..>111649)
FT                   /locus_tag="Eint_091000"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(111263..111649)
FT                   /codon_start=1
FT                   /gene_family="HOG000149604" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091000"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1020"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W3"
FT                   /protein_id="ADM12229.1"
FT                   /translation="MYTTDKPEHLEDYRELHVDGRVFYKLKGKKQEAVRKRRYSDQFKD
FT                   PLFIQKDTNRKLRMMKQFRETHGDLESVIERWKDCVSECISILHTQYNIHPVEIFRAFS
FT                   LRKWGFDIEEYGCCEDDFLPCKEE"
FT   gene            <111781..>112431
FT                   /locus_tag="Eint_091010"
FT   mRNA            <111781..>112431
FT                   /locus_tag="Eint_091010"
FT                   /product="G2/mitotic specific cyclin 1"
FT   CDS_pept        111781..112431
FT                   /codon_start=1
FT                   /gene_family="HOG000149603" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091010"
FT                   /product="G2/mitotic specific cyclin 1"
FT                   /note="similar to ECU09_1030"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W4"
FT                   /protein_id="ADM12230.1"
FT                   /translation="MGWRKPERMMKRVFQDITNVSRKNIKLTIHRSSHRRKLVKWLYEV
FT                   MDDFGYSQVTFSTAVFILDRYTEVRGLDLGKYQLVGISSLFLSAKIEEKRCKEIDDYVH
FT                   VTDNTYSRREILDKEIEILEVFGFNLMFRLPHSFLKEKYLEKMSSEYTVKQCQEIFFCA
FT                   FSYVIEKNICGSSMYWIYLEGIKEAEKVLSGHKASEDFRFYLENNRRIKNIFM"
FT   gene            complement(<112453..>113508)
FT                   /locus_tag="Eint_091020"
FT   mRNA            complement(<112453..>113508)
FT                   /locus_tag="Eint_091020"
FT                   /product="pyruvate dehydrogenase E1 component subunit
FT                   alpha"
FT   CDS_pept        complement(112453..113508)
FT                   /codon_start=1
FT                   /gene_family="HOG000281336" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091020"
FT                   /product="pyruvate dehydrogenase E1 component subunit
FT                   alpha"
FT                   /note="similar to ECU09_1040"
FT                   /db_xref="GOA:E0S8W5"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W5"
FT                   /protein_id="ADM12231.1"
FT                   /translation="MEKEKYIQCNVQEILATIRVHEVRKEEIDMVHKLKIEEMIYIYKQ
FT                   MMKIRFVDKLMDIEYKKENIRGFCHLSIGQEGIYTALEYMMDDDIVVSSYRCHGIAYVS
FT                   GCRTREIMQEVLGRQGGVSKGKGGSMHLYNSHFFGGHGIVGAQIPLGVGIAYAIKYKER
FT                   VLGSKSQKGKVSYVFYGDGAANQGQAWESFNMAMVWKLPIVFVCENNRYGMWTPAESVS
FT                   ADTNFYLRGGRIPGIRVPHNNIFGLISVLGYARKHSAEKGPIIVQIDTYRLCTHSTVDS
FT                   KETYRSKEEVDRERKNDCMEDIRKRLLEFRSEEELGELERCVLEEVEKDMDAAKKSKPT
FT                   EESELFKDVFL"
FT   gene            <113551..>114210
FT                   /locus_tag="Eint_091030"
FT   mRNA            <113551..>114210
FT                   /locus_tag="Eint_091030"
FT                   /product="hypothetical protein"
FT   CDS_pept        113551..114210
FT                   /codon_start=1
FT                   /gene_family="HOG000149602" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W6"
FT                   /protein_id="ADM12232.1"
FT                   /translation="MFCLMSLRWQLGPQQMASQRILSAVDSINNLLKALPFRPSVRRCH
FT                   DSFVPKEMVGLLRKRALESTLPILKEIIDGIKLGQKKEDIIDDREICSRREFATGQLRH
FT                   LRLSMESEFEEGRINKIKDLLNEIEYYEKIGVKPIKKINVGKEMTLKIFQMLSCSGEAP
FT                   MDPYIGEYLGRRICFFHESPSEIEISSLRTMLRFLQESGGETAGRRGEDQAYEDLE"
FT   gene            complement(<114266..>114913)
FT                   /locus_tag="Eint_091040"
FT   mRNA            complement(<114266..>114913)
FT                   /locus_tag="Eint_091040"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(114266..114913)
FT                   /codon_start=1
FT                   /gene_family="HOG000149601" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091040"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1060"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W7"
FT                   /protein_id="ADM12233.1"
FT                   /translation="MTTTAFKNVRSLSQLVSVLLIVINIPLPFFLIPHLMFVRMESEHL
FT                   RMGIRGVTTIFRSTSMANITLGLFASCGINSKTRLYMKLYLLTGVLLLFMLITMLLYVR
FT                   IGYQSDVSRQLGRLYNNASVRNIILYFMECTNQMTCTRIIMKNISMIKYYYITIAIPSL
FT                   CLNLLNLILIRIATSINIETPPPKRPNFVEKTRVGMNTASLRNKRVVVNGAG"
FT   gene            <115142..>115948
FT                   /locus_tag="Eint_091050"
FT   mRNA            <115142..>115948
FT                   /locus_tag="Eint_091050"
FT                   /product="glycosylphosphatidylinositol transamidase subunit
FT                   Gpi8"
FT   CDS_pept        115142..115948
FT                   /codon_start=1
FT                   /gene_family="HOG000149174" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091050"
FT                   /product="glycosylphosphatidylinositol transamidase subunit
FT                   Gpi8"
FT                   /note="similar to ECU09_1070"
FT                   /db_xref="GOA:E0S8W8"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W8"
FT                   /protein_id="ADM12234.1"
FT                   /translation="MSLVFLYALSVAAKNYAILMNSSRGFHNYRHMANVYIFYNVLKEN
FT                   GFKDDQILIISYENQIEDIRNVDRGGVYIDEDQRIPYSAFTPSSNALADLLNALEGRNI
FT                   KLKDADESSNVFIYLNGHGNETFLKFGNIHFMTKDDLMARILKLAERVNKILLVLDTCQ
FT                   AEALIDREILPSNVFIVATSKTGQPAISSFSSSLICANVSDNFPYFFFKRFGKGIDRKI
FT                   RLPDLFSEIAKEPLGSELVFDEEKDFRFEDFFVQNNSAELLPFKER"
FT   gene            <116010..>116846
FT                   /locus_tag="Eint_091060"
FT   mRNA            <116010..>116846
FT                   /locus_tag="Eint_091060"
FT                   /product="hypothetical protein"
FT   CDS_pept        116010..116846
FT                   /codon_start=1
FT                   /gene_family="HOG000149600" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091060"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1080"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8W9"
FT                   /protein_id="ADM12235.1"
FT                   /translation="MEEEGNISASRGRPDKDRWDEYSILNDSSYKGGVTDKGNSLEWKS
FT                   FEKEECVFSEELPEKIEGLQEEEGSREKKKDWDGEIRKGNDNPIRPRKYVASNTEYDRG
FT                   EKGSPTSEEAKKEILLENLGVHQNISKQRYEEHIRKLRAASDKYTGEGEEVEDLVGARK
FT                   AQTEKEENMRRALKIQENDLWIKDQEIVLLREKVARLEMKMEIEGKEYIEKCIQRGEAA
FT                   VKILEEEMKKERRELLERIGQETEKSRVLSRRVEGLKKIINELVRKIKRMKQRSEG"
FT   gene            <116888..>117409
FT                   /locus_tag="Eint_091070"
FT   mRNA            <116888..>117409
FT                   /locus_tag="Eint_091070"
FT                   /product="hypothetical protein"
FT   CDS_pept        116888..117409
FT                   /codon_start=1
FT                   /gene_family="HOG000149599" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091070"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1100"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X0"
FT                   /protein_id="ADM12236.1"
FT                   /translation="MFESEYFKNLLNETTALIANKVEEGNNREEMEARIESNVATLKYL
FT                   AREITDRDLQSKTLKRIDMLCLEPEEFEMSDVRNRTVGARGSEHSDRMERDILKYTKRL
FT                   RGKVKEFMESVDMDSRVLEEVTDKMSKNLAGTSSTLKSLKIEGCRIPILGLLTSVTAVF
FT                   VVMYFVIRFL"
FT   gene            complement(<117451..>117909)
FT                   /locus_tag="Eint_091080"
FT   mRNA            complement(<117451..>117909)
FT                   /locus_tag="Eint_091080"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(117451..117909)
FT                   /codon_start=1
FT                   /gene_family="HOG000149598" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1110"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X1"
FT                   /protein_id="ADM12237.1"
FT                   /translation="MDECDALRYIFGGDLEHYTRDTEHVYKISAEGNSFEFRCSEGYPN
FT                   TIPEMSSDVEDNILAEVREETKKYISTPMIFDMVRIVVRKLEGSNIVSDVKRISISYNI
FT                   DDKQKITEEDFMNWKKGTPRAEKPRTGKTGKEIFLERRRSKEDFQDDI"
FT   gene            <118072..>119571
FT                   /locus_tag="Eint_091090"
FT   mRNA            <118072..>119571
FT                   /locus_tag="Eint_091090"
FT                   /product="hypothetical protein"
FT   CDS_pept        118072..119571
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091090"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1120"
FT                   /db_xref="InterPro:IPR012468"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X2"
FT                   /protein_id="ADM12238.1"
FT                   /translation="MENTRWIKAEIKNVNDGSVAREVLANETNSFVRELNHYEKNLKDI
FT                   LEELENQNITNKEEGISSVKKALEVLETLEKDVSSAVPEETSIWTKDFFKAVDRLRDSC
FT                   NLSLKSLEEALEKFLAYIDNNSDLKGDLLQKAKLIPLLCASSKLKEFSSGIRKSGTNAF
FT                   TWFFKFVRRIPVENFKKNINSSLNGLKEKICRVSGSQRATGKQEIREAQKIVDSFLRDV
FT                   TELQDEYEKTLGLLIRSEISFSDAFETMQGKISNFDGHMSDLEKKIKDIETAFQPILLS
FT                   KESHERSLPEDSFLKNIYLVLIIVLCIQGVLWYTDNEKSSAGTVWNMVVYSVAVVGTIL
FT                   YMAWVWGFGGRRWTSAASMVPMMVGLLNLGKRVSCEYGMEMAGLGFVMVCMESLARHGM
FT                   SSWEILAGLIGNGIVVMGWVSWATMRDRYGERMSQWMCGGLIVFGILMAVMMYMKEGRN
FT                   VERSTGSYMVFIMTVVVGTAVSYACGKDYRQLASKRMSLKS"
FT   gene            <119835..>120620
FT                   /locus_tag="Eint_091100"
FT   mRNA            <119835..>120620
FT                   /locus_tag="Eint_091100"
FT                   /product="hypothetical protein"
FT   CDS_pept        119835..120620
FT                   /codon_start=1
FT                   /gene_family="HOG000149633" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0570"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X3"
FT                   /protein_id="ADM12239.1"
FT                   /translation="MISILFLGHAEAATGIPSDLWDSVNYYSLLLPKRPEVALILFVAG
FT                   LFVNFLGIRAKRCSLSMISFPLLRLSIGSIMNVLKEIVIDKYGSISEAPQMVRNGLEIL
FT                   KKVDENRFFMIFLSVVLGLVMVFFAKAVIYILMVYLAFHLWGILESSAQGTMEGKLYYI
FT                   YQTIMLCIGILVLVLVKPITFLIYILIFSVFGSLFIIVGANFGSGLNLHLNQYIDMLRK
FT                   GDFYQDLVENKISVGYISLVTMGTICQILLRKKPTAKAN"
FT   gene            complement(<120683..>121795)
FT                   /locus_tag="Eint_091110"
FT   mRNA            complement(<120683..>121795)
FT                   /locus_tag="Eint_091110"
FT                   /product="hypothetical integral membrane protein"
FT   CDS_pept        complement(120683..121795)
FT                   /codon_start=1
FT                   /gene_family="HOG000149634" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091110"
FT                   /product="hypothetical integral membrane protein"
FT                   /note="similar to ECU09_0560"
FT                   /db_xref="GOA:E0S8X4"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X4"
FT                   /protein_id="ADM12240.1"
FT                   /translation="MPFATNIQGVIRLAAASRAFYIGISYVAYLLLPRFDKSTELIPSN
FT                   SCMKFLLSWDSIHFLEIMERGYRKTHEAAFFPLLPYLSRCIHKVLPLDPYTVGVLVSCT
FT                   AFVFSSALLYRITQKRYGNKIAAMSCILFIFNPASIVYTAMYSESLFMLLFLLGMYFIE
FT                   NRDTVRGVLFLSLCGLCRSNAVLFAPFLMCPLSRYTFTKIAVFLLPLAAFQYYTLLMIN
FT                   RANNTYKIFIPYSFIQRTLWEQGLFRFFTYKNIPNVLVGLPFILISLFILREYWNKRCA
FT                   GSSKAIGILQHFNTDMCAVVLLAQTLITVFLIHWNMYFRFVSFNPLIYWILAEKYYTMN
FT                   NGLWKKVLFRFYFGFGIAYAILFGCFYPPC"
FT   gene            <121862..>122683
FT                   /locus_tag="Eint_091120"
FT   mRNA            <121862..>122683
FT                   /locus_tag="Eint_091120"
FT                   /product="hypothetical protein"
FT   CDS_pept        121862..122683
FT                   /codon_start=1
FT                   /gene_family="HOG000149181" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091120"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_0550"
FT                   /db_xref="GOA:E0S8X5"
FT                   /db_xref="InterPro:IPR005052"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X5"
FT                   /protein_id="ADM12241.1"
FT                   /translation="MFVFLLHLLGCLCSEHVFIQEASLLSPYVDEIGRFLNWKTFGEQV
FT                   IKVHGKDMFVQLGYSSPNSSGAVVASHPIGSERFGMDLIIEVDSGQKGDTNEGMAIWIS
FT                   DEETFKEGPCFGRSCSFKGLLVVIKPSGKSYVGVKAGDVMINTSNMAKNFDKVEYRDFS
FT                   SGEKFVLRIEQKDYELSIYIGEGEDFSLVHSYRYNLVKEGDLLGVSASTDRSSTSFRLI
FT                   GIESYHLKNMEGKGYAKEDVHSGGRLIWFILAVVVSITAYYLYNIQVKKDN"
FT   gene            <122965..>124545
FT                   /locus_tag="Eint_091130"
FT   mRNA            <122965..>124545
FT                   /locus_tag="Eint_091130"
FT                   /product="hypothetical protein"
FT   CDS_pept        122965..124545
FT                   /codon_start=1
FT                   /gene_family="HOG000149579" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0260"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X6"
FT                   /protein_id="ADM12242.1"
FT                   /translation="MCSPAIEGPGEFIEFLKPLMIESPAIKKFIVNYFIEHSQENIDDI
FT                   AARIDGCLRKRFVENEVVSVVRSGEWGRISRVAGDRYVVSILSLDGGREERLHFSELAR
FT                   KDMAGRTEVKGYLLGITMETPFGRVLKENAFRSIRDSGEVMKCKVPQSQCYEGSFVSRR
FT                   GVGGTERRKWKTEKEGQGSREKNEERETEGSRAKRASVRKEGTKETSVSSILLVGPSQA
FT                   LEIPGLRKEDIELVMKIFGVVANFGGFFGIQEIDVLSLGRAIVDPWYEDDTICKIHLKL
FT                   ISGLRTEMDSVGMEEFVENSKACIEWAKEQGREEDLAGDGGEMEECLEQSLGCGEEGWK
FT                   KDLRKLIESICDDGDTDIFGIVRSISGRSRALGRGEIRKRLVVIELLMNMFFTTEQFRE
FT                   IIWEKMEESKDLEKKKRELQTRLKRSVGWDGESKEAGEGSRAEMEKELGDTREKIFQLP
FT                   VNTGVGTVDGVGLLHLGRKIYAAWEGDYYLVGRDRLADLCKKYKAKNKEERHVLESIGQ
FT                   NIEGLKGHL"
FT   gene            <124808..>126010
FT                   /locus_tag="Eint_091140"
FT   mRNA            <124808..>126010
FT                   /locus_tag="Eint_091140"
FT                   /product="hypothetical protein"
FT   CDS_pept        124808..126010
FT                   /codon_start=1
FT                   /gene_family="HOG000149765" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091140"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0270"
FT                   /db_xref="InterPro:IPR007241"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X7"
FT                   /protein_id="ADM12243.1"
FT                   /translation="MFVTASLCLTVYLASNIDSIRSNKIPRLGVNFSSAALVIGGVFVG
FT                   REAISYAINFRKMVSIFYMYRYILERDMEEIRFKDVVSGMIKLEREVHNRDLEEKDVRD
FT                   IVNHNRLLLLLMMRKFPSIFRPACSRFLLHILHGYIHRIEEGPVEELGDEIRVVSIGIF
FT                   ILSPAISIFFILYYIAKIIEKSQSNMFYVFKKSHRPWFKYMMAKRNEYPHETHRKIQKG
FT                   AGYLNGFFLSRKRDCIPRVCSGISFLLSCLVFLVGYLILSILVASKPNLSQSLSQDITV
FT                   FGRTTNIVYLSYLMGGISCCLRCLSIEYGVSNRRKMFAKWCVLMEQTEVLKYCGRRGSL
FT                   EAIMSKIFVPRIYLFLVEIVSPFIVPFQLEGMRRRLERIRQEFESVGEGEYDRRVSILD
FT                   L"
FT   gene            complement(<126038..>127102)
FT                   /locus_tag="Eint_091150"
FT   mRNA            complement(<126038..>127102)
FT                   /locus_tag="Eint_091150"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(126038..127102)
FT                   /codon_start=1
FT                   /gene_family="HOG000149764" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091150"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0280"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X8"
FT                   /protein_id="ADM12244.1"
FT                   /translation="MITDVLFHPEVLKILHEWKRGREEEVPLDLIALLVEGKQKVDYYW
FT                   MDKILYSYKKTSKRRKDRVNSLKKAVESNFDVEVSGEGNIYFLKSLDGISKGVRSLLKR
FT                   ARKKKAKDKGISGLERDTEKEEANTSGMLRFIQVEGIKKPSADMLGLFSPICFDKETAV
FT                   SMPSSPLSSTIRIRKDIQDPRRLSFIKFSNQLRPPLYGFGGQKHYVKNSLTRLPQVLDY
FT                   EEDSDWEDCEDAEVIESTEEESSEEESSCEWIELDSERMEPSRTCRKPCLGFPSCKFTI
FT                   FPSFCSSWISLPLVEREVFPEELLGELEKELLRCKDLGELVRRFGSKYVVKASVVSDKL
FT                   RDLGVLEPHKEINL"
FT   gene            <127410..>128239
FT                   /locus_tag="Eint_091160"
FT   mRNA            <127410..>128239
FT                   /locus_tag="Eint_091160"
FT                   /product="hypothetical protein"
FT   CDS_pept        127410..>128239
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091160"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1530"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8X9"
FT                   /protein_id="ADM12245.1"
FT                   /translation="MNHINRIRDILINLDSQSSLHEETVAECALVYYYNAVSKFLNGIL
FT                   FYEEKLNEVLESLNNKLNSQSEKGINAVKETLDTLRRLKETIQPKIECPFNQLSHPPEL
FT                   TNIEILEYNFKTFEEYFKAIDRMVSSEGQIPFEEFKDALRNVLPYVDYPLTHSTGSHSI
FT                   VLKNVFLQLLGEYNVSAVFENTCLNKYYENLRIIGRKVLQKHFESLIKSLVSENWKNEI
FT                   EKELSALEREVSLAYKHQRKRIEQGIQDARAVLNSLSQDVTELQDEYERIFGLL"
FT   gap             128240..128339
FT                   /estimated_length=unknown
FT                   /note="unresolvable sequence in this region due to sequence
FT                   content"
FT   gene            complement(<128655..>129173)
FT                   /locus_tag="Eint_091170"
FT   mRNA            complement(<128655..>129173)
FT                   /locus_tag="Eint_091170"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(128655..129173)
FT                   /codon_start=1
FT                   /gene_family="HOG000227039" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091170"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1520"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y0"
FT                   /protein_id="ADM12246.1"
FT                   /translation="MRKIIYEFEQCDPKKCSGKKLIKQNKIEPIKKNKNFKGVVLSPDA
FT                   DQSISPADRDVIERFGIGLIDCSWAQLDSVDFKRLPRKHNRLLPFMVAANPVNYGKPFK
FT                   LNCAEALSASLYICGFKEEAYEILNEFNYGNEFYKLNEDLLEEYSKCTSSAEVVEVQNR
FT                   FLESQSKKE"
FT   gene            complement(<129205..>130392)
FT                   /locus_tag="Eint_091180"
FT   mRNA            complement(<129205..>130392)
FT                   /locus_tag="Eint_091180"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(129205..130392)
FT                   /codon_start=1
FT                   /gene_family="HOG000149580" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091180"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1510"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y1"
FT                   /protein_id="ADM12247.1"
FT                   /translation="MDISDLLERCKDKAFVNDNKEQIRTKMIQQPLRDQVRSLLGTKRN
FT                   TAIVRLIEAVEAPADELVPSIEDRKNINQYVYSTYYYLYKMGLIRREKFEDVKKHFQCM
FT                   KNYEKMFEDTENSFIISKIEADRRRDKMIKREFNKASDTKEEIKSLLIELPEITTKEVC
FT                   EIKDGLTSVRSVFVIDLDPIFGIGGLRCQAKEETSRRISEIRDILFCIDNSCSRIITLG
FT                   SLGEEDGGEGHEATTLRNLKRDKYHRFERIFNSSERFKFTCTPLFYSVDRLLKSRITRL
FT                   YDSVVKLHRTKQTVYFVSARPLPQILAELLFFEYSSFDIRTVVSTKDVSFDVYKEIQRK
FT                   EDARVVAVGGEPSFYQEKGNIYKIGYENFRKMVEGILEPDESMERDSKNLSVSSA"
FT   gene            complement(<130468..>131100)
FT                   /locus_tag="Eint_091190"
FT   mRNA            complement(<130468..>131100)
FT                   /locus_tag="Eint_091190"
FT                   /product="putative methyltransferase"
FT   CDS_pept        complement(130468..131100)
FT                   /codon_start=1
FT                   /gene_family="HOG000209191" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091190"
FT                   /product="putative methyltransferase"
FT                   /note="similar to ECU09_1500"
FT                   /db_xref="GOA:E0S8Y2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y2"
FT                   /protein_id="ADM12248.1"
FT                   /translation="MEDPNEFEGEFVHKFYNENSREFSATRRKHWKMTETFLDRYWTAD
FT                   SIVLDAGCGNGRSFLVPGIVGLDYCWGLLRDGKAVKNYGLIRGDVLELPFVDCSFDLVL
FT                   SVGVIHHLSTDCRRKKAMEEMRRVLRDGGKMLVYVWGSSVSGKRKFSKIIGGSEQDYFA
FT                   TWNLRDDAKRYYHLYGMEDLVELCKSSGFKVLDHGPEEESLFVVLEK"
FT   gene            complement(<131167..>132546)
FT                   /locus_tag="Eint_091200"
FT   mRNA            complement(<131167..>132546)
FT                   /locus_tag="Eint_091200"
FT                   /product="putative protein phosphatase"
FT   CDS_pept        complement(131167..132546)
FT                   /codon_start=1
FT                   /gene_family="HOG000149168" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091200"
FT                   /product="putative protein phosphatase"
FT                   /note="similar to ECU09_1490"
FT                   /db_xref="GOA:E0S8Y3"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y3"
FT                   /protein_id="ADM12249.1"
FT                   /translation="MIDNEVSNLVEKLRGRMHLSVEKLELLVGVDPKLNELLVEYLAAL
FT                   APDKGHLIICELLLIEEPERIVPVIRRIFESFPDEVDRFIKKLLKSPFYVQRQAIPSLI
FT                   VNMEYKEAKEALRRCLKDPVAAVARKAALSLEEYKTIPFDDDELVEIVNDLHGSYSEWI
FT                   QCASSCVIPLIKRQTKFVSEICTSKSWRRRYAIAKEIRRLNVSDRAAVYSHLSQDPEEE
FT                   IRICLAGNMEHVEGWDRLVPLFLKDSSPGVRALIIQMIGNREEFQEMLKDVITDTSWEV
FT                   KKALLCVQRVDTYKSIVIPLINTLNSTPNWRTRKEILESISCASKQDEKLLKEFLGRHL
FT                   LGYLKDKVYEVRAEASKVIGELVSIYPWTVEWLPEIEAISSSKSYLYRITSVEAALSFD
FT                   KAHGTGFGKKLLSDPIENVKLCTLERIDAQEMDEGIKEIVCRLCDSSDSEIRRAAKGLL
FT                   K"
FT   gene            <132663..>133505
FT                   /locus_tag="Eint_091210"
FT   mRNA            <132663..>133505
FT                   /locus_tag="Eint_091210"
FT                   /product="hypothetical protein"
FT   CDS_pept        132663..133505
FT                   /codon_start=1
FT                   /gene_family="HOG000149581" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091210"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1480"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y4"
FT                   /protein_id="ADM12250.1"
FT                   /translation="MKYKITSKRLDEKILAVHVNGAVYTGGTSRTLVNQDTGEVMCRCR
FT                   KSIRSIASHGRYICCASYDCTAVLFHDGKVVDVIEGPDTEIKCVGFSEDGRYLAMATRG
FT                   KSVWVVKIDPEIEIDEIIEDHLHDVKGCVFHKGFLFTYGYDNTIKIYERFDYDDSWELV
FT                   QSISEKNTVWCVIFHGDKMVCSTEEGTISSYVLRNGWELEACKKLSIFPIYSICSVGRD
FT                   MAYVLNRNNIGIIDSNLNLTTTIEDIHEDFINGIAYDEGRGRIISGGDDGILNVIEMF"
FT   gene            <133899..>134183
FT                   /locus_tag="Eint_091220"
FT   mRNA            <133899..>134183
FT                   /locus_tag="Eint_091220"
FT                   /product="hypothetical protein"
FT   CDS_pept        133899..134183
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091220"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1470"
FT                   /db_xref="GOA:E0S8Y5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y5"
FT                   /protein_id="ADM12251.1"
FT                   /translation="MRERVVVSNKKVYISGIPEDTDKDELSALLGNCRISGGDKGKSYL
FT                   FAEYDNSEEQEKALNRINNSKIKGSKLFATQAYEKANIGRTGRKRSDSN"
FT   gene            <134268..>135131
FT                   /locus_tag="Eint_091230"
FT   mRNA            <134268..>135131
FT                   /locus_tag="Eint_091230"
FT                   /product="hypothetical protein"
FT   CDS_pept        134268..135131
FT                   /codon_start=1
FT                   /gene_family="HOG000149582" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091230"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1460"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y6"
FT                   /protein_id="ADM12252.1"
FT                   /translation="MSCFDSTLVVETDAVKDFKLPHTRQMILVKNVSSIQSSPFPKYLH
FT                   VFGRSCMSYQLAPFKLLRTFEYSEDVMDAVAIRGKMAVLSRDSIVVWNKGKEQVIAGKF
FT                   DGRLSEVDGCLGVQERAKLSVYSLETLEVMKVYKANAHCSIRDVLVTSLDNLVSLYFKG
FT                   GKILEISMPEAICKLCTDPLLTNIYCGTGSGTIFCCNTSNGEPSSMKYHRSQVVGLGIS
FT                   FCGKYLYSADMEGLVCIWDTKFNTVVGKVSMESEIRRMKVVYVSEWRKALDTPEDDLII
FT                   PGGTTK"
FT   gene            complement(<135213..>135647)
FT                   /locus_tag="Eint_091240"
FT   mRNA            complement(<135213..>135647)
FT                   /locus_tag="Eint_091240"
FT                   /product="GTP-binding protein"
FT   CDS_pept        complement(135213..135647)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091240"
FT                   /product="GTP-binding protein"
FT                   /note="similar to ECU09_1450"
FT                   /db_xref="GOA:E0S8Y7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y7"
FT                   /protein_id="ADM12253.1"
FT                   /translation="MLNIWDTAGQERFFSITKSYYRNADGILLIFDISDERTFSCVDRW
FT                   FGRIREETGGVPLFLVGNKRDKVDSASYKAMEGRFREKADEMKARYYTTSAKTGENVNN
FT                   IFEDMAMILLKKQALGQKWDIDSPLSSRGNPNRKVNSKCC"
FT   gene            <136007..>139300
FT                   /locus_tag="Eint_091250"
FT   mRNA            <136007..>139300
FT                   /locus_tag="Eint_091250"
FT                   /product="phospholipid-transporting ATPase"
FT   CDS_pept        136007..139300
FT                   /codon_start=1
FT                   /gene_family="HOG000201571" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091250"
FT                   /product="phospholipid-transporting ATPase"
FT                   /note="similar to ECU09_1440"
FT                   /db_xref="GOA:E0S8Y8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y8"
FT                   /protein_id="ADM12254.1"
FT                   /translation="MTDLMGRFRHISKEQRRRYPPNIIRNQKYKWYTFIFAVLRLQFSH
FT                   FFNTFLFFVCMTQLKKEYLVSSLVASVGPWAMVLMFSLFKEGVEDYKRYERDKVTNNQL
FT                   YAKLTSQGFVRVPSSRIEVGDLILLEKNERVPADMVLLKASDVSGNVFVRTDQLDGETD
FT                   WKLKLSIPRIQSATFDEVRRLSILAEQPNKNIYSFVGKIKIGRFSPEELEEVEEEDGEK
FT                   ERFASWLERFLEFDFGREESEADEMEKPRDVSWVYSSSTQSSEENGSRENSLKTPSEVS
FT                   ENSVSSETAEGLEVGNESNIGSEAGDIDASLRDQEGGENIAEVLNCENMLWMNTVVATC
FT                   SVLGCVVYTGKDAKAMLNTTQPRNKIGKIELELNGYMKVLGIGCMVLAGVFTYMRGLES
FT                   RPDIIFIRFLVLFSSVIPISLRITVDWARYCYGRYISRDEKIEGAMMRSNGLPEELGRV
FT                   SYFLTDKTGTLTKNEMEMKKIHLGTICYTKELNREISKNLAKVLNSRSDGKKVFSRGKK
FT                   NINARVYDLVQALSVCHNVTPVVSENEVSYQASSPDEVAIVQWTECVGMKLYKRDRSTI
FT                   VIRDPLNDEQEYRVLYTFPFTSETKRMGIIVRYNEEIIFFLKGADVVMKKIVKGNDWVE
FT                   EEADNMARDGLRTLVIAKKVLSKKEFETFEEMYNKAWMSLVDRAEAINKAMETIENDMS
FT                   VLGITGVEDKLQEDVKVTLENLRNAEMKIWMLTGDKIETAISIARSSRIFHRGTSYLVI
FT                   SNASSVGDVKTKLDLLRGSGYNSLVIDGQSLSFVIESCMDEFIEVVSGLESVVGCRYTP
FT                   TQKAAVARELKRKTKKCVCCIGDGGNDVSMITEANVGIGIVGKEGNQASLAADFSINKF
FT                   CHVSDLLFWHGRNSYQRTAKIAHLIIHRGLTLTVIQAIFCSLIYFVPVGLFRGELLMMF
FT                   ITVYTFLPIFSIICSSDISRSVVVKFPELYKELVENKLLSFRHFSVWILISFYQGTIMM
FT                   ITFYLLKQEFFIISTLTFTSLIINELLMVILTTTRMTSLVFISSGMSLAIYVVYFILRK
FT                   GLLRYQKPFYLFLLKIVVVNALAILVSVIQKLWTKYMSPPTYSKLEVLV"
FT   gene            complement(<139374..>139919)
FT                   /locus_tag="Eint_091260"
FT   mRNA            complement(<139374..>139919)
FT                   /locus_tag="Eint_091260"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(139374..139919)
FT                   /codon_start=1
FT                   /gene_family="HOG000149584" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091260"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1430"
FT                   /db_xref="GOA:E0S8Y9"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Y9"
FT                   /protein_id="ADM12255.1"
FT                   /translation="MNTKLRISILPFFLMHVLCSDNMNEALSIIKNLEDLKICDLHDMD
FT                   LEFISPEMMEALKRNKKIRKLDLSDNKLKELPSDFGCLEWIEEVDASNNRIRRLPRSMK
FT                   NMKNLKVLNLSNNRLRFFPWYLLKLRKEGIGSLRMLDLRCNPFYRIYHTSIARFLLNLF
FT                   FGEIVKTGTEREQVSSTD"
FT   gene            complement(<139982..>140719)
FT                   /locus_tag="Eint_091270"
FT   mRNA            complement(<139982..>140719)
FT                   /locus_tag="Eint_091270"
FT                   /product="putative U2 small nuclear RNA auxillary factor"
FT   CDS_pept        complement(139982..140719)
FT                   /codon_start=1
FT                   /gene_family="HOG000149169" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091270"
FT                   /product="putative U2 small nuclear RNA auxillary factor"
FT                   /note="similar to ECU09_1420"
FT                   /db_xref="GOA:E0S8Z0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z0"
FT                   /protein_id="ADM12256.1"
FT                   /translation="MATGRDTCLFYSKTNACRYGLECTKAHRIPIRGKVVVVKGMYLYP
FT                   KNDPESTLSKESIQIHLDLFYEDWFSELSIRYGSIRRLVIASNSSSQLLGNIYIEFEEE
FT                   KTALRCVEEIGKRYYSGRRIAAELGNCYRIDDGMCTDNEKEKCEKGEKCGFIHSARVST
FT                   DLAEELFESQGLLYGEKGTKSTWFDGGAKASGENLRKGPIRNGNPHESYGMSRRRLDGQ
FT                   GNHNHSKRTKGRRDEEYPRVRRW"
FT   gene            <140797..>141258
FT                   /locus_tag="Eint_091280"
FT   mRNA            <140797..>141258
FT                   /locus_tag="Eint_091280"
FT                   /product="hypothetical protein"
FT   CDS_pept        140797..141258
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091280"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1410"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z1"
FT                   /protein_id="ADM12257.1"
FT                   /translation="MESEVKISITTLAKEIYSGVLGRYASGKYVILKNVVRRHPGSTDN
FT                   RRDVFVYPVMRFKIENIGEIGITWTPNSGGKENGLLVLESLGSKARILEAGGDKGICSR
FT                   SSGSPEGLEGTRGEVVERILDTHRSPRIERLFRRLDLDCMPSRATRQIR"
FT   gene            <141399..>142133
FT                   /locus_tag="Eint_091290"
FT   mRNA            <141399..>142133
FT                   /locus_tag="Eint_091290"
FT                   /product="hypothetical protein"
FT   CDS_pept        141399..142133
FT                   /codon_start=1
FT                   /gene_family="HOG000149585" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091290"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1400"
FT                   /db_xref="GOA:E0S8Z2"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z2"
FT                   /protein_id="ADM12258.1"
FT                   /translation="MSTTNSDEDQKRILYESLCTVEAENLSEACTNAIEGKRTETGKKA
FT                   HIIRFIGEMCCCGDMFDTDAFINESVFSAMAYIEKDISGVKDVFISAESEENSNNCAKL
FT                   LELNEKIEYSSVHPKDVAMGFRIYTEENIKNVIPHNVRKKVIEAYRNNDEEKKKTIIPR
FT                   IPFVIGDSKRMFLKSLKSIFLAIEANNKDEGANVEKIYRIFGSLIIRRPDGMLDTDGET
FT                   LKMILMDLMKADFDEFPVSFYS"
FT   gene            complement(142202..142274)
FT                   /locus_tag="Eint_091300"
FT   tRNA            complement(142202..142274)
FT                   /locus_tag="Eint_091300"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA Type: Arg, Anti Codon: CCT, Cove Score: 75.95"
FT   gene            <142365..>143645
FT                   /locus_tag="Eint_091310"
FT   mRNA            <142365..>143645
FT                   /locus_tag="Eint_091310"
FT                   /product="TIP49-like DNA helicase"
FT   CDS_pept        142365..143645
FT                   /codon_start=1
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091310"
FT                   /product="TIP49-like DNA helicase"
FT                   /note="similar to ECU09_1390"
FT                   /db_xref="GOA:E0S8Z3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z3"
FT                   /protein_id="ADM12259.1"
FT                   /translation="MAKNSNIAIHSHVKSLGLDNLGRPLDVPDAVVGQEDAREAAGLIV
FT                   EMVRTKKMSGRAVLISGPAGCGKTALAVGISEELGPGTPFTSMSGSEIYSSEVKKTEVL
FT                   EEALRRSILVRMRELKDVYEGEIVDLRIVDEENPLSTHGRRVKEIFVTLKTSKESKKLK
FT                   LAPSLYEQIDKQRIVNGDVVYIEVNSGVIKKLGRSEAHMNDFDLEAEAYVPIPKGEVLK
FT                   RKEVVQSVTLHDLDMANARPSGQDMLSLVFRILSPKKTEITERLRSDVNKMVNEYLEKG
FT                   NAEIVPGVLFIDEVHMLDIECFTFLHKVIESPLSPTIVFASNRGMAPIKGSGGLLGPFG
FT                   ITKDLLDRVVIISVKSNSSESNRKIIEMRLKEEGLEMDDDGLVFLASLSSSRGLRYCIS
FT                   LIPLLKTYGRSVGVRDVEEVSELFHDG"
FT   gene            <143687..>144955
FT                   /locus_tag="Eint_091320"
FT   mRNA            <143687..>144955
FT                   /locus_tag="Eint_091320"
FT                   /product="nonsense-mediated mRNA decay protein"
FT   CDS_pept        143687..144955
FT                   /codon_start=1
FT                   /gene_family="HOG000168152" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091320"
FT                   /product="nonsense-mediated mRNA decay protein"
FT                   /note="similar to ECU09_1380"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z4"
FT                   /protein_id="ADM12260.1"
FT                   /translation="MILCCKCGILIEPRLMNMCDRCLVTEVTISSKVKRNLVVERCRGC
FT                   ERYLQPPKSWEGFSWGSKELLLFLIKKNKTLNGLCIVDSNFVYTEPNSKRIVVALTVSE
FT                   CGVEQPLEIKYVIKNMQCSDCAKVEAKQFWNSLVQVRHRGRHKRMMIYLEHLVLKNNAY
FT                   GDTSNIKQRKEGLDFYYIDRNAASRMVSFLQSVLPVKTKVSERLISKDVHTSKCNYKFS
FT                   YSVEIAPLCKDDLVVVGRSLSQSLGIGSLVLVQKIATSIVLFDVGLMKSVRIAGSFYWS
FT                   NQDEFKVLMSSKDFTKYSVVMRDERRRKGGIGYDLTVTSDGSVFSEARFHLGNVEEDDE
FT                   ILGYDLRHLNLTVECEEKPEVVLVRKMPRDDVVWKIDVPQESQMEYRLFVEDVENDKEM
FT                   VEGLCLVEEKGGIDKKIEAFRVS"
FT   gene            <145021..>145317
FT                   /locus_tag="Eint_091330"
FT   mRNA            <145021..>145317
FT                   /locus_tag="Eint_091330"
FT                   /product="glutaredoxin"
FT   CDS_pept        145021..145317
FT                   /codon_start=1
FT                   /gene_family="HOG000149170" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091330"
FT                   /product="glutaredoxin"
FT                   /note="similar to ECU09_1375"
FT                   /db_xref="GOA:E0S8Z5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z5"
FT                   /protein_id="ADM12261.1"
FT                   /translation="MKGGELEKALDKNENLIVSKEGCPFCLDAVEILNEWKIKFDEVRN
FT                   IENEELSKEIERRYGISTFPKIFLKRRFVGGASDLRKYVTKKEFVDAFGSERK"
FT   gene            <145380..>145865
FT                   /locus_tag="Eint_091340"
FT   mRNA            <145380..>145865
FT                   /locus_tag="Eint_091340"
FT                   /product="translation initiation factor 5A-like protein"
FT   CDS_pept        145380..145865
FT                   /codon_start=1
FT                   /gene_family="HOG000149586" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091340"
FT                   /product="translation initiation factor 5A-like protein"
FT                   /note="similar to ECU09_1370"
FT                   /db_xref="GOA:E0S8Z6"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z6"
FT                   /protein_id="ADM12262.1"
FT                   /translation="MENLRFEETPTSPKDIRPGNYIKVEVNGQMRSAQVVDTSSVKNGK
FT                   HGAAKTTIASKILCTGSNHKGIYTANDSIIVCRPEKVQLKLIDISGSTITFSDSNGSFD
FT                   SVDVSGKMSSEDISKIAQSVEGSSSESFDLSLRVLPDFYKLESIRKSGGPSGSTAGG"
FT   gene            <145977..>148061
FT                   /locus_tag="Eint_091350"
FT   mRNA            <145977..>148061
FT                   /locus_tag="Eint_091350"
FT                   /product="DNA replication licensing factor Mcm7"
FT   CDS_pept        145977..148061
FT                   /codon_start=1
FT                   /gene_family="HOG000224125" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091350"
FT                   /product="DNA replication licensing factor Mcm7"
FT                   /note="similar to ECU09_1360"
FT                   /db_xref="GOA:E0S8Z8"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008050"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z8"
FT                   /protein_id="ADM12263.1"
FT                   /translation="MNQVSELRKFETSINYQLDKDRLSKFLLFHEEDGELTYVNRIRES
FT                   EGCVEIDTEDIAVYDDSGLVSRIEGNAMSYMNLLYTVIDEILLENGEAFGGEEPEDVFF
FT                   HHRVSRLKERFPEKNVMDVFPPFLLRRYSLVLKPRRNSRVYSVRGLKSMHIGSLVRVSG
FT                   VVTKASQVKPSIRVATYICENCGAETYQQVEGDVFDLLEECGSEKCRIRNVRGTLVLVT
FT                   RGSKFIKHQTVYIQELTGDIPRGCIPRTLVMECYSSLAEKCRPGDVVVAGGVFMPKPYH
FT                   GIKKLKAGLLADTYLHATSIERVGTSAPKLSGKVKKYPVEQMVRSIAPEIFGMEDIKKI
FT                   LLLMLVGAPGKVRSDGMRIRGDINVLLVGDPGIAKSQLLKTCVKISRRGVYTTGKGSSG
FT                   VGLTASVTKDQITGEMVLEGGALVLADGGICCIDELDKMNEVDRISIHEVMEQQSVSIS
FT                   KAGINTSLNARCCVLGAANPVRGKYDIRQSVEYNIGLPCALLSRFDVVAILRDEPDLER
FT                   DESLANHITSLHLEEETESISYDEIRQVIDEAKRIDPVLPLHLSNRLTDAYVKARKESP
FT                   YVTPRYLLSLIRLSLAHCRLRLSTEVEEDDINEALRLMEVTKIPIPKKKREEVSSKREI
FT                   YNLILSLAIEEGNKRYVKLARLWEATKNKYSTSEVEDVISDFASCGIWIRNNEELVIFN
FT                   "
FT   gene            complement(<148087..>148473)
FT                   /locus_tag="Eint_091360"
FT   mRNA            complement(<148087..>148473)
FT                   /locus_tag="Eint_091360"
FT                   /product="40S ribosomal protein S15A"
FT   CDS_pept        complement(148087..148473)
FT                   /codon_start=1
FT                   /gene_family="HOG000204097" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091360"
FT                   /product="40S ribosomal protein S15A"
FT                   /note="similar to ECU09_1350"
FT                   /db_xref="GOA:E0S8Z9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Z9"
FT                   /protein_id="ADM12264.1"
FT                   /translation="MSAELANMCKAINNASRAGKRQLLLKFSTEEMRMFLLQMLKYGYI
FT                   SGFSYIHDKRSGKSIIDLNGRLNRCGAISPNYIVKRDGIENFRERLLPARQFGHVLFNT
FT                   SKGILDHKECLTENVGGRILGYFY"
FT   gene            <148563..>149006
FT                   /locus_tag="Eint_091370"
FT   mRNA            <148563..>149006
FT                   /locus_tag="Eint_091370"
FT                   /product="hypothetical protein"
FT   CDS_pept        148563..149006
FT                   /codon_start=1
FT                   /gene_family="HOG000149587" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091370"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1340"
FT                   /db_xref="UniProtKB/TrEMBL:E0S900"
FT                   /protein_id="ADM12265.1"
FT                   /translation="MIFLLIFTVVLAIFIRIVAHLITRRGPRVIKFVGPRGAGKTKTLN
FT                   ALMGIHGRTVPTLESYKVIYKGMEIHDVIPKDGSFFERYGIDDPSATYFFFLRSMDDSY
FT                   GIPGAKGLNVRLVYCQPYDGKEALERGVLVLDKDLTHIEKYFS"
FT   gene            complement(<149032..>149961)
FT                   /locus_tag="Eint_091380"
FT   mRNA            complement(<149032..>149961)
FT                   /locus_tag="Eint_091380"
FT                   /product="replication factor C"
FT   CDS_pept        complement(149032..149961)
FT                   /codon_start=1
FT                   /gene_family="HOG000224155" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091380"
FT                   /product="replication factor C"
FT                   /note="similar to ECU09_1330"
FT                   /db_xref="GOA:E0S901"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniProtKB/TrEMBL:E0S901"
FT                   /protein_id="ADM12266.1"
FT                   /translation="MDLLVNKYRPNEVQDVIGNQMTVELVSLIIDSKDMPHLLFAGPPG
FT                   TGKTTCAKILARKLLPSKEGLLELNASDERGIETVRTTIKSFAQRRIKDCSFKVIILDE
FT                   ADSMTTAAQQAMRRVMEVHSSECRFILICNTLTKIFEPIQSRCAILRFDRIENSMILER
FT                   LREISKDEGIKISKEALDLIVELSDGDMRQSLNILQACISSSETIDQGYIIKIIGLPSP
FT                   KRIERVLERLLRNEAEEALKMFDEIWDEKFDPLDLINSFFRAAKNMENYELLKVIGLAN
FT                   LRISEGVNSRLQFYGMFHDILDMGNKKP"
FT   gene            <150146..>152005
FT                   /locus_tag="Eint_091390"
FT   mRNA            <150146..>152005
FT                   /locus_tag="Eint_091390"
FT                   /product="endochitinase"
FT   CDS_pept        150146..152005
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091390"
FT                   /product="endochitinase"
FT                   /note="similar to ECU09_1320"
FT                   /db_xref="GOA:E0S902"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="UniProtKB/TrEMBL:E0S902"
FT                   /protein_id="ADM12267.1"
FT                   /translation="MLVFFLGLTFAKDACVSGSAECVANTLRVCGIKNQWIYVDCPSGT
FT                   ECAVKGSEISCVPNGGKGELESHDKKKPKKRDESEASQSLEEKQDSGDDLGESPEDNRQ
FT                   SEDDKPEEPNEEQKKKVHGKKGDEDQEGKKKTKKEKDSDEKTKDKHLGLGEDKKKNTKG
FT                   NKKKEPKVVTKTVSVLKKETTTTVTVLKTVVQKQQPTEIKLEYTSSDIESKVKPVGSSS
FT                   PGQGQALQGSSRNVSKAGHPTSLPGIESMGGASSPGKAGQGATPAAPSSSGSPSSGKGT
FT                   SVGSSSSSAPSSPTSNKSSSAPSSQGSTPESQGKAQTAGGGTGGATPSTGSQGGKGAES
FT                   GKSSGGSAGKTTGGTSSSAGSQEKKETGGSAGGSTQASGGSQGQKESEGSKQPEGGAGG
FT                   TSPSTESQGGKKTESGKSSSSEGKGGSLLSADKLTKVMTNLGYSPNSEYIDAVVLGVNE
FT                   RFSDLNQAVMFVAQCAHESGGYQYIEEIACAGGTGCAGQYGTGAPGKSYHGRGFIQLSW
FT                   PENYKAAGEALGRGDELYNNPEKVVENPSLAVDVSIFYWESRVADAPGVKENHFGATTK
FT                   AINGALECTGSNIDKSKKRYEIYTALVEEFGVSNPADESGCYS"
FT   gene            complement(<152056..>152922)
FT                   /locus_tag="Eint_091400"
FT   mRNA            complement(<152056..>152922)
FT                   /locus_tag="Eint_091400"
FT                   /product="histone acetyltransferase"
FT   CDS_pept        complement(152056..152922)
FT                   /codon_start=1
FT                   /gene_family="HOG000149172" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091400"
FT                   /product="histone acetyltransferase"
FT                   /note="similar to ECU09_1310"
FT                   /db_xref="GOA:E0S903"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0S903"
FT                   /protein_id="ADM12268.1"
FT                   /translation="MDLNDGEIDMLKKDPEFREYFDTIKRKNQSTEPIPPMKFQGRSVE
FT                   VTQAVFGDNLLDFPNRVWLFSDKNTIYICDRCLLQCWDSMSFASHRRSCSLEIPGKCIY
FT                   SDREEDISVIEIDGEKERVLCQRICIIGKAFIKRKTLYLDVDGYLFYVLFSEGKATGFF
FT                   SKEKESIEHNLSCLLILPPYRAKGYGSLMVDLSYILEAGTPEKPLSGRGRALYKRYWRN
FT                   KVLETLQNKNGQEVSISNISAESGLSVNDTIHGLELLDIDPESHTYDVIGKAPIPSRKC
FT                   KRNCLIL"
FT   gene            <152970..>153380
FT                   /locus_tag="Eint_091410"
FT   mRNA            <152970..>153380
FT                   /locus_tag="Eint_091410"
FT                   /product="DNA repair protein Mms21"
FT   CDS_pept        152970..153380
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091410"
FT                   /product="DNA repair protein Mms21"
FT                   /note="similar to ECU09_1300"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E0S904"
FT                   /protein_id="ADM12269.1"
FT                   /translation="MEEHITRRAEALKIAKSIIMKSDNPPEELVRKILIHQELLSNRDI
FT                   ILNDDFYSILTSKANVRPEMVGLARKKEQVECVRVEKKMICPISQKEVTEAYVGECGHV
FT                   LEEKEAIKYIRNNSRAICPQIGCNKRLVRKKR"
FT   gene            <153451..>153942
FT                   /locus_tag="Eint_091420"
FT   mRNA            <153451..>153942
FT                   /locus_tag="Eint_091420"
FT                   /product="hypothetical protein"
FT   CDS_pept        153451..153942
FT                   /codon_start=1
FT                   /gene_family="HOG000149588" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091420"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1290"
FT                   /db_xref="GOA:E0S905"
FT                   /db_xref="InterPro:IPR007144"
FT                   /db_xref="UniProtKB/TrEMBL:E0S905"
FT                   /protein_id="ADM12270.1"
FT                   /translation="MREKMYRERRQPKNRRMYGRLEKKKDLVKRLSKIGKQKEEIRRAK
FT                   EEIKNKSGQEYFFGYYSVERNGANIYKIDRPTLEELRKMKAYVDNEIQRSRMKLERYIP
FT                   RPCGTHIKFEEDSSSKNDTDIGFEHNEETRKEFEKYLEDLIGKRREIQERIDELKNQKI
FT                   "
FT   gene            complement(<153996..>154511)
FT                   /locus_tag="Eint_091430"
FT   mRNA            complement(<153996..>154511)
FT                   /locus_tag="Eint_091430"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(153996..154511)
FT                   /codon_start=1
FT                   /gene_family="HOG000149589" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091430"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1280"
FT                   /db_xref="UniProtKB/TrEMBL:E0S906"
FT                   /protein_id="ADM12271.1"
FT                   /translation="MSLSDRIIHTLKEMDRPSDFQIYRDILAAKPKLPPGKWNDLCRLA
FT                   KTSKIYNILRLDLSRKEAEVLGSALKKVSLNHVDDMIDILVKKRDENTPVLLRYILEKK
FT                   KKISIDPVQRYFCGELNRMVTLKHLKLLYVMHRNYPASINPTILDFCRSNGHPICKEVL
FT                   ESAMDVIE"
FT   gene            <154558..>154755
FT                   /locus_tag="Eint_091440"
FT   mRNA            <154558..>154755
FT                   /locus_tag="Eint_091440"
FT                   /product="40S ribosomal protein S28"
FT   CDS_pept        154558..154755
FT                   /codon_start=1
FT                   /gene_family="HOG000224552" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091440"
FT                   /product="40S ribosomal protein S28"
FT                   /note="similar to ECU09_1275"
FT                   /db_xref="GOA:E0S907"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S907"
FT                   /protein_id="ADM12272.1"
FT                   /translation="MEDQQEFFGKVTQVLGRTGGSGLLTQVKMELIHNKRMIQRAIKGP
FT                   ISEGDFVEILECEREHRRTR"
FT   gene            <154863..>155855
FT                   /locus_tag="Eint_091450"
FT   mRNA            <154863..>155855
FT                   /locus_tag="Eint_091450"
FT                   /product="hypothetical protein"
FT   CDS_pept        154863..155855
FT                   /codon_start=1
FT                   /gene_family="HOG000149590" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091450"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1270"
FT                   /db_xref="UniProtKB/TrEMBL:E0S908"
FT                   /protein_id="ADM12273.1"
FT                   /translation="MCRQNEIYGKQSEEEGHLNYGEIERKRRERVDELAYRLLVEREKA
FT                   NRSIEEELQRLFELEKDPVDTETHSSEEPAKEIETYSPVILEEHGLSEELSKNNSGMQP
FT                   LCSTNVPFTDELVSRFILNKAYVSIEEKIWRERQTMPKNIQMQTKIQVNKRLTQVSGKA
FT                   GQVDRIFNVLREYSHSYVFVETFTVKIIEQGRLQVSSCPESYKEFAELFCRFYSSELME
FT                   YFRVILFTREASSSTIKGVYSIYFGVLEIQGNSDEAWFFIASMLNSRQSELSCYVVECF
FT                   FSILGNLLFRTCRGPFFKLIEYVKRYYFREMNNEPCKIRISSMFERYGA"
FT   gene            <155917..>156903
FT                   /locus_tag="Eint_091460"
FT   mRNA            <155917..>156903
FT                   /locus_tag="Eint_091460"
FT                   /product="RIO-like serine/threonine protein kinase"
FT   CDS_pept        155917..156903
FT                   /codon_start=1
FT                   /gene_family="HOG000149591" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091460"
FT                   /product="RIO-like serine/threonine protein kinase"
FT                   /note="similar to ECU09_1260"
FT                   /db_xref="GOA:E0S909"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:E0S909"
FT                   /protein_id="ADM12274.1"
FT                   /translation="MKLITDGVWSLSRTHLRILRTAEQCMKSHVVIPFDVLKTRSQIKG
FT                   NFMEHVIDLCKLKFLSYVENGYKLTYSGHDCLAINTLRSRGLEAMGEKIGIGKESDIYL
FT                   GVYKGKDSILKLHRLGRSSFRNVRRNREYAGEKTDWLALSRTSCRREVEYLEKFKDMNV
FT                   PAVLDHDRHAIVQELLDYLPLYKTRVENVKTIFYLMIDFIKDLWKRGYVHGDFNEFNVL
FT                   VKDDIKVIDFPQCIQSNDERAVSYLRRDFECVLTYFKKKYRYEPENGCSKFMRELGIED
FT                   FLDEPETYGTDSEDSSLYSTDEVGSQKEMELLETKMEKTFISDTQSA"
FT   gene            <157081..>157764
FT                   /locus_tag="Eint_091470"
FT   mRNA            <157081..>157764
FT                   /locus_tag="Eint_091470"
FT                   /product="40S ribosomal protein S3"
FT   CDS_pept        157081..157764
FT                   /codon_start=1
FT                   /gene_family="HOG000210611" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091470"
FT                   /product="40S ribosomal protein S3"
FT                   /note="similar to ECU09_1250"
FT                   /db_xref="GOA:E0S910"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/TrEMBL:E0S910"
FT                   /protein_id="ADM12275.1"
FT                   /translation="MISGNKKFTLEMSDDQVLKRFMKNGLMNAELKEFFEKALVNEGFN
FT                   TMELRMQETPIKIILKVAKPHEAIGEKKYRLKQFQHLVAQRLEVPDENVEIIVEKVHEK
FT                   GLCALIQANFIREKMLGGVQYRRSVNMALKAVRHSGAQGCQIIVSGKLKGQRAKSVKFQ
FT                   DGVLIHSGNPVKDYIDTGYATVETKQGVIGIQVRIMLPYDPEGVLGPSYPLPDRITILE
FT                   PNEIQ"
FT   gene            complement(<157806..>158393)
FT                   /locus_tag="Eint_091480"
FT   mRNA            complement(<157806..>158393)
FT                   /locus_tag="Eint_091480"
FT                   /product="S1-like RNA-binding domain-containing protein"
FT   CDS_pept        complement(157806..158393)
FT                   /codon_start=1
FT                   /gene_family="HOG000149592" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091480"
FT                   /product="S1-like RNA-binding domain-containing protein"
FT                   /note="similar to ECU09_1240"
FT                   /db_xref="UniProtKB/TrEMBL:E0S911"
FT                   /protein_id="ADM12276.1"
FT                   /translation="MLTKIKNVLPGDDVPSNGSKSLGIHGTKATIVGTLCKTSNHLFVV
FT                   SKTNRYHPCIDDIVIGKAILTSQDMHRIDLGGVVGALPSLSFTNATKRNKPEINKGDYL
FT                   LCKIARTGTEPLLTCVGEGFGKLSGVVLPLEPWKVRLLYLSTTLATIGKKYRFRIALGL
FT                   NGFVWIDAEKDTDIRDIYHLLSEDSKLEFPNP"
FT   gene            <158446..>158862
FT                   /locus_tag="Eint_091490"
FT   mRNA            <158446..>158862
FT                   /locus_tag="Eint_091490"
FT                   /product="hypothetical protein"
FT   CDS_pept        158446..158862
FT                   /codon_start=1
FT                   /gene_family="HOG000149593" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091490"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1230"
FT                   /db_xref="UniProtKB/TrEMBL:E0S912"
FT                   /protein_id="ADM12277.1"
FT                   /translation="MNVRPRKSASKYSFEPKIPQNQELFEVEESKEKKEFVLGDQGEYA
FT                   PKSMDQGVVEYPFILGKEDGVVLTLPSNALTSKIIVYEDGSCGLKIGDEIHPIATRFIG
FT                   ESLAIEHKDMAYNIGSAKFQLTPQVQDSLKDKSP"
FT   gene            complement(<158878..>159300)
FT                   /locus_tag="Eint_091500"
FT   mRNA            complement(<158878..>159300)
FT                   /locus_tag="Eint_091500"
FT                   /product="calmodulin"
FT   CDS_pept        complement(158878..159300)
FT                   /codon_start=1
FT                   /gene_family="HOG000149595" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091500"
FT                   /product="calmodulin"
FT                   /note="similar to ECU09_1220"
FT                   /db_xref="GOA:E0S913"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:E0S913"
FT                   /protein_id="ADM12278.1"
FT                   /translation="MEETKRLQKVYQLFAESPTERVPTDRLGDILRFAGYIISESYAEE
FT                   LMASVPGEMFDFSQLVEICEKIREREITREELQKSFRRLDAENTSHIDAGRLVQILSSG
FT                   ENKFSQEEIEELLNILNPDGDGKICYDLIIKNIFGY"
FT   gene            <159511..>160716
FT                   /locus_tag="Eint_091510"
FT   mRNA            <159511..>160716
FT                   /locus_tag="Eint_091510"
FT                   /product="GPI-anchor biosynthesis protein"
FT   CDS_pept        159511..160716
FT                   /codon_start=1
FT                   /gene_family="HOG000203293" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091510"
FT                   /product="GPI-anchor biosynthesis protein"
FT                   /note="similar to ECU09_1210"
FT                   /db_xref="GOA:E0S914"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013234"
FT                   /db_xref="UniProtKB/TrEMBL:E0S914"
FT                   /protein_id="ADM12279.1"
FT                   /translation="MVSDFFYPVMGGVETHIRYLSEELISMGHKVIVITHKIGDLVGCR
FT                   AVGNIKVYFLDIPVLCRNTTFPSLYSNLPLFKEVFDNEKIEIVHGHQTMSNMCIEALFH
FT                   ARTLNLKTVITDHSIFEVGPFENIVVNSLCRLALKNIDRCICVSYTSKENTHIRTMIPL
FT                   EKIHVIPNGIVSDIFYPREKKQSDERIVVVASRLMFRKGIDLLIGAIPLICKGDPEVRI
FT                   IIVGDGPMKEGIEQVLDENELYDRVEIICEVDHGEVGDIMRRGDVFLNTSLTETFCIAI
FT                   VEAASCGLHVVSTNVGGIHEVLPPDMITFSKITSEDLAEKVLMALKKNNHNPQDYNKRL
FT                   RNIYSWERVAKMTEKVYVDIKETSLSYLDRRKEFKGATGFISRFMITMEYIFLFFLGGK
FT                   SR"
FT   gene            complement(<160750..>162027)
FT                   /locus_tag="Eint_091520"
FT   mRNA            complement(<160750..>162027)
FT                   /locus_tag="Eint_091520"
FT                   /product="eukaryotic translation initiation factor 4A"
FT   CDS_pept        complement(160750..162027)
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091520"
FT                   /product="eukaryotic translation initiation factor 4A"
FT                   /note="similar to ECU09_1200"
FT                   /db_xref="GOA:E0S924"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S924"
FT                   /protein_id="ADM12280.1"
FT                   /translation="MKQALEREEDFEDLKSSNVEVRDFEDLRSDSSQIRMFDTWEDYGL
FT                   KEDLLKGIYGIGFETPSFIQKAAIQPIIDGRDIRAQAQSGTGKTGAFAVAALQICDMSQ
FT                   DVTQILVLASTREIAAQNAARFEDLGCFMGARVALLSGGSPISADKIALEKRPHIVVGT
FT                   PGRVEHMININELNMDNIKLFVIDEADEMLKAGFQEQVKSIFRRITNKDEVQIAMFSAT
FT                   YDEEELRVSEEILINPVIIDLRYNDQTLKGIRQYFIDLKKEPPFRKGREDYLLPKLVTL
FT                   YDIFRKQRLGQSIVFINSKEDARIVYDWLIKHEWECELISAELTQAERERTLNRFRGGT
FT                   GRCLISSGLLSRGIDIQNLSVVFCLDVPSFERKSTYIHRIGRSGRYGRKGIAINIVYEH
FT                   ELKNLKAIERFYNTTIKELPADFSFQ"
FT   gene            <162402..>163565
FT                   /locus_tag="Eint_091530"
FT   mRNA            <162402..>163565
FT                   /locus_tag="Eint_091530"
FT                   /product="transmembrane amino acid transporter protein"
FT   CDS_pept        162402..163565
FT                   /codon_start=1
FT                   /gene_family="HOG000149173" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091530"
FT                   /product="transmembrane amino acid transporter protein"
FT                   /note="similar to ECU09_1190"
FT                   /db_xref="GOA:E0S925"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:E0S925"
FT                   /protein_id="ADM12281.1"
FT                   /translation="MATTLASGYVTLLKTSIGSGILSFPYLFKTYGILTGIALTMVSGF
FT                   FSVLGLILYAICSQELGRTATLSRLATESMPYTRIIVDLSVFLKCFGVALSYLIITRQL
FT                   LPVLIETIFGASILSDPNVSLLAFISCIGPFAYFNRLDKLKYTSLCGVIAIVVVVIASL
FT                   YRYEYTPVSATNSIEYFAPLSYAWAGGFGKFVFSFTCHQNIFAIHSEMEDNSFPRMKRL
FT                   IYMVASSAAIIYISFGILNYLLYGKAVKDNVLENYPNDVLASVVRGLYIVVMGVSYPLQ
FT                   VNPCRSHLINIIAFSQRSEKLLRFAVTTGIIISTCLLAVSGMSLGIIYSVIGATASTFM
FT                   CLIFPALFYFNMNITKPKGLIFLSYTAFLFGIFVFSASLFSIILRNI"
FT   gene            <163613..>164314
FT                   /locus_tag="Eint_091540"
FT   mRNA            <163613..>164314
FT                   /locus_tag="Eint_091540"
FT                   /product="hypothetical protein"
FT   CDS_pept        163613..164314
FT                   /codon_start=1
FT                   /gene_family="HOG000149596" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091540"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1180"
FT                   /db_xref="GOA:E0S926"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0S926"
FT                   /protein_id="ADM12282.1"
FT                   /translation="MNSKEIERYFRKKRQYLSKEEYRTIVEVLRRLENAEKTSNKHLAE
FT                   EMKNKGNEEYNAGDFQSAIDSYTQAIIYDPTNAVYLSNRAAAYSKLGMVESAIEDCERG
FT                   LKIDCKFVKLYIRLGMLHLDRDKEKACQIFKRGLEIDPENKTLKRQLALLQEKTPDQSL
FT                   KSSKSPSLDDMVKNINMEALKDSKIDFNSFFNNKNIKDVLDTVIKDKSPKDLMEMVKDV
FT                   IEAMGGQDCKK"
FT   gene            <164702..>165526
FT                   /locus_tag="Eint_091550"
FT   mRNA            <164702..>165526
FT                   /locus_tag="Eint_091550"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        164702..165526
FT                   /codon_start=1
FT                   /gene_family="HOG000149597" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091550"
FT                   /product="hypothetical membrane protein"
FT                   /note="similar to ECU09_1170"
FT                   /db_xref="InterPro:IPR007217"
FT                   /db_xref="UniProtKB/TrEMBL:E0S927"
FT                   /protein_id="ADM12283.1"
FT                   /translation="MKYCFCRCFEESKNLVKIGLVDRIFRRDADEKTKSMCHLLCLKLT
FT                   NNGNIKRNGRWGFQPVLGMTEFFSALFSFMNLITNIFCFHRMLKKHLRVTRLGKLYYIQ
FT                   YYICNLAFISSTLFHIHETPFTRNCDYFLAFLTILFGFYMALVRVILMASPSMERAIRK
FT                   PLQLIFTLFYAYHIHRMSNIEFDYVYNKISCTIIIAFTLLSHLITFLKYRRMEHSKNIL
FT                   LFTFFFFLAGAIEIQDVPPYAYLIDSHAIWHLISCISTPFYLLFWSGDVYMH"
FT   gene            <165712..>167379
FT                   /locus_tag="Eint_091560"
FT   mRNA            <165712..>167379
FT                   /locus_tag="Eint_091560"
FT                   /product="hypothetical protein"
FT   CDS_pept        165712..167379
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091560"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1550"
FT                   /db_xref="InterPro:IPR012468"
FT                   /db_xref="UniProtKB/TrEMBL:E0S928"
FT                   /protein_id="ADM12284.1"
FT                   /translation="MDFNQLKRLTEYAKIIEGIGDKEAVKHLESAIESFLKEVESLLDK
FT                   VTNLGGNLEKAAEGADSEGICQNACQKLTNLSGLLKKAKESCCGKGPHKCTTLFKSIDD
FT                   VLKEVTEEGLDNTLGGLKDFLGIFKGDETLGEDIREEVKATTTTIEKFLESKFDDKLTE
FT                   ETLSCFKKCFSGTVCEEQCASDFSEGLQGKVDQLKILVDECPKEEVKGQLTELFEQVCA
FT                   LSNNIQEMAAAPENVFKHSCGQLANFSQVSEEFRSELRKVKGTLKDISEKLIDLEKKSE
FT                   EIRKLTRKGFFERLQDFYQRLKENILSINTGSLYGNLCLAFLGILVIQIIIWSFGREDE
FT                   ETDFQKAWNTTVYFIAVVVSIIYLQWLANKGYKSSSGIGDTLKKEWPTILSTIPMMIGI
FT                   LNFGPIKSSIYALTMAATAVVMLYAQNLVRTNNMSKKGMLLVGVGNLIIILAYFTGPES
FT                   SFMPTISGPNYRAYTALIIFVILLLIISYLERNLPKEEVLKEGTPGTKGLAYWISYALF
FT                   ALTLITVTWVSYMAGSDYHQLYGSNNSTKPLNDDFFNS"
FT   gene            <167667..>169040
FT                   /locus_tag="Eint_091570"
FT   mRNA            <167667..>169040
FT                   /locus_tag="Eint_091570"
FT                   /product="protein disulfide isomerase"
FT   CDS_pept        167667..169040
FT                   /codon_start=1
FT                   /gene_family="HOG000149167" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091570"
FT                   /product="protein disulfide isomerase"
FT                   /note="similar to ECU09_1560"
FT                   /db_xref="GOA:E0S929"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:E0S929"
FT                   /protein_id="ADM12285.1"
FT                   /translation="MFGIMLGTVFFSGYAMAEAVHMQDSTLLDNLKIVPSPSMIGMVRD
FT                   MKSIVSYVSEDEKFDGEGIKIKHDGRMFVVSKAEDVEGAVNILKKYPAPTEEVIKTIKS
FT                   SDGKGIEGNFIIYFLDNSGYKEKLVGSREGLNVFVSTDPALASLLDASIPGIYGYNGRD
FT                   RLSYKFPFSDKNATKIFSLTNLPIFGFTSAESISLYRSLDGTIFYIFFNPSSSLDVLNG
FT                   YSGVLDDFRYDVRVILIPSVKDGINLEDYGLTEKDLPGCISISEDGGKYILRNVTKESI
FT                   SEFVKDVLGGKAEAFYKSQEEPKDNGSKNVKVVTRNNSKTYLGDVSKDRLVVFGTERCP
FT                   HCIRIKPTLEKLGEIVKNNADDKVFIGYCDVDMNDMNDVEIRFVPTILLYKAGENKSIQ
FT                   YSGGERNLLNLITFIRESGSLGVDLSKFAGQEDESEKRKFEAGKEATGSWGEDARAEL"
FT   gene            <169093..>169557
FT                   /locus_tag="Eint_091580"
FT   mRNA            <169093..>169557
FT                   /locus_tag="Eint_091580"
FT                   /product="hypothetical protein"
FT   CDS_pept        169093..169557
FT                   /codon_start=1
FT                   /gene_family="HOG000149577" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091580"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1570"
FT                   /db_xref="UniProtKB/TrEMBL:E0S930"
FT                   /protein_id="ADM12286.1"
FT                   /translation="MDIPSIILRLLTDGIVDGEYHDSLSSLNELLRPIQYEAVGWPDGS
FT                   CIVLKDNHSSYPPDSRTKEIEDVFKKVVRGISVSGEVVDMLIRERWMESTSEGYRLSKR
FT                   SLVQHKDFILGLGEGYTVCDVCGFLRSENEVHKFCKELLESERGFGRKKN"
FT   gene            <169581..>169973
FT                   /locus_tag="Eint_091590"
FT   mRNA            <169581..>169973
FT                   /locus_tag="Eint_091590"
FT                   /product="hypothetical protein"
FT   CDS_pept        169581..169973
FT                   /codon_start=1
FT                   /gene_family="HOG000149576" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091590"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1580"
FT                   /db_xref="UniProtKB/TrEMBL:E0S931"
FT                   /protein_id="ADM12287.1"
FT                   /translation="MTVLEVEFPFRIGRRHPKLKVDVTMERKEDLVSFDMEYDMDLAID
FT                   NAEPKSKERAGGRFIHVYKFVDLDSAMEFMESRKAKALPPKGLLDVERVEKEMDLFMER
FT                   YEAGERKVKKKKKTIVVSEDGFMKYA"
FT   gene            complement(<170022..>170642)
FT                   /locus_tag="Eint_091600"
FT   mRNA            complement(<170022..>170642)
FT                   /locus_tag="Eint_091600"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        complement(170022..170642)
FT                   /codon_start=1
FT                   /gene_family="HOG000149575" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091600"
FT                   /product="hypothetical membrane protein"
FT                   /note="similar to ECU09_1590"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniProtKB/TrEMBL:E0S932"
FT                   /protein_id="ADM12288.1"
FT                   /translation="MEIEIGKEAIKRSTEYANKGLSGVSLKPFRTYFDIDNTFVLKKLV
FT                   LILFPFNNKEWASDDEGMARPELYIPVMSFISYVLVRALHLGLEGVFSPEKLGIVFTRL
FT                   FFLEAMCVLFMRVSGYFVDVTLCTLDVIAYSGYKYVIAVLLRLNKIQYVRVIGGMYLYV
FT                   SFFVFLSRSLKRRVMDKGAERMRRAYYLFGIVVIQEFIMFLLS"
FT   gene            complement(<170718..>172193)
FT                   /locus_tag="Eint_091610"
FT   mRNA            complement(<170718..>172193)
FT                   /locus_tag="Eint_091610"
FT                   /product="Nop56p-like nucleolar protein"
FT   CDS_pept        complement(170718..172193)
FT                   /codon_start=1
FT                   /gene_family="HOG000196309" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091610"
FT                   /product="Nop56p-like nucleolar protein"
FT                   /note="similar to ECU09_1600"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="UniProtKB/TrEMBL:E0S933"
FT                   /protein_id="ADM12289.1"
FT                   /translation="MEHLLFEYAGGYGLFELKEYEDMSKSTYEDYTKLTQVLNLRSGMR
FT                   FASLNEASDHLKCLSQGEIHEDLKKFLELNNVKVLHCDSTLRKGLDVLGIKQKESENIM
FT                   RGVRKDYRKLMRLDEYDSKQMVLGLAYEYSREKVEYNVKREDFIVIHTVMLLEQVGKDI
FT                   NSYSMRIREIYGWVFPELSVALKDNHEYIKAVKHFVDEETEGNKGEWKDIEVDVEKLEK
FT                   IKELKRNSMGMKLSPVDMINLKKLIEIVNNKIEIRKGLSKYLKDKMESIAPNLAAILGD
FT                   VLAARLISQGGGLLNLAKAPASTFQLLGAEKSLFKSLKTKTKTPKYGLIYTTSYLSRVR
FT                   DKDKGRICRYIATKCSIAAKIDYFGKDRTPDYGLELKSLIDKKIQSLRTNEEVERTSTV
FT                   IQRVFDRINGISKDKKTKDDLQPEDSKKNSKLKKQKKKSERQEHKEEVFRFGERRKGGD
FT                   EGSKRNDKRVSFDLTRNDIKETEKMPKKFKRKI"
FT   gene            complement(<172267..>173265)
FT                   /locus_tag="Eint_091620"
FT   mRNA            complement(<172267..>173265)
FT                   /locus_tag="Eint_091620"
FT                   /product="translation factor"
FT   CDS_pept        complement(172267..173265)
FT                   /codon_start=1
FT                   /gene_family="HOG000076160" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091620"
FT                   /product="translation factor"
FT                   /note="similar to ECU09_1610"
FT                   /db_xref="InterPro:IPR004388"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:E0S934"
FT                   /protein_id="ADM12290.1"
FT                   /translation="MRVVSAEGLDVESVLDFFEDVVVVPTETVYGLAANIWNLRAVERI
FT                   FALKGRPANNPLIAGISSVQMLEEIVEGPIPLQYKKLIENFWPGPLTLLFKSKDNVSPI
FT                   VRGGLNTIAVRMPGSKLLLKIIERLGAPLVIPSANISGRPSPTTIEHVIEDFGDEVKLM
FT                   IDGGPSSIGVESTIVQYVDGRLQVLRPGGITVERIKDVVDCEVIVKKNEWGGKEKRHKH
FT                   YSPKSPLVLFKGRQEDIKDGILKYISESSNIARVGVALHSGMDLKIFSDVKVDIFDMGD
FT                   DKKNICKNFFRGIRKLDKVNDIILVAGMDCDEQGHAIMDRLEKAADRVIEL"
FT   gene            <173574..>175250
FT                   /locus_tag="Eint_091630"
FT   mRNA            <173574..>175250
FT                   /locus_tag="Eint_091630"
FT                   /product="Rad2"
FT   CDS_pept        173574..175250
FT                   /codon_start=1
FT                   /gene_family="HOG000149574" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091630"
FT                   /product="Rad2"
FT                   /note="similar to ECU09_1620"
FT                   /db_xref="GOA:E0S935"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniProtKB/TrEMBL:E0S935"
FT                   /protein_id="ADM12291.1"
FT                   /translation="MGVRSLWKILKPSMEKTTPSGIKLAVDTSIWICQYGHLGSDDIIY
FT                   FFSKRIIKLLYHGIQPVFVFDGKPPEIKKHAILERRKRSNRSGIETVDKMLKWDENLDL
FT                   PSSKAKAVEFGKDRYNWGDIFDSELDSHLLEYSTSSDEEVSSNEREENSLELDISFDFV
FT                   ESKDLSRTQKLRRLVDLRGRRKEIRTRCNFDDPDTFSMLQIKNLKIRNLISHNIKALEK
FT                   KGYRRVHGDCKAIYKLTKKPDYVRNEGETTNELKKPTKRVLPATGPDLENDISELVDET
FT                   CVKNNLSVQDLASYPVLKSLVDKYKDSDRSLKKDTECIQGVENYKEEKVALVSGAKERM
FT                   MGGFFGLDGSLDSWDTVQEEYGSFYKGREIPDETNQGIRDICRVMRLIKDILEVFNISY
FT                   VEAPSEADAQCGFMCRNNTVDGVITEDNDVLLYGGTVYRNFFRRDRGIEKYSLERIKKE
FT                   LNLDRKNLIELSYLLGSDYTLGVKGIGPVKALEAVRKGSVREEDIGMLVGLYLNPVAID
FT                   MKDILIPVVDKDKIRMFYEKKGLSKERIDGVMFFLERIKFG"
FT   gene            <175324..>176286
FT                   /locus_tag="Eint_091640"
FT   mRNA            <175324..>176286
FT                   /locus_tag="Eint_091640"
FT                   /product="hypothetical protein"
FT   CDS_pept        175324..176286
FT                   /codon_start=1
FT                   /gene_family="HOG000149573" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091640"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1630"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E0S936"
FT                   /protein_id="ADM12292.1"
FT                   /translation="MKLRPRRIKKRCLVLLIILFNLLLVLLVKHKNKMNIGNKVDLGRL
FT                   KWFGTGTIVVSAMEMFQDVGFSDAISKSELISTDVQGQGDVVDSILSRVNVEVREILLI
FT                   DTRRLRGMNRTVFPRFEKERANYSLGIDYIEELAKEFIRRIDNGRVKYPFGSNTAREYV
FT                   MRIKSFTKRHTKGEDDSEIIKLVNKVFPTIEISFYTYIMMVLLNIREMIVEDFDSIKEI
FT                   LKTRKIYSISNDKINQLGGMIMRARAFNDGIPEWNLCNACDQVFFEEDRADLQKLTCDD
FT                   VICRRCLKQSFLYSDDEFCIKCGTEYDILPGNRFKDLLD"
FT   gene            <176368..>177819
FT                   /locus_tag="Eint_091650"
FT   mRNA            <176368..>177819
FT                   /locus_tag="Eint_091650"
FT                   /product="ATP-dependent RNA helicase"
FT   CDS_pept        176368..177819
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091650"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="similar to ECU09_1640"
FT                   /db_xref="GOA:E0S937"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S937"
FT                   /protein_id="ADM12293.1"
FT                   /translation="MEMPMKSMTEDIKKEGKKGGRNREKESWKKGEFLGKKYVERSSAG
FT                   LSNIRRSEEEFQGNGKDEERNNLEGKTNRKETRDTKTNSLELSLLNRTAESDGGVFLSK
FT                   DVRETENVKWEIFGLKPKLLKRIQDIGYNFPSPVQVASIPHALKGRDMLVRSKNGTGKT
FT                   ASYTIPILNAINPEELNIQGIILVPIRELALQISRNVKRLSEGMGVISAPIVGGTNMQD
FT                   DIIRVSNGVHVMVGTPGRIVDLIEKKIGVLSKKIILVFDEADKLLDVTFGETVTRLLDI
FT                   LPRERHILLYSATFPYFVTGFIKRYMRDPLCLNLMKELVPVGVKQFYTIVKPSEKLLCL
FT                   RSLLLKLKINQCVIFCNNIKTVELLAMKVTEIGIPSYFIHSKMTQEDRNIVFHNFLKGK
FT                   CKILVATDLITRGVDVPNTNYVINFDIPKSPESYLHRIGRAGRFGTPGVAISLVTTEEK
FT                   EMLADIEVKLGKEVSPLSDGGLDRL"
FT   gene            complement(<177927..>179168)
FT                   /locus_tag="Eint_091660"
FT   mRNA            complement(<177927..>179168)
FT                   /locus_tag="Eint_091660"
FT                   /product="GTP-binding protein"
FT   CDS_pept        complement(177927..179168)
FT                   /codon_start=1
FT                   /gene_family="HOG000189714" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091660"
FT                   /product="GTP-binding protein"
FT                   /note="similar to ECU09_1650"
FT                   /db_xref="GOA:E0S938"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012971"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniProtKB/TrEMBL:E0S938"
FT                   /protein_id="ADM12294.1"
FT                   /translation="MRENYYNKKKLKYLEMLRSGKAKKNSRGDIIKDAPFQNSKADVGR
FT                   IEPSRKWFTGSKTISSTELDAFRLETKIESPYNVLLSTGKVPYSLLEDGTKKKKRGDFE
FT                   EVFGKRSVRKKPNLQYSSLEELSQKAKEAKEEKKEVKKDHVKGQSHRIWLELYKVLDSS
FT                   DVIVHVLDARDPLGTMCDKIASYIKEEAPHKHLMYVLNKVDLVPTGVTAKWLKRLSKSH
FT                   PTIAYHSNSVTNNYGKASLINLLKQLSKLYKKRHLSVGFVGYPNTGKSSIINTLRNKEV
FT                   CKVAPIPGETKVWQYIALTRGIYLIDCPGIVPIPDYDQAVLRGAVRIENIEDPEDYIDM
FT                   IVEKARDSISKTYRIQFLDSTDLLERLAIKFGKLQKGGEPNTNTVSKMILHDWVRGKIP
FT                   YFVPPKEEDGDEEK"
FT   gene            complement(<179266..>180225)
FT                   /locus_tag="Eint_091670"
FT   mRNA            complement(<179266..>180225)
FT                   /locus_tag="Eint_091670"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(179266..180225)
FT                   /codon_start=1
FT                   /gene_family="HOG000149571" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091670"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1660"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019417"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S939"
FT                   /protein_id="ADM12295.1"
FT                   /translation="MSQEAREVSNLVNDMHKICDFGVTSQHWQLKDMLKIKGESLVFPK
FT                   ACNVMSFDPYKNATKMVYEGTDFFPTSICLKDDILAVGGSRGHLKVKNLSTNEVLSQVV
FT                   SSSINNNICINNNRIFICNNDRTLKVFTMDLQSSGCINHIAQVNSCGISPDNKFLVIVG
FT                   DSNDVFLYSIDNDNYKLVKKLKSTEDGGFSVSWNSVSSSFAVGTQDGYVCIWDIRSDRM
FT                   LHKFESKQKDSHKGAVRNVKFSLKNSLDLLFFTEHFSFLTICDMRDFRRCQRLKIFPDK
FT                   QITGAVFSEMNDKIFSSSEDQIFEININSKARRMFGGI"
FT   gene            <180555..>183155
FT                   /locus_tag="Eint_091680"
FT   mRNA            <180555..>183155
FT                   /locus_tag="Eint_091680"
FT                   /product="hypothetical protein"
FT   CDS_pept        180555..183155
FT                   /codon_start=1
FT                   /gene_family="HOG000149570" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091680"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1670"
FT                   /db_xref="InterPro:IPR019442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S940"
FT                   /protein_id="ADM12296.1"
FT                   /translation="MDSNWNTKDLYLLALEVSHLHKIGYGEIMSMRLRNGIQISCTLDN
FT                   GEEIGFGHLWRYEGEEAETRFKLCLVETQLKNSTEGAVDHLLMILPNTSKANQLTIFMI
FT                   FYKLTTKYKVYDKRILRECKAHLHAIHLRYPILKTLVAYTLFKEDLVSEEFTDEEIIEM
FT                   NLVDPRNLNPENPDAVRLVKRLFSTITKTSFRYSRRIFKHMDEKFFFHFPLELNGVGYS
FT                   HLRELIGELSPRKALSIGEIICSRSAVRLFFPLKIDDVERFFIHKDVEVRIESVRHIDT
FT                   VGLMKRFLEVNQFIYNRNMVKLLSRYFRIWLGKRVNEEHEFKVMYTEIVSPMLRSRNTY
FT                   RRLLGVHLMDSLIDIGVVEPSGHSWLLFDPDYEIRSIVCKYSGWIPLNIEEARIRIESY
FT                   QSYDVNGCVEYIKSCRPEWLISDLKDILDTYAKDFMSGKKGIEEVPIYGFLRLFSEVKS
FT                   YNIKIYVDRVYEYCFGKLSNVIHEQDDDGLVVYWKNMKECCNYYCSLALEGDKSSAAKL
FT                   VRTLLYINHLGVVLQVSQYLNKVLRSVVFPQDELLEIVDLSFKRIQNCKIFFRKSGGIP
FT                   LLLVQILRNYPSIINYVLERLLEMIDKDENNIKVHCLNILSRIIGDGSLSPKIPLQTIE
FT                   LFKISFRCSRSSLWAVRNIGIEIFSHLVRKVFERGPEFIVSIAHKEFRNLLYEELSSCS
FT                   HNKDDILVFLILHLYGRVKKLDEREMELVRRFSSRSDLIGLESKSICEGKECRRPQYRE
FT                   TRIKFDDKMNEGEILLRLLILLDSEQPEERRMAESYMKDVYKLSLYSEEYFRHYIAKRI
FT                   CRIGYKDVAVKKLQEYGLGVEKSQSCFFKDSPSNERFDLEYNISLIEKYKSQKW"
FT   gene            complement(<183211..>184554)
FT                   /locus_tag="Eint_091690"
FT   mRNA            complement(<183211..>184554)
FT                   /locus_tag="Eint_091690"
FT                   /product="asparagine-tRNA ligase"
FT   CDS_pept        complement(183211..184554)
FT                   /codon_start=1
FT                   /gene_family="HOG000226035" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091690"
FT                   /product="asparagine-tRNA ligase"
FT                   /note="similar to ECU09_1680"
FT                   /db_xref="GOA:E0S941"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:E0S941"
FT                   /protein_id="ADM12297.1"
FT                   /translation="MSGKIEEEISKLDFSEYKRIELSKLTKENIGQKIRTFGWVTNVRS
FT                   QSSITFIDLYAHYKTVKCVYPKKMHLTMCTSMTIYGTVAENFGKKDAYEFEIQVEKVEI
FT                   YNDAIAPSFPLNEESSVNAILTNAHLALRTKKRQLFLKARGYLLKIIRDFYFAKEYTEI
FT                   TPPTMVQTQVEGGSTLFKLDYYGEDAYLTQSSQLYLETVVPVSHRAYCIMPSYRAEKSR
FT                   TRRHLSEYTHVEAELADIDFSELMSSIESLISYSMEKFYEGMKDDILSLYPKFEFHKIP
FT                   KTPFKKIKYSEAIDFLNSKGYKKEDGTDFEIGDDIPDAAERYIVEAIGDGCPVFLTNFL
FT                   VEQKPFYMRKDKGNKDWTESVDLLFPGIGEILGGSMRQDIYEDLIEGFKREDINIDPYY
FT                   WYLDMARFGPCKHGGYGLGFERFLMGLMRYENVDEATLYPRKVSRCQP"
FT   gene            <184749..>186008
FT                   /locus_tag="Eint_091700"
FT   mRNA            <184749..>186008
FT                   /locus_tag="Eint_091700"
FT                   /product="kinetochore Nuf2-like protein"
FT   CDS_pept        184749..186008
FT                   /codon_start=1
FT                   /gene_family="HOG000113887" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091700"
FT                   /product="kinetochore Nuf2-like protein"
FT                   /note="similar to ECU09_1690"
FT                   /db_xref="GOA:E0S942"
FT                   /db_xref="InterPro:IPR005549"
FT                   /db_xref="UniProtKB/TrEMBL:E0S942"
FT                   /protein_id="ADM12298.1"
FT                   /translation="MQYFNEMEINIKASDILKPTPQSTQRIYEILLEVYCGIKTSDLVS
FT                   RTESTEGFEESLSYLLLQKRMEGFLRKIGMDNFGLRDLSPDSKRLIGILSVIVNFSMFR
FT                   DNKRHVYERVCQANDEKLLLKNEIDERVYNARKELEKCEKDAKKSVEDAKEVEKEISLL
FT                   ESELKDFYKHQRALVQETERIKAERNEYSDKLSSLRLMLLNFSQEITCLKTQVVSDPTK
FT                   LMELLEEMRSLISKENEIIRGLETKRIGLKEKTEFMELMKEDTMKAITLAISNREAGKT
FT                   VDRINREISELEVQIKNLDSGINALKIRLNHVNRQISHIESKIFNLQDNDKRCSEEISA
FT                   KLEKLKNNYGVVSGERNTIRKKIEENVRQTKNIEYELVKKRNEHINDITAIQSALCRLK
FT                   DDIFNYFAEAKGVIDKTMSS"
FT   gene            <186052..>186306
FT                   /locus_tag="Eint_091710"
FT   mRNA            <186052..>186306
FT                   /locus_tag="Eint_091710"
FT                   /product="hypothetical protein"
FT   CDS_pept        186052..186306
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091710"
FT                   /product="hypothetical protein"
FT                   /note="similar to TP01_0402"
FT                   /db_xref="UniProtKB/TrEMBL:E0S943"
FT                   /protein_id="ADM12299.1"
FT                   /translation="MVPESVNNLYKDLESVILQFKSPAFGNYFLKKAKEEFDNISIQTS
FT                   KQKDEGAIERYLKDQGELLDVLRRQTTIYNMFYDESSGI"
FT   gene            <186513..>188240
FT                   /locus_tag="Eint_091720"
FT   mRNA            <186513..>188240
FT                   /locus_tag="Eint_091720"
FT                   /product="vacuolar import and degradation protein"
FT   CDS_pept        186513..188240
FT                   /codon_start=1
FT                   /gene_family="HOG000149569" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091720"
FT                   /product="vacuolar import and degradation protein"
FT                   /note="similar to ECU09_1700"
FT                   /db_xref="InterPro:IPR013863"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S944"
FT                   /protein_id="ADM12300.1"
FT                   /translation="MVLGRIKKMFSNTKKNLFGDLHCGRTILMNGCEALASQEDLLFSS
FT                   KKSKMSFKLCEIVSIEHDNKTLSFIHNQKKYLFTSGESLDLFCKAIVPFIKKTKILYKK
FT                   SAVYSRYNTTTGRFEEASGNVDVFIVEDGMFLIRIETRDDIIHFEEIRTETQYYMDQKN
FT                   ITFVWSVMEGGVFHTFSLKFLDNLDFLEFLGKYIGCLYKNVNHENKEDKEAEQYFEKME
FT                   MENYHPDESSESEEEEEYESCDDDELENHFGEADEKNKHLVVGDEMAFITRGKSIGVFE
FT                   NTDDGLEFRANIKNVLNEDVKKIITHDNCASLIYLDKSERDKLHKLDVERGEVIETWDV
FT                   QRDVNDYFDAQKLIDTGSLVGLSDYSVFRIDPRTKNKVVESKDYKTRNNFNCGMATSLG
FT                   HVVAAGKGGDLRLYDKIDKRAKSLLPGFGDEIKYIDVTSNGKHIICTCKNYLMLTTVPG
FT                   DYKQPIGKDKPVPKRLQLKPEHLAYINEEIDFTPAKFSTDTSESSIITSTGSYVVKWNL
FT                   DDVLNGKLYSYQLAKCNDLVVADNFEFGENNSVIVTMPDDIRKVNVRNLKRPGRKIWG"
FT   gene            <188316..>189479
FT                   /locus_tag="Eint_091730"
FT   mRNA            <188316..>189479
FT                   /locus_tag="Eint_091730"
FT                   /product="sulfite reductase subunit alpha"
FT   CDS_pept        188316..189479
FT                   /codon_start=1
FT                   /gene_family="HOG000149568" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091730"
FT                   /product="sulfite reductase subunit alpha"
FT                   /note="similar to ECU09_1710"
FT                   /db_xref="GOA:E0S945"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniProtKB/TrEMBL:E0S945"
FT                   /protein_id="ADM12301.1"
FT                   /translation="MDFNPVRFEYNKNYTKSIASIFSRVEIISTDTDSSSRKFVFPSIG
FT                   SIKYCKARIVETERLETSWREVYRIKFDKKFDFKPGDSIGILCPNNDALVDEIMKILCL
FT                   KDFSCQMSRTGKNSFNYTGRIRDFFKYYFDFGGLPRKSLLINLARSCTEENQKYIEYLC
FT                   SREGIADYLGIGKRWNNILDIIRTFKCKPTLEEIIGECEIVKPRYFSLINEIGKESEIL
FT                   IGITNKIFNEFVRYGHVSDFIIQSEAEEIEACLRTNLLFRMDYNRRRILAICTGTGIAP
FT                   FLSFVANLQSHQSIWIIYGFRNDEDDISKLMKSGEKIKISRVKSSDGHYVTDYLVEKID
FT                   EIKEYIDEECAVYACGKMEMQRKVFEIFKNEHPEIVESKRLIFDQWG"
FT   gene            complement(<189525..>190541)
FT                   /locus_tag="Eint_091740"
FT   mRNA            complement(<189525..>190541)
FT                   /locus_tag="Eint_091740"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(189525..190541)
FT                   /codon_start=1
FT                   /gene_family="HOG000149567" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091740"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1720"
FT                   /db_xref="UniProtKB/TrEMBL:E0S946"
FT                   /protein_id="ADM12302.1"
FT                   /translation="MSWDEYDEASLSSSARSSEDIEGASNKDSSEDNSGCKDLVPDNKD
FT                   TKNKTEDDCSKLYITALGEEFFYLLIFDGSNLTLIKRVKKKISSQVFAKDLYIISDKKL
FT                   YGFHDVVSSPDSLDEVLKPERKRKKVNGSLLNDESHEEYTYRPFRKDRRIIFKREEGKS
FT                   DIANNWEGFFITRGLVHKIVYEDGGYTFVYNSKKYSYEKEIGRIAHNNEMLVYYLKGKD
FT                   SKLYFQEVHEKIYSIPKITTMSCEGQWTVVGTADGYIYLFNKCVLSGRKKVYNVPITGV
FT                   GFMNESVYFSSFDGFVGVHRMSGRYNILHMTLPIAIFIFAILIGLILKPVEFPFTSK"
FT   gene            complement(<190818..>191588)
FT                   /locus_tag="Eint_091750"
FT   mRNA            complement(<190818..>191588)
FT                   /locus_tag="Eint_091750"
FT                   /product="RNA polymerase II assessory factor"
FT   CDS_pept        complement(190818..191588)
FT                   /codon_start=1
FT                   /gene_family="HOG000149566" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091750"
FT                   /product="RNA polymerase II assessory factor"
FT                   /note="similar to ECU09_1730"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="UniProtKB/TrEMBL:E0S947"
FT                   /protein_id="ADM12303.1"
FT                   /translation="MNPEEITIGGRKISPKQTIKFKGTETKEYTFEQVLFYLLNKDKKY
FT                   TAYMTLCKESGIGKIYYTDQKIIVEEIENFKEASIEAKIDGPDFRYIGFRDYSYLNNIC
FT                   KKEEEGRPVTYYAIVPQSVSSPVNLSNVKEFFEKGICSDEISISEAEKVELKIEGFGVV
FT                   AVDDVGRFTSEDWKKVVCIFLDGTKWQVSRWNIKDVGEIFNSIPTFCFVKRGMTSSIYM
FT                   RNWNAIEIPIQNGKVDGPILSSIKERIRSCILGI"
FT   gene            complement(<191755..>193410)
FT                   /locus_tag="Eint_091760"
FT   mRNA            complement(<191755..>193410)
FT                   /locus_tag="Eint_091760"
FT                   /product="putative phospholipase activating protein"
FT   CDS_pept        complement(191755..193410)
FT                   /codon_start=1
FT                   /gene_family="HOG000149166" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091760"
FT                   /product="putative phospholipase activating protein"
FT                   /note="similar to ECU09_1740"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniProtKB/TrEMBL:E0S961"
FT                   /protein_id="ADM12304.1"
FT                   /translation="MIGIEKIEKISNSDVKALFVNDEMIITGGREGVIRIYGYELGCWA
FT                   EIKPGQGYINCITTGNGFLFVGCQNGCIVMYSMDELGAQKEEQKVEPMRLIKEHSSNVC
FT                   CLDTVGDLVVSSSWDCSAIIWTTKHILNGNVTIVQKIPHPAVVWSAKFVNENTVVTGCS
FT                   DKLVRVFKNGTLACTFNYNLSYVRGVALLHKSIISVDNEGMILKISLDGRILKHYSAKD
FT                   FMYTISSCTNGDSDLIICAGENGKVVILNEDLKLVQEILVPTTSCWAVLGWKGRVYVGG
FT                   SDGRLYVYSSDISDEASRILEEIRNSKEAPLKDGEFISDGQKFRVTDGSVYQEINGEWV
FT                   FLGKGEGIKPHDNTFQVELENKYYTLSFNNDENVYEVAEKFLSKNKLRDEFRDDIVDFI
FT                   KKNFTSAREFKTYSRINVEGIKNMLNRVKDDHGYLYPYILDNLERPKIADNGKVEEEIE
FT                   KLIENGLMFMALDLIRYFMVHKYSFDLSFLPTFTPQDKKEAITFVRLLSNLFIDPPFNL
FT                   EMFHSRVLELKDRGVVDGEVLDDYFVNRSLRNRA"
FT   gene            complement(<193483..>194874)
FT                   /locus_tag="Eint_091770"
FT   mRNA            complement(<193483..>194874)
FT                   /locus_tag="Eint_091770"
FT                   /product="SET domain-containing protein"
FT   CDS_pept        complement(193483..194874)
FT                   /codon_start=1
FT                   /gene_family="HOG000149565" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091770"
FT                   /product="SET domain-containing protein"
FT                   /note="similar to ECU09_1750"
FT                   /db_xref="GOA:E0S962"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="UniProtKB/TrEMBL:E0S962"
FT                   /protein_id="ADM12305.1"
FT                   /translation="MISNNTNPTTENHLRPNGFHPSVKKIVIPRIEPKTRSTFFTFTNT
FT                   SIKTEDDPILRFIPYIPGASGFINLTEFKNTGFIEKCYSYDKEVVKGTLPKKLDVWDRS
FT                   SFREECVKDDGLRIMRRIFCNVCFIFGCRWHSKTEGICIKPVGFEKNPTNAFVEARDIC
FT                   GDICKKMKITCKESTKEELDFNAYNALYEACMESQGYECIASLLFYFRYKKYIPCTKIK
FT                   DSCAIPPGRHKYLIESKSKNNVDFNVFFTPCDHSGNCTKENGCVCISNKTNCEMSCLCA
FT                   GCKNFFIGCRCSSACDNKCRCRQAMRECIQTCSCNQCGNRDIQLGKKSPIYVSSSKIEG
FT                   YGLFAKEKISKGKFIIEYVGEIISNEEAERRGTFYDLKGCSYLFDLYSREGVPLYVIDS
FT                   RFIGNESRFINHSKKNSNLNALVLLVNGIRRIGFYASRDIDKNEELFFDYKYSEKHKKK
FT                   HGIKD"
FT   gene            <195143..>195538
FT                   /locus_tag="Eint_091780"
FT   mRNA            <195143..>195538
FT                   /locus_tag="Eint_091780"
FT                   /product="hypothetical protein"
FT   CDS_pept        195143..195538
FT                   /codon_start=1
FT                   /gene_family="HOG000149564" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091780"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1760"
FT                   /db_xref="UniProtKB/TrEMBL:E0S963"
FT                   /protein_id="ADM12306.1"
FT                   /translation="MQVSTWPLPPRFKKKEPPKIPSSYTIFGVGYKVENGEPTSTSFSS
FT                   VEFDKSRLKDLLNLSFSTFVELLTFPLDHQELIETIGSIHLEINQILNGAKKMEAVSEI
FT                   RRIKNDHTRNKNRIAEEVRRGISDFKI"
FT   gene            complement(<195565..>196500)
FT                   /locus_tag="Eint_091790"
FT   mRNA            complement(<195565..>196500)
FT                   /locus_tag="Eint_091790"
FT                   /product="WD40 domain-binding protein"
FT   CDS_pept        complement(195565..196500)
FT                   /codon_start=1
FT                   /gene_family="HOG000149165" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091790"
FT                   /product="WD40 domain-binding protein"
FT                   /note="similar to ECU09_1770"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S964"
FT                   /protein_id="ADM12307.1"
FT                   /translation="MALSIEIPNAYLEFMSICDEYEIVSLVGKRTSVIISYADDLRMVQ
FT                   RVLDEHPDENFQCSEFLIRQNDVLLALGGSLGIIKVLNLSKGTFVGYIQAHGGIIFSIK
FT                   RYKDEYLLSCSEDTTIKMWDVSELKCVCVFGGYTGHRDHVLSIDVSDDLRYLASGGTDC
FT                   SIRVWRIPSSLNKFQCVAPIYLSPRIHKFPIQCVRFYREFLVFYSGESRIDIISPRYGE
FT                   VEPTSRTEFVGGVKFEGQLLRGFEIDDGMLVAVTESQDIILFKMNDIGFTSQSTILRST
FT                   KKGKIRDFRVIRNRMFILFEDSFFRVLSLA"
FT   gene            complement(<196525..>197355)
FT                   /locus_tag="Eint_091800"
FT   mRNA            complement(<196525..>197355)
FT                   /locus_tag="Eint_091800"
FT                   /product="mevalonate kinase"
FT   CDS_pept        complement(196525..197355)
FT                   /codon_start=1
FT                   /gene_family="HOG000149164" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091800"
FT                   /product="mevalonate kinase"
FT                   /note="similar to ECU09_1780"
FT                   /db_xref="GOA:E0S965"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0S965"
FT                   /protein_id="ADM12308.1"
FT                   /translation="MAYLARSPLKVILFGEHGVLSGARCLAISIKIYGYLAMKPSPRDK
FT                   AVVIDGEGNYIDLIEKYKCSIPGSDAILFLEASLGCGLGTSAAVSLLLSYGRVQDSKMT
FT                   REALAIENMFHGKASGVDVLACYTGGLISFKQGNVQKLSTRHLSRFKILIFNSRIPKNT
FT                   QSAIQVGELKKELYDEIGKISEEAYWLLQREFTLEELYKLIRKSQDLLDELGVCPREMR
FT                   EVVRRMRDIGVEVKITGAGCGGHLVTVVNKDLEIPGWTPVSIDLQGFYIFDTEC"
FT   gene            197421..197492
FT                   /locus_tag="Eint_091810"
FT   tRNA            197421..197492
FT                   /locus_tag="Eint_091810"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA Type: Glu, Anti Codon: TTC, Cove Score: 54.23"
FT   gene            complement(<197613..>199715)
FT                   /locus_tag="Eint_091820"
FT   mRNA            complement(<197613..>199715)
FT                   /locus_tag="Eint_091820"
FT                   /product="V-type ATP synthase"
FT   CDS_pept        complement(197613..199715)
FT                   /codon_start=1
FT                   /gene_family="HOG000149163" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091820"
FT                   /product="V-type ATP synthase"
FT                   /note="similar to ECU09_1790"
FT                   /db_xref="GOA:E0S966"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:E0S966"
FT                   /protein_id="ADM12309.1"
FT                   /translation="MLRSEKMCLVSMYFSKDTAKQTITEIGKNGLLHFKDLNKSIKAEN
FT                   LLYTREIAHMEKLISRLQYLTGDVGEIDEGIKHSDIDQVEEQVNKFFSRLTQLKSIKKE
FT                   TNANQGRLKEDLYMQEETENFLGTVAEEVHLVQFDFMTGIVERGKKLLIRKVLHQALRR
FT                   NLVIRTRDVEEGTKTVFIVLAHGCEALEKVRDIFSSLGGRMLDHKKFRECKRGLLELSA
FT                   TISQMQQIEDHNDEAIEKEQDKIRHFANTWKYYLNKETKIYQTLNKLSFDFDRDCLVGE
FT                   AWILGEEIGKLKRINEIKGDGTSLFAFEITESEEMPPTYFRTNEFTESFQILTNTYAIP
FT                   SYGEINPAVFSLFTFPMLFGCMFGDVFHGLLLLCLSVYMIKNSKKFKNCSETLRMIVNG
FT                   KYIIFVFSLAAMFFGFLYSDFGSLTIPLFSSSKDTGRPYPFGVDHMWHHSKNEMIFLNS
FT                   MKMKMSIIIGFFHMSLGIVISFLNAMYFNEPVEIYGVLIPQTIVFCSFVGYMVFLIIYK
FT                   WLVTSNYPSIIGVLVNMFTNPFVVAEEIYPYQHRVQLCLLFLMLLCIPWMLLGKPVYMI
FT                   AKNKVKKEEISSLWINQFIHVVEFGLGLISNTSSYLRLWAVSLAHAQLTRVLHEFTIGK
FT                   EGFIAPIALSGVYILGTIVLLIGMEGLGSCLHALRLNWVEFHSKFFRGKGYLFEPLGFN
FT                   ISLDDE"
FT   gene            <199942..>202722
FT                   /locus_tag="Eint_091830"
FT   mRNA            <199942..>202722
FT                   /locus_tag="Eint_091830"
FT                   /product="DNA helicase"
FT   CDS_pept        199942..202722
FT                   /codon_start=1
FT                   /gene_family="HOG000149162" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091830"
FT                   /product="DNA helicase"
FT                   /note="similar to ECU09_1800"
FT                   /db_xref="GOA:E0S967"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR014808"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:E0S967"
FT                   /protein_id="ADM12310.1"
FT                   /translation="MDRKPSVKWEEPESDRKTVPKKIERPSVSTLDFWNRELENPLDSD
FT                   KDQDESTDMDAFFTSTGCLENEKEREFLVYSKFTVREIKRSTDSVVLVGDKVECHLSGE
FT                   WCETEYRVNDRITVLHCICCNEQDETSDIDYLDEIFESECGDHSMIEEKENSGQSILRN
FT                   RIFVTNTENYLLIEDDPISITTLCESLSCKNKRYINTKIASIRFSYTDLRVLIGVVVHS
FT                   VMEKALVERNFSFDFLTRQTKAKISKNVALMHRCGIDERTALNESLKLIKNIYLFRDHR
FT                   FEVVETEKKLMSLLFNIKGNADAIGEDSVLEIKSTKSQRAEHRAQVILYALMLREKTGR
FT                   DFSPCLYYIPTREMVEVKLKHQEIRSLLNLRNKIAVTSEPCECTCDDFSCNALLKIKSL
FT                   DETHFLRSQLDAIDSEEGRTAESFIPVILRYQNNTLVRLDIQGVFSPNNIYLSLFSSDF
FT                   VRISKGIVEEINGNRLLVRLNEEILFKDREKLYVSFGVSDIFFRFMRFSLVHIAYPRYC
FT                   TPEVIGGFTLPMEKMGLGLENGFDEPNSGDGDSLLTEELEECLKSDKEVLENDKEKIKA
FT                   DGNGGDKTSSNISEIHTSYELDDHKITIPEVYREEFLKLNDDQRSALFLSLNCKNYRII
FT                   HGMPGTGKSTLICLLIKILVYLKKKVLLICYTNLALANITKKLSGIRVYTAGKEGFFFK
FT                   TTEEAKLFFDNIELVVGTCFSFSDPIYLNRRFDFCVVDEGSQMHLLLTLIPISISSKFV
FT                   IVGDHLQLKPLSRCSKDLSISLFEYLLGKDYSKLRTQYRMGNEIMRLSNTLFYSNQLLG
FT                   EKRPSKVEFIDTDIIDFMALVPSFEKCTILCYFNAQVDTIREMTRCIVETVDRFQGSES
FT                   DKVVVVFDPISKCEVMESSERLNVALTRAKKHLVLAGSRTKMMEIDILKRLISIL"
FT   gene            <202792..>203076
FT                   /locus_tag="Eint_091840"
FT   mRNA            <202792..>203076
FT                   /locus_tag="Eint_091840"
FT                   /product="U6 snRNA-associated ribonucleoprotein"
FT   CDS_pept        202792..203076
FT                   /codon_start=1
FT                   /gene_family="HOG000166937" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091840"
FT                   /product="U6 snRNA-associated ribonucleoprotein"
FT                   /note="similar to ECU09_1805"
FT                   /db_xref="GOA:E0S968"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S968"
FT                   /protein_id="ADM12311.1"
FT                   /translation="MLFYEFFKSNIGKRIFVMLKAGVYVSGVLNSIDPYLNLNLEEVEI
FT                   LSDHPGLSGTSLCSIRGSSIKYILADRDAGLLQGVNAGSRLRMILDKCY"
FT   gene            <203170..>205314
FT                   /locus_tag="Eint_091850"
FT   mRNA            <203170..>205314
FT                   /locus_tag="Eint_091850"
FT                   /product="hypothetical protein"
FT   CDS_pept        203170..205314
FT                   /codon_start=1
FT                   /gene_family="HOG000149563" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091850"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1810"
FT                   /db_xref="GOA:E0S969"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="UniProtKB/TrEMBL:E0S969"
FT                   /protein_id="ADM12312.1"
FT                   /translation="MKGYKRQSRESTIVKKFLKEHLNEGTTKSTCEKIYQLSQRVAKAR
FT                   MSKRLLSEIIKVSKVFVDDYAEKTRGMSSKDTGRCLYSFDCLWSRSMNLFGKVFCPIIR
FT                   TRRKFIDRLSSKLFMQFVKNIEDKIVKFIIDNIREEIQKVETNRRTSKPESSSLESSSN
FT                   KKQKLSQDEPGKLGELKERDFGVFESLSRKEKISTLIGILQGRGCFDLFLERVVGSLTS
FT                   VLDEKIDREGLGILAIKRLIDEQRKAGYMKDYFYAVESNLMRKIVIKYTNEEIFKMLDK
FT                   EDEMRLCMGFFCASNEEKRLMEALDVYFRKIMGNPSIDDFIGKYYWIYLKFRELENSKD
FT                   GGYERIIEGIRNCKKDILKLDAECVVECVCRWTDSFLRGKIIIQENTIEGMESPIFIPG
FT                   SERKEVINVERVLKKIGIDSLLEGNGWREYLVLNIFDMIGEMFRFCDYKEMFETTLQGR
FT                   LGSRLVSGSSISMDWEIRLIDKIDSGRSTIDKMRCMIKDFMETEQFMGHDILLLRGCKW
FT                   PRYEETILRIPDVEEVKKRYNHVVKNKRKIIRWNDLLSSCEIEFLGRMVRVTLPQYLMM
FT                   KLLVEKDRTAEDLKICKSWDKNLEVLVKKGLVKVEGKRHFLNMDYWKGDFPMDSMIPDM
FT                   FPLLGPQKIIKMFDESESYKDLLDCKIIKEMKANKTLSKSGLKELLNKTYPQEILDERI
FT                   DSLANREFLSVEGENIKYVP"
FT   gene            <205432..>206151
FT                   /locus_tag="Eint_091860"
FT   mRNA            <205432..>206151
FT                   /locus_tag="Eint_091860"
FT                   /product="hypothetical protein"
FT   CDS_pept        205432..206151
FT                   /codon_start=1
FT                   /gene_family="HOG000149562" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091860"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1820"
FT                   /db_xref="UniProtKB/TrEMBL:E0S970"
FT                   /protein_id="ADM12313.1"
FT                   /translation="MFLPWSAMNSEARIKKIMEETGCSLEVAKKAEQESQGNLNAAIEM
FT                   AKKKGNVLYSGGNSGLYVEENPSRKSITQYKNGILVEDKFYDFSVDNNIRLKDMLEKGT
FT                   FDASLLVLEGDTAEVIYSERLDEEYKEKKPQEPSKVTASFVGEGRQIGNSSRDIPCNNI
FT                   EDTLEIVHDGDTVFKVMIGSKRVTVKMHKFQTVGDFFDYMERYYDFGLVLSTNGKEIPP
FT                   SHSVEEISNKLVLLSRR"
FT   gene            complement(<206247..>206786)
FT                   /locus_tag="Eint_091870"
FT   mRNA            complement(<206247..>206786)
FT                   /locus_tag="Eint_091870"
FT                   /product="nucleotide excision repair factor TFIIH/TFIIK
FT                   subunit cyclin H-like protein"
FT   CDS_pept        complement(206247..206786)
FT                   /codon_start=1
FT                   /gene_family="HOG000149560" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091870"
FT                   /product="nucleotide excision repair factor TFIIH/TFIIK
FT                   subunit cyclin H-like protein"
FT                   /note="similar to ECU09_1830"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniProtKB/TrEMBL:E0S971"
FT                   /protein_id="ADM12314.1"
FT                   /translation="MLRGKKEMRDVIYAIVIVASKCEDLHGNIDTLIKRLPGSNKKNIF
FT                   NYESELFEVLDYNFHFPSLYLRMYGVLALLQEKGLIKVARDTPEATEGDKGEEIFVYSG
FT                   EDCIVPCINKLWKLSVERMDKILILGREPYKEIELVYASLYFPCEMFGFLSFSFSKDNV
FT                   IRLRNACESFRPPETK"
FT   gene            complement(<207102..>208280)
FT                   /locus_tag="Eint_091880"
FT   mRNA            complement(<207102..>208280)
FT                   /locus_tag="Eint_091880"
FT                   /product="26S proteasome regulatory subunit 8"
FT   CDS_pept        complement(207102..208280)
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091880"
FT                   /product="26S proteasome regulatory subunit 8"
FT                   /note="similar to ECU09_1840"
FT                   /db_xref="GOA:E0S980"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:E0S980"
FT                   /protein_id="ADM12315.1"
FT                   /translation="MVEGFCKNFYSNKLDHLEVLIAKKSKVLRVLEQKRAELNRRVRFL
FT                   REEISIVQEPSSNVGVIVEKMGKMQVLVKTNPDGKYLAKVEPGVNYDDLKPGVRVALRS
FT                   DSYDVHRILPTKVDPLVSLMMVEKVPDSTYQMIGGLDEQIKEIREVIELPIKHPELFEN
FT                   LGIAQPKGVLLYGPPGTGKTLLARAVAHHTQCKFIRVSGSELVQKYIGEGSRLVRELFV
FT                   MAREHAPSIIFMDEIDSIGSTRGDSNKGSDSEVQRTMLELLNQLDGFESHNNIKVIMAT
FT                   NRIDILDPALLRTGRIDRKIEFPQPKESARLEILKIHSRKMNLTKGIDLETIASKMVGC
FT                   SGAEVKAVCTEAGMYALRERRVHVTQEDFEMAVHKVLKKAGDLNSDLRKLLK"
FT   gene            208464..208534
FT                   /locus_tag="Eint_091890"
FT   tRNA            208464..208534
FT                   /locus_tag="Eint_091890"
FT                   /product="tRNA-His"
FT                   /note="tRNA Type: His, Anti Codon: GTG, Cove Score: 64.28"
FT   gene            complement(<208560..>209744)
FT                   /locus_tag="Eint_091900"
FT   mRNA            complement(<208560..>209744)
FT                   /locus_tag="Eint_091900"
FT                   /product="PHD zinc finger-containing putative
FT                   transcriptional regulator"
FT   CDS_pept        complement(208560..209744)
FT                   /codon_start=1
FT                   /gene_family="HOG000149161" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091900"
FT                   /product="PHD zinc finger-containing putative
FT                   transcriptional regulator"
FT                   /note="similar to ECU09_1850"
FT                   /db_xref="GOA:E0S981"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="UniProtKB/TrEMBL:E0S981"
FT                   /protein_id="ADM12316.1"
FT                   /translation="MCREKKFSIPYGESYYPKMSTSKCLGGVPREERDYRSIYHNLEIE
FT                   KMHQIISKSTYASESESDSKKTTRRNQKGNFFESIVYKLDSYDQLYLERSGIDISKDVF
FT                   ELVIDRLEKEWFLFVQDLVSRHVKPIEPTSFCDICTRHASERTGTLFVCQGCGICVHEN
FT                   CYGIQDLSDFWLCKGCIYGKDLKECSFCPSSDGIFKQTSDNRWGHVLCAMFNRSLSFGH
FT                   PLSKDPIDVSSYTKESGCSFCEKTVGTVICCSYFMCSRKYHVSCALDKCYFDLENRISY
FT                   CIDHSPLKRSPYELGYRKVTKIRYFGYEKLRNPPIIRKKAPMACPQVTLFRKLCNLQPV
FT                   ATPSILSKIKAYTQKEGNFPDLLKVLEYWELKRRGVGGPLLVLPEIKIGRKEEN"
FT   gene            <209719..>213024
FT                   /locus_tag="Eint_091910"
FT   mRNA            <209719..>213024
FT                   /locus_tag="Eint_091910"
FT                   /product="IkappaB kinase complex protein"
FT   CDS_pept        209719..213024
FT                   /codon_start=1
FT                   /gene_family="HOG000149161" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091910"
FT                   /product="IkappaB kinase complex protein"
FT                   /note="similar to ECU09_1860"
FT                   /db_xref="GOA:E0S982"
FT                   /db_xref="InterPro:IPR006849"
FT                   /db_xref="UniProtKB/TrEMBL:E0S982"
FT                   /protein_id="ADM12317.1"
FT                   /translation="MENFFSRHITIAETGGDTWIYSKGYTARKNIIYNESGESIYEIPF
FT                   VPKHFHVLAFEYFLVDELNAIYLVNKNTLEILEIGRVKDEVVALSVSRDEKWCVIASTT
FT                   EILLFDSYIDFKKSIKFEFNEVIQIEWTDYEVFGVLTSNMIFFYDIELNLVGKSKEREY
FT                   SSISWRSKYNVFGCSTGKEICFVEPNGLEHGDPLEVRCNKLTFLENEDLLATIENNDEG
FT                   SLLKVFYTKNFHWYLKLLKQVPGGFLCSEKNAVLFKDKERIAKVFLFEEKTHSGPEYYV
FT                   IDGNCILYTDFSKKIVPPPFFSVKIEFDSNVIDIFPSAKKGAVLLRDKVIIFKWNGDNF
FT                   ISEEAFFLGREFDSVVQFKSFLLLKSKDEFLIKKMNGGEEIRINRSVRIQEATRRNIMN
FT                   EENINVVTSQLCEILNSSVDVVRCYNFEEKLYLLLEDGSVIHNGRIVHSGIDLEKRFEI
FT                   VIGEDIFVHNGTKLFKNGNVTENITSFLIGEHGIITVSEGTGRFFLGLKESTCQVDHRL
FT                   ELLCALDFRVVGLTRHGTLETYTPKIYTLTFIRKLLLDGKYKDAIEGCQRYIIPFGVFL
FT                   DYNIELCKFIEACKDTHLISFFNEALQTFGDFDFILESEKVKRFRRVFNFPMVLEPGKG
FT                   KEYFEVLIANDESISDGSLEHLMEYRNGKSQEDSKLGNSRYSRDLPRDGKKLCGRNTKD
FT                   FFNELFQSLDLERNFKFAIFALVKVKRMDLALQVAKHDMKGGIGYMLSITNMSNIINSA
FT                   LETCEEDLVHEVMKICQKDSSDFLFLIRNCEKDLRGFKINDFLKNRIDALYHISRTGMV
FT                   DLEREYIQKHDLVEEALMYEACGLSIRKEGYYFNLCAELLPPEKALILFKRAQNIEKAL
FT                   ETAIENLYWREALGMCVKERQEELGKSLASRLIDSGKNYEAGQLFEEFLGDTEKAFIEY
FT                   VKAKSMGNALRLCSDGELLMKEAREILKEKLLVLDDIKKSFIKYRDRLKTLEEREDDCM
FT                   SETSFSYTENRRGSKSTKVKNRPGGGYEKEFVLGKIRDIGLNLMRWRDETEDLLKVFEK
FT                   FEMKECIDAHNTSFSAVGEVLKMEIDNVFGTEKRHLYESNRPIVEKPDLSKWL"
FT   gene            complement(<213061..>213801)
FT                   /locus_tag="Eint_091920"
FT   mRNA            complement(<213061..>213801)
FT                   /locus_tag="Eint_091920"
FT                   /product="undecaprenyl pyrophosphatase synthetase"
FT   CDS_pept        complement(213061..213801)
FT                   /codon_start=1
FT                   /gene_family="HOG000149159" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091920"
FT                   /product="undecaprenyl pyrophosphatase synthetase"
FT                   /note="similar to ECU09_1870"
FT                   /db_xref="GOA:E0S983"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniProtKB/TrEMBL:E0S983"
FT                   /protein_id="ADM12318.1"
FT                   /translation="MELILFIVGIFRKASSLTSMGLDVWNGIPYSNHSDGAFRRSRIKI
FT                   FQGMRVAFICDGNRRYMKKIGQKDKFTRDPGLQKIYEFINFGYFYGLKEVSFFCFALSN
FT                   LRRTPEEVNGIMNIIRKKIKNPKKTSIKPKFLVYGRLDLLDSDVRNKLIEVEKETENNT
FT                   DIVVNIFFAYSSEDEINRGIKFDSKVDILIRTGDAKRLSNFMVRQVATGTSVFFAKVLW
FT                   PELTIVHLFLILLKHQLENKYLLN"
FT   gene            complement(<213985..>215223)
FT                   /locus_tag="Eint_091930"
FT   mRNA            complement(<213985..>215223)
FT                   /locus_tag="Eint_091930"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(213985..215223)
FT                   /codon_start=1
FT                   /gene_family="HOG000149558" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091930"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S984"
FT                   /protein_id="ADM12319.1"
FT                   /translation="MIAIIVLIQVCLSKIVVVDDLGVTDRPNKDPDMARKVINALGGTI
FT                   KNSRDGVLLSNTKGIKRVVGDNENIPSKYDEGNRGEDKLFGKGKDSLSKKDDEENRLQL
FT                   NSSKPEYMGRSTPSSMDEDTTPELGMSYQESSLLNPLHIRSLFNRGNQQMFNGSGSGTQ
FT                   GYLPKDILSGYRPEQSKYIPLSFRESGDSFMEVPRYTRSPLGDGMGFGMGENTNQSDEL
FT                   GAKKSFIVLKMAQSKQKENMLQNSIDKLLQDIDQLTEKIQDTQKMKDNMMSRIHTKKNH
FT                   LRNLQTNIKEVEIQRGRTLALIRLSRNELLKLSKMMDDQRSKLALLEDEEKIFSDRIKK
FT                   YDEEYDIGNRELQLDETRTQEIKKNIEELERMYNILKIRNNELLNERNKESALRNRLEL
FT                   ETERLDRNTIDFI"
FT   gene            <215364..>218003
FT                   /locus_tag="Eint_091940"
FT   mRNA            <215364..>218003
FT                   /locus_tag="Eint_091940"
FT                   /product="putative transcriptional activator"
FT   CDS_pept        215364..218003
FT                   /codon_start=1
FT                   /gene_family="HOG000048482" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091940"
FT                   /product="putative transcriptional activator"
FT                   /note="similar to ECU09_1890"
FT                   /db_xref="GOA:E0S985"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR020838"
FT                   /db_xref="UniProtKB/TrEMBL:E0S985"
FT                   /protein_id="ADM12320.1"
FT                   /translation="MRKTDLEDIRRVYEKYGEVLDVDKIKNGAKHIFKYVMDIPGSLLD
FT                   YPKVRHLRFLAKEKISQIVSEIRSQHNEGDIDSKRTLEWISAIKNIRKVHSAIVGYESA
FT                   RIAYWRKISVICARELKRGLSKTSRTNPILKSKKIYKELFGHIKKTERSMKDKSKRAEK
FT                   EEMERKKKEMEEKEELRQKRKFEYLLSQTELFSHFILKKSKCDVSNTEGEGTEEYNSMK
FT                   GYKAAMLQKEKVKEFEMGKQGKKFKSGEEVGEVASRYVSQPSILKCVLKEYQLKGLNWL
FT                   VSLYDKGINGILADDMGLGKTVQSISLLAYLYETEEIPGPFLVVTISSTLDNWAQEFSR
FT                   FLPSFKVCRFSGSPSERKELKKQFKNSDVVITTYQTAVSDEKMLKKIKWQYMILDEAQA
FT                   IKSSMSRRWKTLLSFKARNRLLLTGTPIQNSMQELWALLHFIMPTLFDSLSEFSDWFSK
FT                   EIETSATMKKTVDEKSLQRLHTILKPFMLRRHKSDVIHELGQKTQIDLYCNLSYRQRVL
FT                   YKEITKSCSSMEMENLLMQLKKVCNHPDLFKKLEPTCGLSLEISDGVGDTISFGRSKLD
FT                   IKIPSLIAKDALEVFHRREQELIERINALEKIAYGRGFWGWYLENSLDFKYKGRIFRSV
FT                   KEVGKSILRNFENLDSNKLLESLKRLMNEEMYCLKRYACCISPVVATVPRLISNEVELP
FT                   GIYLEDVHIPLNTTIHVPPLNTFISDSGKMIILDELLPRLKAEGHRLLIYFQMTRMIDL
FT                   IEDYLVKKGYTYLRLDGSLKASARADVIRDWQTNDKFIFLLSTRAGGLGINLTAADTVI
FT                   FYDSDWNPTADQQAMDRAHRLGQTRDVTVYRLITRGTVEEKVLESANRKDEIQKMVIHG
FT                   NIFEGENF"
FT   gene            <218270..>219385
FT                   /locus_tag="Eint_091950"
FT   mRNA            <218270..>219385
FT                   /locus_tag="Eint_091950"
FT                   /product="hypothetical protein"
FT   CDS_pept        218270..219385
FT                   /codon_start=1
FT                   /gene_family="HOG000149557" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091950"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1900"
FT                   /db_xref="UniProtKB/TrEMBL:E0S986"
FT                   /protein_id="ADM12321.1"
FT                   /translation="MCNRKHCNTSCTSRVLEEFEFWAYFLSEKEPNRREVRKKIHTMSK
FT                   DLRFSIWIKCVGSREKFIRMKEIGLSNTKEARDVESKEDGNRKLDDKGLVKFILDMCRD
FT                   AEGNNQEAIFNILKNLERDFSSISNKKLLALTIMHILELPYASPQTTYRFIHSLMESHN
FT                   FCSVFSGFNESELDNGMDQDDENSVHSAFWKFIISENALVFDRIIDLLVCYEGANIASV
FT                   PTFLKKQTGDNDVQKWVEFISVRSNLDKLGSVFDSERLEGPTEVEDREETYFDFLVIQN
FT                   ETIKAQEMMKIETNEKLNSLKEERDELYAQKVNLMEACSSLESDLKEYQKEYVKKVEEM
FT                   LHSVEDKCEKYEKENMELKAKVDEKEQVKDL"
FT   gene            <219454..>222498
FT                   /locus_tag="Eint_091960"
FT   mRNA            <219454..>222498
FT                   /locus_tag="Eint_091960"
FT                   /product="chromosome segregation protein"
FT   CDS_pept        219454..222498
FT                   /codon_start=1
FT                   /gene_family="HOG000149158" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091960"
FT                   /product="chromosome segregation protein"
FT                   /note="similar to ECU09_1910"
FT                   /db_xref="GOA:E0S987"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniProtKB/TrEMBL:E0S987"
FT                   /protein_id="ADM12322.1"
FT                   /translation="MHIKQIRLKNFKSFKDETLVEFTENVNIIVGRNGSGKSSIVSAIR
FT                   FVLCGEKYNCESRMELIHEGSRASEEEASVEIVFDSGSPESLGKGFSIKRVVDAKKDEY
FT                   MLDNKTISRDELGGLLQGHGFATSSPYFIVLQEEISELAVLSDRRRYELIKDVAGVSEY
FT                   EKDRENSMQTLEETKQSENKIELLLERIEEKLRGFENDKKEAELCLELEKEKRRLEYGY
FT                   IEREVGEINEEICKIENLGSNNLEESSEENEDYGCEIREVESKLERLGRRRKELHVDEK
FT                   YKDKESEIENEIKNIEKKRNDLLGSLEIEKKTLKSLKRNEMETFVRSGYIKYLIVFLET
FT                   LGNREVSSEEIEISKRALKEKIEKLKDFNNLDHSGKFEEKRNIEELIERRKHLWREERR
FT                   LKLSEESIGGIVKSQEGRLIAMGNIGLDVYKQIKNEKGVLGYVYDLISIPNELANAFEA
FT                   VVGNALFNIVVESEDVASNVLKKMKDLRFRVTFMPLNRIEYKEENEIEDSNVISLTSQL
FT                   KCNQQYKPLLRYITKNFYLCPDLKQALHLSKKYGINVVTLSGEVVAREGTITGGYERRN
FT                   MVFQEYKRICKESRKIKGEMIKVQHELGKINKEIEEVKMHKECGSDESRYYESLKSSVL
FT                   FLQEKIKILEEVVKEKLDGNGINGKLRKLREEEKDLKLKGIWIGGEIKKVGMRIEEAEI
FT                   GVRNLNEGVGRLREELSKSSMYREAKEIEKEILELKDKKRAVKEMMFNEENMGLFAKPK
FT                   KINVEVENLVRRKHMLINKRNELCERIGISDFRNLERLFPDKKKEDIMNEIVRINERIR
FT                   GLSVVNRVAVSQWESYIEQKNSIRKRLEELKDDKRHISEFIAELDSRKEGAMGKAMSVV
FT                   EEGFSEFYSRLTEGGKAELYSYESSIGIKVGKDVGTSLLSGGQKAVVALSLIFSMQRVN
FT                   PSPLYVFDEIDANLDAQSRQKVSMLIKEMSERNGSQFIITTFRKELLNCGDKYLNVEFR
FT                   EKRSNIKDIDAGVAHKFLDEDLGER"
FT   gene            <222556..>222861
FT                   /locus_tag="Eint_091970"
FT   mRNA            <222556..>222861
FT                   /locus_tag="Eint_091970"
FT                   /product="hypothetical protein"
FT   CDS_pept        222556..222861
FT                   /codon_start=1
FT                   /gene_family="HOG000149556" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091970"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S988"
FT                   /protein_id="ADM12323.1"
FT                   /translation="MGENKDFISPLDLAKRLRSNVYDPVKTLLSIQCLSRPLSVDRSQV
FT                   RAIRRLSKFLFSLSLDKEVLVSLAFNPEAVDTFMDFGKIVMHREYNKIYYCIDIKP"
FT   gene            <222933..>224252
FT                   /locus_tag="Eint_091980"
FT   mRNA            <222933..>224252
FT                   /locus_tag="Eint_091980"
FT                   /product="hypothetical protein"
FT   CDS_pept        222933..224252
FT                   /codon_start=1
FT                   /gene_family="HOG000149555" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091980"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1930"
FT                   /db_xref="UniProtKB/TrEMBL:E0S989"
FT                   /protein_id="ADM12324.1"
FT                   /translation="MLKELIDEDDFCRKLRTSKEEDSKTGFYRLFYVLLDDPSLQVLES
FT                   LLSNYTLQDVVNGLKHLIKFKFDRLTKEVYANILLVVRMMLDYEENIDTLIINLLRHHL
FT                   VEEVYSMYKDKPKYFNNHPNCLSFLAFFCAQSSTRRDAFEANLSTRDFLFMTIKEMMSG
FT                   SHFEDQKKKKIKKESIHGSSEYPIFPFTSYFSSKKLLPALFMPTSLNILSSQLSVDLEM
FT                   NIMFILEHDQNFDFHLELLFKNHIRNLDDACRVLRFVVNIPYPQNIGRLVNSLLDKYPS
FT                   SYIAVIYDMLFWNQKERLNGNLVEYLKGNSNKIAEKITSLQEEWKPLKLAMESIKKRQE
FT                   CTVESITKMIHGLNFQKYFGLVKEMEKWGTPIVPKEMYDRIILESSEWDGYAQVYLWKI
FT                   IGFQKIYLGLDVDTPKRIESLEGIEGFEIIKSLSNIKKRT"
FT   gene            complement(<224267..>224908)
FT                   /locus_tag="Eint_091990"
FT   mRNA            complement(<224267..>224908)
FT                   /locus_tag="Eint_091990"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(224267..224908)
FT                   /codon_start=1
FT                   /gene_family="HOG000149554" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_091990"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1940"
FT                   /db_xref="UniProtKB/TrEMBL:E0S990"
FT                   /protein_id="ADM12325.1"
FT                   /translation="MIISWTDAFKVLRNIKMEERLFQKKLIFEYLSKQPKSTSCSLCSR
FT                   RMPIKDIVCRACFCRLHPFPADFKISIAVEYAKIFQIIRAKSLGKSKLLSKNEDECLKL
FT                   LGISSRCPLQDLIGKILTLEPTGLSHEEILILNSIKLKIRASTVNEWTVVRIKSMMDLI
FT                   DEQLNAINLRYLICLRHLRIDDALSLKKHIIEIKKHKDDLDTILKRKSIL"
FT   gene            complement(<225015..>225554)
FT                   /locus_tag="Eint_092000"
FT   mRNA            complement(<225015..>225554)
FT                   /locus_tag="Eint_092000"
FT                   /product="putative membrane traffic regulatory protein"
FT   CDS_pept        complement(225015..225554)
FT                   /codon_start=1
FT                   /gene_family="HOG000149553" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_092000"
FT                   /product="putative membrane traffic regulatory protein"
FT                   /note="similar to ECU09_1950"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniProtKB/TrEMBL:E0S991"
FT                   /protein_id="ADM12326.1"
FT                   /translation="MDCLRKQAEKIPILDAFEKRMNIRKEYALLGISFLCLVIIMTTSL
FT                   GPLVTSTIGIIVPLQETLVILRQVNPKKEEGKHMLVFWMVFGILTSLDAYSTTVISLIP
FT                   LWYTIKFFFLLWAGPLRFHGGIIIYDNILARIPESWYREECGIENAVRKATDAVKTVAE
FT                   SELSKKDVIESNKKTD"
FT   gene            <225643..>226092
FT                   /locus_tag="Eint_092010"
FT   mRNA            <225643..>226092
FT                   /locus_tag="Eint_092010"
FT                   /product="deoxycytidylate deaminase"
FT   CDS_pept        225643..226092
FT                   /codon_start=1
FT                   /gene_family="HOG000085051" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_092010"
FT                   /product="deoxycytidylate deaminase"
FT                   /note="similar to ECU09_1960"
FT                   /db_xref="GOA:E0S992"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E0S992"
FT                   /protein_id="ADM12327.1"
FT                   /translation="MALSSSRHSFFMDMALDQAEKAFDQLEVPVGCVVVRDGIVVSKSH
FT                   NMTNANKSPLDHAEVISIRSTDCSNSTFYVTCEPCIMCMGILGRLKGVRVYYGCKNEIF
FT                   GSETICGVGIESTYLPDDRCFKILQKFYSRENAFAPDEKRKLKNR"
FT   gene            complement(<226117..>229215)
FT                   /locus_tag="Eint_092020"
FT   mRNA            complement(<226117..>229215)
FT                   /locus_tag="Eint_092020"
FT                   /product="myosin heavy chain"
FT   CDS_pept        complement(226117..229215)
FT                   /codon_start=1
FT                   /gene_family="HOG000149157" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_092020"
FT                   /product="myosin heavy chain"
FT                   /note="similar to ECU09_1970"
FT                   /db_xref="GOA:E0S993"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="UniProtKB/TrEMBL:E0S993"
FT                   /protein_id="ADM12328.1"
FT                   /translation="MQSPADYAYSYPHIYGVAESAYQDLFIHGNQTIVISGESGSGKTE
FT                   NAKLIIKYLIERTASSASIERNIAAANAILEAFGNAQTILNDNSSRFGKRIKVMFNGKI
FT                   TGAKFETYLLEKSRVTHHEIGEKNFHIFYQFCASKGLNLKNDFIDTSSLVGNKEYSMRL
FT                   SKEYAATRSAMESVGVACINKIEDCLLGILYLGSIQFGGDGILKVVRNECFKEFCKLHD
FT                   IQEDAFEESLVKFSIQVKGETIEVFNTLKQAVTIRNSMARLLYSNIFNYITSSINNCLS
FT                   GNGELFISVLDIFGFEIFEKNGLDQLCINWTNEKIQNDFIRKVFRGKQEMYKKEGIEWR
FT                   DVEFFDNNQCILDFEKPCGLMDLISEESFNAWGNVQNLSMKIKNYLKGNIRTKADDKIV
FT                   VSHYAGDVEYDLRSFLDKNRERGNLKIFENPLIIHEENKEDLVKYFKDSMNNLLHSINE
FT                   TQTKYIKCIRPNAQKKPKLFDRPLIAKQLAECGVLETIRISKQCFPQEIQKNEFETRYE
FT                   VLGSTTFEMVTVKKGKSRYFMSNESLRILEIRRSLFYEECFRNIKNALRSYLNNHNCDK
FT                   KQRIMFVNEPVVAESSVSIESNSVELMIDKGYNTTDPCNAQEDNRKQRSYKEIIRDLEL
FT                   KIEKYKKFCEAPCRNCKSLELKYRFQSEALKKKNMIELELEKYKAKVEDLEKRLSEKEE
FT                   DDDSHMSVSFTNAYNVFNCLVQLYLEFVPTFSNEEVPKPEILGLAHSAFYAVNKLGKNI
FT                   VESTACMMNEINLQLHMFERNIHKVSFILSNLIEYENILRGYGVNNVEEVKSLISILFK
FT                   HLCELQRSFLLEVLPHAVLEHQQLSKFKCSEGYFKKLFKPPHISKLIHLLEYFYHQMSY
FT                   YYIPDPYIMESINYLLKTINISVFNEILVKKNFLSFNRGVQINYNINEIDKFCRSINYL
FT                   EGMFNLSHTTAIIRLINLVESRATADLILDECSILNCLQINEIVSKLDAEASYFFGNDN
FT                   RNDKFISDPTVTLPSYTGVSSHAFICPRYLPSESLLSILKSIR"
FT   gene            complement(<229552..>230145)
FT                   /locus_tag="Eint_092030"
FT   mRNA            complement(<229552..>230145)
FT                   /locus_tag="Eint_092030"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(229552..230145)
FT                   /codon_start=1
FT                   /gene_family="HOG000149552" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_092030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1980"
FT                   /db_xref="UniProtKB/TrEMBL:E0S994"
FT                   /protein_id="ADM12329.1"
FT                   /translation="MNSENNSSILATIQGRYKFRSKTLDYSTSFYPDRFTILYKDRKVG
FT                   EVSYENILRVEKNREGLKFGLRNGVWIKIPCASDDKRKIFRIFKAKKLGGIMSQNDIMG
FT                   LALVEFADLKFLVPLASMCFSDFKKSVIKKIGSHFLPSQSLDFVSLDHYNEFSLFIKDK
FT                   DSLVIFENDDDLLCSLLYFEKKLDVVVKHVPRTS"
FT   gene            <230310..>231065
FT                   /locus_tag="Eint_092040"
FT   mRNA            <230310..>231065
FT                   /locus_tag="Eint_092040"
FT                   /product="hypothetical protein"
FT   CDS_pept        230310..231065
FT                   /codon_start=1
FT                   /gene_family="HOG000149551" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_092040"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_1990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S995"
FT                   /protein_id="ADM12330.1"
FT                   /translation="MIDKIRSFLPSPRSLEPLEPLKKRVKRKERPSKCILSRSIYEETD
FT                   LSRLTPRQRLLHQKYQENKNNVSSFFLLSNNIPIERHIDIKPKKLNEEAPSKSTDKSIE
FT                   LDCEANWKVRDGNSLQEEKNFLILTSDLYNSSYKDIEEEQSSSESNDEVIEAAEIESPF
FT                   RSRIPENASDKDHHICKDCFKDAVEIYYILERISDVHKCRLKNFILLHKYKIRQNFKKK
FT                   LCFSTIRREETAFIKTLEKVECCMEKPRF"
FT   gene            complement(<231104..>232018)
FT                   /locus_tag="Eint_092050"
FT   mRNA            complement(<231104..>232018)
FT                   /locus_tag="Eint_092050"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(231104..232018)
FT                   /codon_start=1
FT                   /gene_family="HOG000149549" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_092050"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU09_2000"
FT                   /db_xref="UniProtKB/TrEMBL:E0S996"
FT                   /protein_id="ADM12331.1"
FT                   /translation="MPSYNIFRGKLRSLGSIFALSSIFLSGIYICIVTYLSTKLEIDKA
FT                   NIELVGWLDANYPVRYKDFKADLVYLLNISLIGSRILRMSSVFLLIGLWGPCAYSVFNG
FT                   GDRPFDIFKSSSTGTRTFVAKSMFNTSVVTFSKIYAILRAPALLYYYYSRSRLMGEKTA
FT                   VFIESFLLGNEVYLSVALLLILRTKHSFLSEYKSLDSTNLLSFCLMFHGFLTYTINTVA
FT                   IPFEMTDLHHQIQQSLSLGARLILDMLLISMFCPIRDQLFDNSSDRYEKNFEITRITRL
FT                   EDEGPIVQEIESVIEFEEKEIGK"
FT   gene            complement(<232627..>233388)
FT                   /locus_tag="Eint_092060"
FT   mRNA            complement(<232627..>233388)
FT                   /locus_tag="Eint_092060"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(232627..233388)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_092060"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU11_0090"
FT                   /db_xref="InterPro:IPR019081"
FT                   /db_xref="UniProtKB/TrEMBL:E0S997"
FT                   /protein_id="ADM12332.1"
FT                   /translation="MSSIFITELASTPMYTYHENSKRESYWSPDLYSHLGTSISILIPL
FT                   LMFLIFGENTLKDNSFIRFLFFAIPLLQLTFLNFCLFSTINNSNTMSIFHSILHSVLKF
FT                   LLILFSILPFLLIFMFPLLKPENIKVLSSSSLFLLSITYFFFTSLSPIPSTIQFSGSAI
FT                   DALAGFSLLLIFFLKRNHLLLFHLFLFLFTLFKFLRFKYSPPKNIETTPWRQILFVLIF
FT                   TVLTVVYLFISLLFFLFITKNLFSLAVKKIL"
XX
SQ   Sequence 233397 BP; 69636 A; 46863 C; 48017 G; 68781 T; 100 other;
     ctgcattttg gttagctttc ttttctttcc tctccttctc ttctttttct ttcctttttt        60
     ccttcctttt ctctttttct tctctcctct ttctttcttc aacctccaga acagccctat       120
     ttatttcatt cttataatca cttttatatt ctaagaatgt ttccttcatt aactctccta       180
     cagcttcccc tccatgttct ctatcgatct ttatcaaaag atcatgatcc agataaccaa       240
     ttgatgaaat ctgattattt gcataatcag ataatggttc tttgatttcc atttttattt       300
     ctttaacgta taactttttc agacgcattt tcataataaa attttctcta tattcttctc       360
     tttcccagag actcaagcac ctatcatatg ccatattcag cacttcaaat atttgtttct       420
     cttccctctt gttacaaata agttctccat gcttcttgat ctctttgaat tcttcttttt       480
     tcttcttatt ttcttctgaa tcaggattag gtaggtcctt taacttccta atctcttctg       540
     aagctttgga cacaaaaagc tttccaagtt cctcaagtgt tcccttacac ccttcgagta       600
     ttttttttgc tagatctcca aatgtcatct tgtcctcctc atacttttta gaaagagaat       660
     caaagtgctt atatagacca cttttttgaa ggacttcatc tgataacatc atagtcgatt       720
     ctctacaaaa gggaacgttc aaaaacccca tacaccacaa tgttaatctt ggtaatccct       780
     caatgatttt ctttacatgt tctctctttc cttcttctat ctcactgtat tttgttgtag       840
     ggaatactaa aaatgaatta tcatgaatag caaatggata taatatcact ttccgatagt       900
     tgagtatctt aggagaattt tcgaatactt ctctccctgc ttttctttct gcatcattca       960
     tcttccgtcc aatccttctt tctatatctt ctatccctat ctccaaggag ctccatacta      1020
     catttatcag accaagtaac tctactacat atatccaaat catctgaaag ggatttccaa      1080
     tctaaactta tatactagag tccctttctt atcttcatta aggattcatc attaataaaa      1140
     atatcgattt tgataagttc ctgacttcat tcttctccaa atcaagaata tcctttgata      1200
     gttagaaaca acctaattgc aactatcatc catctacgga gtaacaataa taacaacaaa      1260
     ctctttatct agtacactaa actcttatac tcaaccgcgt aagcataaat catacttctt      1320
     tattccaatc tatagctata ggaggacccc tccactatat ttatcttctt taacactttc      1380
     tatgtatttg tagaatcttt atgaggaatc tgaagtcctt gttcattctt tccactgaga      1440
     atcgcactcc ttgagaatat acaagctcct cctttgcagc tgactctttt ggaagatctt      1500
     ctcctagagg atcttacttc ttctttgttt agtctttcct tgatctttta ttacatcctc      1560
     acggcgcccg tggattcata tctcgtaagg atgtttctag taaccgactc agtagcctta      1620
     gacatcttat tactaattaa aatccttaac agcttcctat ctcccctctt agcttctcat      1680
     aaatttttct ttcatacctt aaactatcca ttttaatgat ttccgaacct atctccctta      1740
     ttataaattt ttatttcaat cacttttatc caactagcct tactttttta aattcttctc      1800
     gtatgaatat agcctctatt tccactatcc cagaaacaac tatttgtaaa agaaggtgca      1860
     gatagcttgt ttttgctttc ttgttatttc aaagtaagca tggaaaatat ctgcaaacat      1920
     tttgaatctc cgttaatttc atattcttta taaaatttga tatttaatgg atttctttac      1980
     ctgttaattg tttttatttg ggatgtactt tgcacaaatt gcctcttatt agccgacctt      2040
     aatccaaaga tatattaaaa aataaattca attatggaat agtaagtaac tgaaggaaga      2100
     caaggatcaa gaaataaaaa gaaaatttcg tattttaaag ttttagttag ttttcttcct      2160
     cttgtgagag ttttaccttg ttcccaagaa tattttttag ctctttccat ccaacattat      2220
     caccactact ttcctctctt aaacggttat ttcctctcaa atctagcaga actaaacttt      2280
     tgctatctgc aagtatttcg attaacttcc tgggaatctt tcttagtctt ttgtttttag      2340
     tgaaaataat tttctctaag ttctctaaat atccaagtat tagaggcaac gtattaaata      2400
     aatttccttc gagattgagt attcttagat tgtctagagc acctattccg aaaggtaatg      2460
     ctgcaagttc attgtttcca agatctaacc gaaccaggct atccatattg tgtatttctt      2520
     cgggtaacat tcttagctga ttatttcgga cacttaattc ctctagatgc tccagaagtg      2580
     taatttcctt aggaagataa aggaggttgt tgttgttgag gtttagtttt tctagtgaag      2640
     ccaagcctag tattgagtct gatatgtatt ttagttcgtt gttgctggca tcgaggactt      2700
     ttacaaacga aagtttttca aagtatggag gtaacctgtc tatgttgttt ctactaatat      2760
     cgagttctat aattttctct cctctcatta tactctcaaa tacctctcga ggtacgttcc      2820
     tctctctcct acctgaatag tttagacaaa catatttctc tcttcctctt agactgaaaa      2880
     ctgtgtctat tatccacatg gcacctataa cacctgtacc tagcctcatt tctctaaggg      2940
     cccaagctag ctctataatt gaatttcttt aaaatacatg ttatatgcca atatgagttt      3000
     aatatcatag ttcattatac ttgcctgttt ttaacttccc tgaataacat cttgacactt      3060
     ttagaatttt gacctatccg gccagtagta agccagcgta aataaaatta actgaataaa      3120
     gtcaatggct tggagttggg ccttagatat gtcccacaag tctcttgtct cagatggtat      3180
     ggtttcttcc cataatgaga ggagtaccaa tgcaattcca cttagaacaa agctccaaga      3240
     taccacaagt gcattacctg tttttgcatg gaacgcaatt gcagaggtta tcatgacaat      3300
     agctccaata gaaatgattt ttccaatact gctgcatctg tagacggggc gggggagaag      3360
     tcccagactc ttaaatctta tataactaac agaagagaat gttgcgaata ctttcagaat      3420
     attcacgtta gaattgtata aaccatatag aaatacttct cctatacatg taaacaatcc      3480
     tgtcatgcac aggacaataa atgtaagata tagaaaagac tcctttgctc cgtttgagga      3540
     aacgttcaca caccaatttc ttactatcca gtaaatcaac atgaatgccg tgaaagatga      3600
     actggatact gcagccacga attgaagtat agtgtttgtt cccgtcaatt tatctgacag      3660
     atgaattgcc gtaggaacca gcatggatgc taatccgagc gagtttgcta gtacactcat      3720
     tttattcttc ttgaaattca taatacccat tatttccaga acaaatttat tatttttaat      3780
     tggaaaatat agaaatgaac gtttatgaat atcactttaa ttgttgattt gatatcgaat      3840
     ttccattaat ggaaaattgg ttgttaataa aatgtagttt tccgctatta agaaacaaaa      3900
     gagtaaaatt atataagttc ccaaacccct attagtatgg aaaagacttc aacattaaat      3960
     ctagaatttc aactattcaa tctcatggca aaaagtcaat ccattgaagt gcttattgtg      4020
     tttggagtaa tttttggaaa tatggtgttc aataacatga aaatggaaag cttatctttc      4080
     catctttttg gagtggttac agttgtactt ctcactgcct acttactggc aattatagga      4140
     tccaccgagt tttctgaaaa cgacgataat accatcttta aatctatggc tatatgctcg      4200
     atggtagtta cttcgatcat tgccgtaatt caatcagttt gttctttaat ggatcttcgg      4260
     aaggatagag caaaactttt ttactcggaa aggggagaaa ggttaataat aggaggatac      4320
     gctgctatca tttcaatatt atttctgctg attcagatat caaagatggt gagtatgaaa      4380
     aaaattaaga aaagtgtctt tgtaagtgtc tgcatcatga tggtagcatc tgtgttctat      4440
     ttcctcctct ctgaggaaat cgatcaagaa caaatcttgt ctttgattat aggtcttgct      4500
     ttgatagttg gaataattgt gctgataaat attggaggat caaaagaaat agatatgaaa      4560
     gagaaaggta ctctacctta tgtgatgtct tctataatcg ttttctttat tacttctgca      4620
     ctaggtgcaa aagtggtggg agacaaagtt aagctagtgg aaaaattagc ttcggtcttt      4680
     acagttattg ataaatgtat actgaccaaa aaataagata ttaaaaaaga catcttgcta      4740
     tctaaaatgc ttcaattgtt gaacaatttt caaggatttg agaggaaaga tggttttaat      4800
     ccctatggga gaagagtttg atgtctttct gattggtgtt tctcctaaac cccatatttt      4860
     ttaaaacata gggaacataa aacacaagaa aaagatatgc aatgcacaac ccatgtgcta      4920
     ggtagtttgg aatattcttc ggactgaaaa aatgcttgtt tataaataca agaaggttgg      4980
     accaaactaa tataaacagt aaatacttac ttgtgaagcg gtgcatcttg agttcttcaa      5040
     tcctaaaagc cttattaaat attccaaagg taattccctg tgtggtgtga agaaacatta      5100
     ttatcatagc aaaagaaagg ttatgtattc tgcggcaggg cacggaatat gtacgagtca      5160
     tcagaaatat ggtaaaaaaa agtaaattgt agaacatgat gatatttgtg ttctttcttt      5220
     tgaatatggc ttttgatatg tcgcttgcca tcaaaaacat ccccatttga ggcagaagga      5280
     atgtaattcc ttcaatattt gcagttatca agtttgatct agtggaattg tatattacct      5340
     cttctaatcc aaaaaacttc aagaagatct catggaatag acacatagca aatcccacta      5400
     agaagtttgc atatgtgtct ataaacaaag aggccaagtt taagattcca agcatgaaaa      5460
     agaaattcaa atggactcca aactctgcat ctttgacatc gagcttaagt atcactttgg      5520
     acaagtatct taaggctcca aaaaagaagg aagacaatat gttcttgatt ttcctttgct      5580
     tacttgcttt taccgaaaag aatcctgcat tgtacacgaa ggagcctaca cctatatcca      5640
     tgagcttgag tccataatcc atgcttttcc ctaactttct tccgtcgtag aaagaaaaat      5700
     cagatgcaaa tatagtaatg gcaacactgg taatgataag agagcgagtt ctgtctattg      5760
     caattgatgt gtttaggtct ttttcctgaa acactgagga ggagatttgt ttatactgag      5820
     atggagcata gcttttccat ggccatacag attttctctg tttccactct agaaacatcg      5880
     tgaataaaag gtatgcaata agcataaagg aaaatccggc ataaattagg cctgagtacc      5940
     caataaaaac aaccacaaag tataatggaa ttgcggaaaa gacaaattct aaaaatgcag      6000
     accttggcag cattaaataa tataccaata tggatagctg tgttatgctt gtggctgcaa      6060
     atagctcaac ttcactaaga gttttcgtca tgaagggcta tacttctaat aaaacaaata      6120
     aaagagtgaa gtatttatgg aatggaataa taaatagaaa ataccaaatt tattttctaa      6180
     cctgttcagg aggtctgtaa ggtcttctgt cagttcatca gagaaatgct tcttcaagac      6240
     attgatggac tcctttgtaa gcacagagta tagaatgtcg ctttgctcaa aatgccttcc      6300
     aaacatccga ggtggtatat tgggcttggc ctcgatcttt atggccacct tcaagccttt      6360
     aggtgcctct tggacagctt ctttattgtt ctcgatagag gtcactatgc caagtttaac      6420
     tgtctcgctt tccttgaaca cacagagagg tgtccctatt ttcagaatcc cctccttgac      6480
     atggactcct attaccaacg ggctcctgga gttgaaaatg cattttggga caattgacag      6540
     ttccaccgga aatattgcct gttccatgtg gattttcttg tccttctctt tttcctcatt      6600
     tacaaacctc aggtatgagt ctaggagatg atagataatt ttggcctcaa atatccttac      6660
     gcccatcgaa gaggccatgt ccttcatttc cttgtccaac actacatcaa agcaaaggat      6720
     tgctgcatat tttttttgtt tttttaccat cgaggccaca attatcatgt ctttcttctt      6780
     tactgtcccg atacttacgc cggatatcag tacattagag gcctttagaa atgaaaccag      6840
     ggcctccaga gacccaaggg tgcttgatac aacatggact ccttcctggt gaagttctat      6900
     agacgaaaaa accgactcta agtctgctgc aagagtgttt ttcacttcct cttcgttatt      6960
     ttttatgaca aggacacggc ttccagctat tgccttttca aggccacctg ctgcaatctt      7020
     gattccaaga ctggccctta cttcttttac cataacatac tggtttttga cccttaactc      7080
     tttcaatggt tgaggcataa gtaaggcctt gatagtcgta acaataggct catggaatcc      7140
     acagactcca attttgtctc cttctttcag aaccccgttg cttaggatgg catcaagggt      7200
     tactccaaaa ccttcgacgc tctttacttc gagaacagta cattcaacct catctttgat      7260
     cttcatcttt gatcccatat atttctcgga cagctccaat atcagagata ccaagtcagg      7320
     aattccctct ccagatactg cagatgtagg aaccaaagat acaaatctct tttggtttgt      7380
     attttcgtaa aacaacttca cattcaaacc tatttctgca aacgctagga ctgtgttgtt      7440
     tactcttctc ttaaagtcgt ctatcgttgg ttttgattgt ttcttaagcg tggtcttaat      7500
     ttctccaaat gaggtagatt tccatccata gagtctatct actttgttaa gagcaactac      7560
     aaatggtgtt ttccgttttt taagaagctc tatactttcc aaagtttgag cttcaagtcc      7620
     atggactatg tccaccacaa gtattgcaag attgcagaga gaagatcctc gtgtccttag      7680
     gttggcaaaa gattcgtgcc ctggggtgtc gatgaccaag attccgggaa gctttgattc      7740
     cttccttcca cacttcttga acagctcgga taccggaaag aatgtggcac ctatctgctg      7800
     tgttattcct cctgcctctt ctccttgaac atttgactct cttaatttgt caagaagttt      7860
     tgtttttccc gtgtcgacat gtcctaagat gcagcagatt ggacttttaa actcggaatt      7920
     ttcaccatta gttgtgtttg cttctacagt ttctttggca ctcttcaagt ttctttcgtt      7980
     ttctccattc attttcattt tttccaaaga tttgtctatt tcctccaaat cctctttgtc      8040
     tttacatcct tccttactct ttttgtctgt tggtccaagt aatgtattca gataatcatc      8100
     gtcttttctg ttcttcttac ccattgggag tattcgcctc tctccttaag aaattatttt      8160
     ctttggaaat actaagcaca cctaggcttc ttaccgctcg agacattgga accaatcgac      8220
     gttctggttt cagaaccaga aacctgtata agactctcca ggaggagaag gaagatgaat      8280
     caagacatga tcagtaagat ggtacctttt ctttcgaaga aatcgatcct gatgctttat      8340
     ggtataacta gggatccgaa atatcctgtt tacatcatca ggagatataa agccaggcta      8400
     aacataattc ccacgggaaa ggctgccatg ctaatacaaa gggcagtaga catggaaagg      8460
     aatgacttgg taatggaata tctatgccat gttccaccgg gaagaatgac cagaatctta      8520
     ctaaagttgg cagaaaatat agaacccgaa aagacacagc atatgatttc ggatttaaaa      8580
     aaaagtaact tctgcttgat gtgcagttct aataacagat gcgaggtaat tgtagcccgt      8640
     atcgagaaca ttgtaaaaaa cataaggtca tatgcctacc actgtaaata ataagtattt      8700
     aataaatttc ttaaatagat tttgttctgc caatgcgatg aagttacaaa ctgcctgatg      8760
     gccctactca tgaatgaagc tatttttctg gatgcctgag tctaatctta caggtgtttg      8820
     gaatcctgat aaccgaacca acagaactag tatccattgg agagtcttgg gtgccccatt      8880
     tccttgtctt tttcaaatca tcgacgcctt ttctattagg agtctttctg tagaagctct      8940
     tttttgttgg atctgcctca ggttttggat tggaaggtat gtgttcctta cgttccagaa      9000
     atcccccgag aatctttttc gttcttgaaa agggaattct aataagatat tctgcttgta      9060
     aaagttttct tttaagcgta tctatgctgt tcaaccttag ggtcactcgc ttgtccccca      9120
     taaactctct acccagtcga ttgattgttt tacgtaagtc gtttggaaga gttcgctcat      9180
     agattctaac cacggccttg tggtattcat cacgtgttaa ctccatatct tctatgagat      9240
     aaatcagatt ggcaatcttt tctttaacaa ttgcgttccc ttggttgagt ctcagtaact      9300
     taaatatttc ttttcttttt ccttttagaa cctttttgaa gttgaatttt ggagacgatc      9360
     caagagctgt catgacatca aaggctacgc acttgatagt gaacgttcct tggagcagca      9420
     tttcaaagat cgaattaacc acttcttcgt cttcataaaa tagagaaagt aaaacttcaa      9480
     gcgctgcaac tctcacactg cagaagttgg gatgtttcga aagctggatc aaggcatttt      9540
     tcttcaagct catcattcca aacaaagaga gccgtcctaa ggcatatatg caagatttag      9600
     ttaccagatt tctatgtgat ggaaagacca tgtccaggat cctaaacctt tcgatctcag      9660
     aaaccgaaag ctgaagataa tcagggtttt ccgaggactc tgtccttata ctctgcccac      9720
     ccttgtaaac actcgaaaga tcaccatctt gcctttttcc ttcttcttta tctatcgaaa      9780
     ggtaaggtga tttcctattc tcatatcttt cattcatgtc gaatgaattc atgttacctt      9840
     tgtcacttcc tgcagaaaga tcgtctaaag acaatccccc atgcttctca aaatccttgc      9900
     tgctatttcc ttctgcccta aacagatcgt tgatgtcatc ctctgttttt cccggcctgt      9960
     ggagagtgtg ctctttattt ttggacttca tgtgctcccc agagtagaat tccggaaagc     10020
     tcattgaaga aagaggaaag ctcagacttt caatcacaga agatatgtac catccatcgc     10080
     tataggagtt gaacgagttg tcattaaact tgagtatgtt gataataaat gcagaaatta     10140
     tgcttgctga tcccacttct cttcctgaat agtttctgaa aataaacgga tctgcaagcg     10200
     acagtgccct cacaaggtgt ttctgtatga agtatggaat aaatgaaaag tcgtttggtt     10260
     tgactatcgt ggatgtttga acacaatact tctttacaaa atactgaata agcctttgga     10320
     atccatagta gcttccaatt gttgttctgg agagaatgta aagtatatga actcttatct     10380
     tgtaaaatat gtgtgtgttt tcaagcattc tttcaagtat ctcacaaact tgaacagacg     10440
     gctttatcga gagattctcg agagcctcca tctgcccgac tacattcttg tctagtagct     10500
     gttcaatgaa catgtagtct ggctgctcta taacgatcct tgccagatgc tctcctttta     10560
     tgtctgctct tatccacagc agaggcatta cctcctcttc ttcctcagac ttctttttct     10620
     tcttagtttt tgggtggtag taaaaatgat tctctctgtc cagcataaac acatgttcaa     10680
     atattccttc catctcatag ctacagatag ttacaggccc acatattgtc ttattcccat     10740
     ttgaaaagat acttgttggg gtttgctctg ccgtgaagtc cactctattg cttttcttgt     10800
     ttatcgtaaa tccaagcctt actttcacca ctccaggctt aaatacataa gtttcaaaaa     10860
     gaaaccgaag atcttttcca gtaacatcct ttacaagctt aacaaactca aagctataat     10920
     cctctttgac gtcccccttc ctctttatag tgtagttcaa aatcttttcc ataaatgccc     10980
     tgctgaggtt tccttccaga agatggaaga agaccttggc tttggtttta aagaatttgt     11040
     ctctcattga aaaaaacgtc ctccgtggat catacaatgc atattctgca acatctctat     11100
     ctagtacgta gtccctgtcc ttcttgagtt cgtatagaaa ctcgttattt cccagaaaat     11160
     gcctagcaca atagtcttgg aagtatccct tcatcccttc agcaatccag aagtctatct     11220
     tttccactat ggaaaaatag aaatagaata tctgggagct tagtatatca catacaatcc     11280
     tttttagaag aaacataggc tcaatatcgt tcaaggatgt gagattggat agagccagaa     11340
     atgcagtatt ctgcccatac accttgtctg catctccaaa cacaaaggca atcgaaagag     11400
     ctttgaaagg atattctctt tggagaaaat attcggaata cctgatcaaa ttttcaacgt     11460
     cgcagcagaa ctctcttata caatccttgt atccttcgga tcctttcgga atgcatacgg     11520
     cctttctatc atctcctgtg gaaatctcat agctatcaaa agttcctatg caaaagttca     11580
     atgccccact atgggccatc tccactgaat aagagtacag gatcacattt tcttcctctc     11640
     ttatactctt gaggatccct ggcgatatga tttttacttc ctcactgctt ggtagaatgt     11700
     agactagttc ccatttgttc ttgtaaggtg ttgaaagaga tggaaatatt gaagaagaat     11760
     caaacattct gttgcatgct accacttctc tatgcctatc ctccggagaa ataggtctgt     11820
     agaattccac cgagtcgttg ttttctccaa tctcgtacaa gatccggact gtaaatgtat     11880
     tttccctaac ttcctctggc acacgaacct caaatgtacc atctacattt atatttttcc     11940
     acatatttct actaaaagat ctctcacact cgtcaatagc atctgttgca tctttaatcg     12000
     tatagttcac tgtcttcagc ttactagatg caataatgtc gacacttaaa acggctaaat     12060
     cttttgattt gtacacaagc acatcttccc cagcctctct ttgaattgtt gtctcggaaa     12120
     atcctctgta cacacacttc cccaggtcta gaaagtacac attcctctgc tggatcacct     12180
     tcattttcag ggcaaatttt tgttatacaa cttgaaatag tgtctcgaag accccttggc     12240
     tgtatatttc aacgatgaaa aagataaagg ttgattgcgg aagctttgct aattcaaaag     12300
     tagtagaaca actttgggag atgatcagta gggaggacat atctttgcat caaaagtcct     12360
     ctatctttct tgaaatgacg gagtacaaaa aaatgaatga aaagcttgtc aagagaaaca     12420
     acgagctaat tgaagagaac gcatccatgg tatctattct ggaggcgcag aaggaaaatc     12480
     caaataacgc ttcatccttg ggagaagaag ccaaattcga tgctggctta aaaatttcag     12540
     agctgaacta tgaaataaga aggctggatt ccgttatttg cgaaatgcag aaaagaatag     12600
     ctagagactt gcttcaaaaa gaaacaaagg atacaccgga gcttgagagg actgaggaga     12660
     aaaagcatgt tgttgctgac agcaccacgg ttaccaacga agtatacaag aaaattaccg     12720
     aggactacgg agatctcaaa gcgaaaatgg cagggctgga gagtaagcat aatgaagaac     12780
     tatgtgaaag agatcaaaaa atagctaaac ttcaaaggga actgaaagaa gtaatgtcga     12840
     atgccaaaga catgggagaa agattcacca tcttaaacac agaaagtggg aagtggaaag     12900
     aaggccttca aacgtttatc gggaaggagt tagtattaaa caatgaaata agtggatgtg     12960
     tgccaaggtt agaaaaaata gagaaggaca tggaggaaat tgcggcagga ttagatgttt     13020
     ggatgaagaa gatagagcag ttggatgctg aaaaaaaaga actctggaaa ataacggaaa     13080
     attataagag ttatgaaaga gtaaggaatg ggagtggtac ttgtgatcaa ggatctttgg     13140
     aggacgagat cattaatctg gttgagagtc tggacaaaag tctgggtgag aacaaagcat     13200
     tagttctaag gctcgaggca gcacacaaaa agaacagaga attagaaagc gaaatgattt     13260
     ccctaaagat ggcaagctct gacctgagaa gcaggaatgc aaaacttgaa tcagacataa     13320
     aacatcttgg aatggagaac agatatacaa cacaagggga cttgggagat catggtttga     13380
     agatccggaa actagagagt tctctagccg agtataacaa agtagctact gattacaaga     13440
     aaagattata tactttatcc aaagagaagg aagagaccga aaagatacta gaaagcatta     13500
     aaaaacaaaa tagagaaatg agggatgaga tgtcaaggat tgctaagaca aactcccaaa     13560
     tcgaagcaga gaacaaaagg ctaagcggag tgttgagagc aattcaaaac ggaggctctg     13620
     aagaagatac agatcttgct gtacagctgg agaggtacag aggccttctt cgctgtaccc     13680
     tttgtgacac acgcttcaag gatacagcaa taaccaaatg tatgcattgt ttctgtgaag     13740
     aatgcataaa ctccagaatc aggatgagag atcgaaaatg tccctcttgc aatgagccct     13800
     ttgcacctaa tgacgtaaag aaaatttatc tgtagaaaca atattccttt ttatgaaatc     13860
     cttcttcttt ttactgattg tctacacggc ttcggtgttt tctttgcatt tataaatctt     13920
     caatgaccgg aagaagttaa aataaacagg atcatatttt agaagaactc tagatatgga     13980
     aaatgctttc cataaaatat gttattaggc caaataaaaa tttcttagtt tattcactag     14040
     tttcatttta caactttgta cttcaaaaca tactcaatga ttggttctac caatcgccac     14100
     aatcgaagat tttgctagtc tcatgtcttc caacaatatt cggagtctct tgtaatgctt     14160
     tgtttttagt acaatgtctt cctcactcat cgagataata gtcccaacaa actcatctcc     14220
     atttatagtg gccttgattt tatctccttt ggtaaacatg gaacctttta cattgagtgt     14280
     attattttca acgaagacat caagatcttc tccctctaat attcttcgta ggtccttggc     14340
     tatctcgtct ccagtgatat agagtatttc gtctacatcc agcgttgtag acctccttct     14400
     tcttttggta ccttctacca tgttcttttg ctcttcggaa gaaataaaat ccagttcatc     14460
     ttccaaatca tagatcttcc ttatgaaatc tttgtacatt gcgccctgcc tcttcttttg     14520
     ctctatacgt ctccttaggc tgctatacag acttcctaca tctcctgatg gaaaagataa     14580
     acccattctc ttttgattag atcaaggggt ttgcatttaa ttaaaaatgg tatgaatgaa     14640
     tatattcata ttacatttta tttcttataa ccagaaagcc caaaaacctt taccttttat     14700
     cgagaatcct ctctaactct tccttggact tgtaacaatg gcctttaaaa aaagaagtta     14760
     tcttgttgaa aaacccttgg aagttaaact ccattttact tctcacaaat ctttcataat     14820
     agcaaaagtt aagcaacaac tggtttccgc ttgctccaaa cttgcggttt tctgagatga     14880
     aaattttaca gaactcagaa agcaattttc tgttgtaaat ggaaaacacc tcttttccaa     14940
     attcatcatc gaaattaaat gtttcttctg catctcttgt tatttgttta atccattttt     15000
     cgggtcttcc gataacctta cggtcgcttg tatagtcgtc atccaccaag tcgagtatca     15060
     aggctcttat ttggagtatc ttatggtcta gaacatcatt cattatatta tcggttcctt     15120
     ccccacctac agcacataaa tcgcttaaaa gatcaaactt agatcgtttg acctctcttt     15180
     catccagaag aatgcttttg gatttctcaa tgtagtactt aataagcatc tccttgtcct     15240
     caccttcaaa gtctcctatt atcttttcta ccttttccaa atagctactc atttatttgg     15300
     gattgaaatc acccatccta tttctcccca gtcttaagat ccttttctct ctcaaggctc     15360
     caaggctttg tgttttgctt acgaccctaa aagaaaaaca acatttcgag agactttcta     15420
     ggtgcttgag aatagatctg agattaaaaa caaaaatgtt accaccccca atgtcatgta     15480
     agtgaagata aatatcaaag ctaattttag acaaccttct gcatatcgtt aagcctttgg     15540
     tgccgtacat accagatgtc caatcaccat cgagaacaat caccttccat gaaagattta     15600
     tctggacaac acttgcaatt ctgatatatt tgatctcatc ccaggttcct ttgtttggaa     15660
     taatctcaaa tgacgctgca gatcccttac aatggatgag agccatgatg gcatccaaca     15720
     gagggacact tatggatctt ggaacaagcc ctgtagttac atccagcctt ataatgcagt     15780
     tcctgacgat gtccgagata ctaaaggttg actggtctat caaggaagac aagaatcttc     15840
     acaatgcaac tcaaagactt atatcactca taatgacggt tggccaagca tttgtacagg     15900
     tgtatacggg cttttatggc agtccaaaga gtcttggtac aatatactgc cttcttcttg     15960
     ttgtccagct catattctcg ggtattataa taattctcct cgatgagctc cttcagaagg     16020
     gatatggcct tggaaatgga gttaacctgt tcattgcaac caatgtttgc gagagcattg     16080
     tctggaaagc atttagtcca aaggtacttt tcacaggtcg tggaatagaa tttgaaggat     16140
     cagtaattgc attatttcac cttcttgtgg taagaaaaaa caaatttgca gcaatatacg     16200
     aggctttctt cagacaaaac cttccgaatc tcttttcatt actctcaact gtgtttctgt     16260
     ttgcatttgt tatatatctc caaggaatga gagtagagct tccaacagaa tcttcccagg     16320
     tcagaggaca tgtagccaaa ttccctatca agttgctgta cacatctacc atgccgataa     16380
     ttgctcaaaa ctatatagtt ggacatattt catctatttc ttccttcctt tacaaaagat     16440
     ggccccagta tctctttgtc cgcatacttg gcgtttggaa cacatccaag actggaaggt     16500
     acactccaat aagcggtctt agttattata ttacatctcc agagtccctt ctggagggcc     16560
     taaaggatcc gcttcgattt gtcatctatc tttccattat gcttctgaca tcggccatcc     16620
     ttagtacatc atggctcgag ttaaacgagc tatcccctga aaaagccgct cagaaactca     16680
     aggagtctcg tatgaggctg aagggtgtaa gagaaacaaa cacagttcac gtgctttcca     16740
     gatacattcc aacggctgca tttcttggag ggattctcac atctatggtt gtcataatgt     16800
     ctaatctttt tgacaccatc gggagcggca caaacatctt cttggccacg tcgattgtaa     16860
     atcagtacct tgaaatgttt gccaaagagt caatccaaaa gaacagtgaa ataggtttta     16920
     tcgagtaaag ttatttctat ggccctacaa gcttttttgg aacaataaaa atttaccttc     16980
     aattcttgaa tgatagcaat gggattagag ggaagtgcca acaagttagg catagggata     17040
     atgaaggaca acgaaatact ggcaaacgaa agactcacct acgctcctcc tccaggagag     17100
     gggtttatcc ctgccaagac tgcagagcac catcgctcca aaattctggg tcttattgcc     17160
     atgtcattgg agaaggccgg aattaatctt aacgacatcg atatattttg ctatacaaaa     17220
     ggaccgggaa tgggccagcc tctagcagtg gtggcaacgg ttgctaggac aatgagcttg     17280
     tactgcaaca agcctcttgt tcctgtaaat cattgcatag gccacataga aatgggtagg     17340
     tttataacaa aagcaaaaaa tccggttatt ctctatgtta gcggaggaaa tactcagatt     17400
     atagcatact acaacaaaag atataaaatc tttggagaga cattagacat agccgttgga     17460
     aactgcatag atcggtttgc tagagccctc aagcttccga actttcctgc accgggtctt     17520
     agtgtggaaa ggtatgcaag acttggaaaa aactacatag agcttcctta tgttgtgaaa     17580
     ggaatggatg tttcgttttc gggaattcta tcgaatataa agagtaaaat tgtggacgat     17640
     gagcagttga agtacgatct gtgttattcg cttcaagaaa cagttttctc tgcactggtt     17700
     gaggtcactg aaagagcaat ggcctttagc aactccaaag aagttttaat agtcggaggc     17760
     gttggatgca atctgaggct tcaagaaatg atgaacataa tggcaagaga acgtggtgga     17820
     acttgttatg caaccgacga gagattttgc atagacaatg ggctaatgat tgcccatgca     17880
     ggaatgctta tggccaagag cggagcttcc ttcagcctag atgaatgctt cgttacacag     17940
     agatatagga ctgactccat agatgtagtt tggagagatg attaaaacaa atcagtttac     18000
     aatacaataa aagttttata gtcttggttt ccttatcttc ctgggtagct ccacagtttc     18060
     ttctttgtct tcctcaggct cagtccattt ttcaaatcta tcgtagagac tgccccctaa     18120
     agaaatctcc ttcttatcta ggatcctggc tcttgaacta aggcttccaa gcaaatcgta     18180
     ctcgaggttt tcttccccgt acacctcaca ccccaagctc ttgtaggcag gatacttctg     18240
     ggctccaagt atctcattcc tatctctata gtagtctcct gcctcttcta gaatcacttg     18300
     cgggcttata tctgaacaac aatacatgta ctctgctctt gtgctaagat gcttataaaa     18360
     caaaacatat tggcagggat tatctttaag tgcactagac ggatggattg cacatttacg     18420
     gaagttgctt aaggaaacat atcccttatt acttcttttg gctatgttat agtatattga     18480
     agatacaata cacctttgga tttgctctag agatcttgcg cgggatattt ctattcctct     18540
     tcctttcaag gtcattaata ctgccttttt gatttccatg gcctttttta gtgcatcccc     18600
     attaactttc accttgttac accattcatt tctattttta ctcgaaatga attcgttaaa     18660
     tatgttcaga agagttatga agtcacaact ctgatggtat agagacgacg atttatcgaa     18720
     gtctttatca aaaagtccat aaatactgag cattccaact atgcttgtta tttcatcaac     18780
     aacaccatag tttatggagt ttataaccat ccgagcaaga ggaggctcta gctttaattc     18840
     actcatttct tctccacttt tagtgaggag gcccttctgg caaaccgctc ctaagcgata     18900
     aagaagaaat aaggcattat gaatcaactc ccttgagaga ctatcaagaa aatcaaatcc     18960
     aaatatatct tgaacaccat gctttaagag tagaagaatg acatcgtgta tgtttgttct     19020
     ctgtatttct ggcactgaag aagggagaag atcattctca taagtacttg ctgtatacat     19080
     tctgtagcat acacctggcc ttgttcttcc tgcacgccct gctctttggt ctgcccctgc     19140
     cctgcttacc ggaatcttca ccaacgactc tcccgtatca taattgtaga tacttatctt     19200
     ttgcaaccct gtgtctacaa catatccaat gtttgggatg gttaaggatg tctcggctat     19260
     atttgtagaa acaatgcatc ttcttacatt tctttctctc agaaacactt gactctgtgc     19320
     ctcctccgaa agttggctgt aaaatgggag agccttaaga tccatttccc ttccgtcctc     19380
     tttttcttta ctcaaacgct tattctgggc atagtgattc actattccca caacaccttc     19440
     gacatcctct tttcccgtca taaaaactag aatatctcct tcatcgcaat tctcatggat     19500
     ataaaggatc ttcttaaccg cccattcgac atagtcatcg acattcacgc tcaaatatcg     19560
     aatctcaaca gggaaacttc taccttcgat attgaagact gaacatccaa agtaattgga     19620
     aaacttctgg gcttcgattg tggcactcat tattacaagc ttcaaatctt tcctttcctt     19680
     caaaacacat ttcagtagtc ccatggatat atccaggttt gtgcttcttt catgtgcttc     19740
     gtccagtatc actacagagt atttcttaag tagtttgtcc cctagcagct cttgaagaag     19800
     aattccttcg gtcatatatc ttatcttagt gttccgcgtc actgtattgt caaatctgat     19860
     cgaatatcct acaagagatc ccatgtcact tcccagagtg gatgctaaat tcattgctgc     19920
     agcccttctc ggctgtgtgc atcctataat tcccttttct ccatatccct cttgataaag     19980
     atacttgggc accaacgtgc tcttcccaga tcctgtttct ccaaccaaaa ccgtcacttg     20040
     atgttccctt atgaatttca tcaaatcgct tctaaaactt tcgataggaa gcttctttgg     20100
     aatctcttgg gagatttctt cacctatcaa tggaatcgta ttgctccgag ggtgcatatt     20160
     caaaaacacg ctttctcgct ttgccacttt acctatctcc gtatctggct tctctacttc     20220
     gactctattc ttcaaagtac tgtcaagtat ttttcttccc agaaactcat ctatgctctc     20280
     tttatatacc agatccggag ctagatgatt gtcctcatca gagtatgtct cctccacact     20340
     cagtccggcg gctttcatct tcctcatttc ccatctcttg gtatcccgat atttactgta     20400
     tcccatagac ttgggtatga aaatcacaat ctaaaagacc atacatattt aattctcatt     20460
     attcttttta cccagaactc caggaattct cttattccct gcactctttc tatttgcata     20520
     catcgatgta acattcgtat ctaattcgtt tttggctggt cttcctactc caatcttggg     20580
     ctttggtatt tctcgaggtt ttacggcagg gctatctccg ctctttcctt catttgaaga     20640
     tcctcccacc cattttttct ccactggatc gtaacggaag tcgtcatcta catcgatgtt     20700
     ggccttatga accgtctctt ttttgaacat gttcaagaat ccaaagaaag atccactctt     20760
     ctttgattct tttttcttgc tttctgaggt aggaagctca tcatccataa atttggagag     20820
     aaataagctt gtgtcatctt cacttctaat ttcttcctct ttcttattgc tctcaaagaa     20880
     atctgcaaag ctttttgact gttttgtatc catgtataaa ttactccgtt ccttaatctc     20940
     gcaaggtgca ctattaacag ataactctct atcgcttgtc tccagctcct gattgtcata     21000
     tttcaacaaa gtctcctcct gagaaagtct atacatacca tctttttttc ttgcatcact     21060
     cttctttatc cattcttctc tgtttaatac cccatcgttt tcttttatct ctggcgccct     21120
     actctccagg actccccttt cttctttggt gttcacactg gtttcatggc tatcgataca     21180
     cgttacccgg ttctttttat caaatgaagc cgtttcggaa atactttcat ccttcctgga     21240
     aggttcagaa ggaatggggc ccaaagatgt ttctttgggt gcagaaaccc cgttcttctc     21300
     tagatcgtct tcaaaactgt ccacattaag aatctttttg attccaaagt caaaaacact     21360
     cttaagacca aaagaccatc tggtgtcaaa taccgattca agactgcttc caagctcctt     21420
     tctaaagcac tttcgatttg ctttaaaata ttcctctgcc ttttgcctat cgaattctat     21480
     ccctacggaa acaaattcat atttgagaag atcaaggtct tttatgtggc cgaaaatatg     21540
     ttctacatag caaagaaccc tgagggcttc aaagttcttg ctgaacatcc ataagtactt     21600
     gtttatgtct cctattccaa ggaggtgaga tgctattatc acaaatagtg catcgggaat     21660
     actcctatcg aaaacttgaa gtataaagtc attattaata ttgatgctct tggtacttag     21720
     aacctctcta atatatgctt tccaatttcc gttaagctta aaggaacatt tcgagaaccc     21780
     aagtgccaaa gatatcagct gtacacagga gctgttacaa aacttctcca gaaacttatt     21840
     tccaacacct tttgaccact ttggcaacaa aataccaact tcccatattt cattttccat     21900
     tgcatattca aaggctttgt ctgggtcttc tatacagagc tctatgagct tattcatact     21960
     ttcagcacta atagacctat tgatatcttt gctacaatag acaggttttg tatcggaaac     22020
     aatacgggaa atattatcga tcgatatagt cttaagctga actaattcat agacatgcat     22080
     atacttgaca tctccatttc tttcaagact tgaaacaaaa ttggaaggct tgatatcagg     22140
     gaggatgtag tcaggcctat accattccga aacatttata tagctttgaa tggcctctcc     22200
     ttgtatgttg aatctcttct gcgaagacat aaaaactgta atcaggtttc cgcacacaaa     22260
     ctttgacaat ggcttaggct tcatgggatc cattttagtg ctctgcaatc ctgtaggaga     22320
     cccaataaaa aggtttgtgg aatctatttg tttagactcc ccacaacttt cgggtgtctc     22380
     ctcctccttt atgatagttt cctcctcgat acaaggcttt tcctgaagcg gggtgtcttg     22440
     caagtcttcc ttgccattag aggcttcctt ctctatcttc acattagaga ccccttcaag     22500
     tatgaactcc tcgtcgtcgt cccaaagaaa atccatttca tctacagaag atatctttac     22560
     ctccgaatct gctacaggct cagacttcgt acttacttct agcctcgaaa atttgctttc     22620
     attccgaact tctttcatct ccataacctc ttctttgttc tctagtttat ctccagaaaa     22680
     agacttctct tgagtctttg cttcccagct agatgtctct tccggatcct ttttctcttc     22740
     ttctttcttt ccacttcgat cagagatgtc ttcctcggcc catggaattt ctccaggatt     22800
     cttttccagc tcttccgacg atgtattgga ggcttcgacc ttttgacctt ccccctcaat     22860
     tttagattct ggattgactc cctccgtcct gggtctaaaa agcagcccta tttcttgctc     22920
     atattcacta tcgctctcgc ttaagatctt ccaaaagtcg tcttcatcct tctcagatcc     22980
     attgtttttc atggactaaa attagacccc atttttaaaa gcccactggg tctctaaaac     23040
     cttgaatatc aaaacaaacc tttaattcta gtatctaagc tgttgtcgac gatataattt     23100
     agagaccttt ttattcctag caacaccttc ttccctttac atactttatg gactccagcc     23160
     taactgtact ctcatcctca gcaggatcct ccaaatcttc ttcaataagc ctgtcaacag     23220
     ccttaacaag atcctctatt ccctcatgct tcatagcaca tgtctcaaca tactcccctc     23280
     catgcttctt cgccttttta cttcccacct ccttatacca ttcttgtgtc tcctcatctg     23340
     caaggtcctt cttattcccc actattagaa tcctgacctt acttccggga ttgtcatttg     23400
     cctttgtaag tgtattaatc cagtgatcta tcctctcaaa agaggcctta tccttcatat     23460
     caaagacgat aatggccagg aaggagtttc ttgtatagtt tggtataatc gagttgaacc     23520
     tttcttgtcc tgccgtgtcc catagttgga gacgaaccct atgtccacta accacaatcg     23580
     ttgtactaac aaagtccagt cctatcgtag ggccatatga cctttgtact tcctggtgca     23640
     aatattggga cattaatgtg gtctttccaa cgttggagct tcctagaaat actatcttat     23700
     aggttgatct catttggatc cctgcccttt ttgtttattt ttatatatct ctcaaatgtg     23760
     agaaagcctt tgctttgttt ggaggtttcc ctttggatgc tattacaaac atagatactt     23820
     taatattttc gtttgttgtt aagccatggc tgtaagatct atccccaacc ccatcaatgt     23880
     ttctgaagaa gcttcttgca attgcagcga agaatgaaac gttagtccac accacaagtg     23940
     catatacaat gtacaacact acttttgaga acaaaagagc tacaaaactt gcatttacac     24000
     aaccaccggt agcctactca ttcttgagga agataaagca tgataacata gttggaattt     24060
     ataagctgaa tgtggagaaa ggatatctga ttacaaagag gctgtttcct ttttgctctg     24120
     tgttcagaaa ggaaaccagg gaatttaaca aatacatatc ttttaaaata gcacaggcaa     24180
     tagtgttcct tcacactcaa tgtggtgtag ttcacggaaa tatcgtgaag gattctcttt     24240
     tctttaacga ggaaggtggg atagttcttg gcggatttga aaagagcaga aacagtagcg     24300
     tatttgacca agacaacata atgttcagta atcttgtgaa agagctaaca aatgttgaca     24360
     ccacccttgt taaagttgcc ggagatgaga ggttttgctc agatatattc ttagacctgg     24420
     atatcgcatt ttttggttac aagtctttta ctacagagca gaaactagat ttcatttcaa     24480
     aggccagaaa gagcaaaaat gaatttgtag acatccataa gagaaggata tcatggatga     24540
     ttcttggaga tataaactct agcactcaga aggacttcaa aatactagct gttgattttg     24600
     tcctgggttt tggagtctca gacatggagg agtttttacc tccattgttt tccatattgg     24660
     acacgggtat cagactctac cttcttagaa actctgataa gtacatcagt agaatcgttt     24720
     ctttagaccc aataataaaa agtctgtccc ttggcatcaa atgtaaagat aaggagctga     24780
     gagaagaaac aattgtgttt ataaaggaaa acataaacat gatatctaag aagcagcaat     24840
     ctgaaatatt ggaaacaatg catggataca tcttggatga ccaggggatg cagttggttc     24900
     tcaagtttct ttgcgatgta agacctgttt tcaagaaaac tgatgttgta tatagaattc     24960
     tctgtaagta ccttatccaa tcaaaatcaa aagtaaaggt ccttgctgca atggaaatct     25020
     tctatgagac ctttgataac ttcaagatga ctacagagct tctacctctt ctctgtggat     25080
     atctatcaaa cagacatgca cagcctgcag ttttttccct catagaaaaa gtccttgagc     25140
     atctcaagga acacaaaact gaaatagtgg acaaggagtg gaagattgga aatatcaaaa     25200
     acatctttaa gccaagatct ccagaaggcc aaggaacaat tccttccgga aaggtagaga     25260
     ctccatcgga aaagtcagaa aatgagctga gccaggacca taaggaatgg aaaagcccag     25320
     aagacggatg ggatgatcca tggtgattat ccaaggtcaa aacctcctaa gaaataaata     25380
     caaattcaat ttattatgca tcagattaag ccaagtgttt ttcgaactaa tccatttcct     25440
     tttttccatc ctggaaaacc tctaattctt ttcgatatac attccagcat acttcgaaag     25500
     gcaaataaga ggcatttgat ctgtctcctc actactccat ccttggttaa aaatcctttt     25560
     ctgttcgtca ttgtatccaa agtggttgaa caactcactg actaacggca tgtttgactt     25620
     tataagtctc tgaggataag ttttcaatgg gccgaggaac agagttgtta ttctgtcttc     25680
     atgtcttaca tagtgtttaa cacacagctt atagactatt ggaaatctct ctgaatcaaa     25740
     agtttgcatg ctcctgtgaa gatagtagtt ttcaaaaaga ggacctccac aaaacgaaca     25800
     ctcctctaca gacaggagat accttatcag tggcttgtcg atactccttc gaacattcag     25860
     attgtttctt accaaatgcc ttgagcaagt ttccttgagt gtgacatgtc ctatgtactc     25920
     tacagtttct tcaggtgtaa agttgcagga tgtggcagcc aactctatta gaaatggaag     25980
     cttcaaaatt tccagtggga tattctgaat tttgttgttg gagacattca agtactttag     26040
     tccataaagt ctccctataa ccgagggaag aacaacaaat aggttattat ctatatgaag     26100
     tgcattgaga gcttttagtg cagaaattcc cttgggaaga gaggaaagaa ggttctggga     26160
     cagattaagc tctctaaggt tcttcagtag tccgatttct tcgggtagtt tctgtatcct     26220
     gttctttgaa aggactaaaa ccttaagatt cgtcaagcag cctatgtgct gtggaagcct     26280
     tgttaagtag ttgcaacaag cttgcaagat ttttaagtct cggatctctc ctataccctc     26340
     cgttatctcc acaacaaatt gtctgcacat gtatacctga cttctatctt ctttagaatt     26400
     atggcgtata ttagttactc tttctccact cgtcaatatc tcccaggctg tctcctcttt     26460
     gttaacaacg ttatgatata tatccatttc ttttcctgtt atttcctcca acctaggtga     26520
     taaaggaaga tgtctcgaga caagtctctc aaagctactg agagaagtag ctaaatgaac     26580
     gcttggataa ctttctactg acttcgccac tttgtacggg aaaacatgat cttcaagatt     26640
     gtacagtctc aaaacaccag gcgcacttgg attagatcga gcaataaccg gatccctatt     26700
     catactactc tgggtgtttc ccatagctta ctgtggtctc tcaaatttaa cgttgtgttg     26760
     tttgatgttc tttgacacaa taggtttctg gctttcaaac agacttccac ttggaaacaa     26820
     gtttcagcaa ttgtatgctt tatctctccg ggatacattt ctccgaaggg aactcaggaa     26880
     ccgctacttg tacaaggaaa aaaaggcctt tatttgctaa cttgaaacaa tccttgatat     26940
     tgaaaaaata aaaagagatt gaaacagtgc aaataatgac cgaggttacc agtgcggatt     27000
     attccaagca agggtaccat gaaataccaa agacagcata cactacccct ataaattggc     27060
     tcatcctttc cgataacaag ataagagagg tgccggaaag tataaaggag ctcaagacct     27120
     taagcaggct tgctctaaac gacaacagaa ttgaagaaat acaccctgga attgggtctc     27180
     ttgtgggact cacatggatc gaccttacta gaaaccgact caggtcattg cccgacgaaa     27240
     tgtcaaatct aaaaagagta tctgggcttg ggctgagcga gaacaacttc tccgaaattc     27300
     ccagatgtat attcaaaatg accaatctcc ggaagtttgg ctttttttca aacaaaatca     27360
     gaacaattcc caaagacatc aggtttctca tcaacctaat caaaatagat ttatccaata     27420
     atgagatttc ctcacttccc gacgaattct gtgagctgaa aaacctaaac tggctgaatc     27480
     tgtccaacaa taaactgcag aagcttcctg acggaatcaa caacttggta caattggagg     27540
     aacttggtct tggcgcaaac tgcctcaccg agctacctga catgagtaac ctgaggaagt     27600
     tgaggatact cccggtcttt aagaaccagc tgacccacat aaaccaaagt atatcccgtc     27660
     tcagcagcat cgaaaaactg gacttcagcg acaacaacat cattgaattc cctgggcatg     27720
     tgataggtat tccaactcta agatatctaa atctaaaatc aaacaagatt tcaaagatag     27780
     acccaagcac attcagaagc cgtgtatctt cagtctcaat aatcgatgtg agtgacaatc     27840
     ttcttagctg tatccctttg aaattcttca aaaccttttc aaatgtaaca gtaataagag     27900
     tgggggaaaa cccatttgtt tatcatgaga gcaagccagc acccagcccg gccttaacgg     27960
     agctctgcta caacaaatgc ctaaatatgc agtacaaatg cgaaagctgg ataaggaaga     28020
     ggtacccaaa tgtaaagagc tgcgatgctt gcagtaagct gtttactacc caacctcatc     28080
     tgggatatag cctcagctcg gttggggatg gaagtacatt tgttgttgaa aagatgttat     28140
     gctcttatgg ttgctacaaa aacgaatata aataaagatt taatgcattt tatcccaatt     28200
     atactactcg tcctgaagaa atcatgcttt gcacattctc tgagatcgga tgaaaaaatg     28260
     cctggagatt gaacttttca tcaactacat ttccttctcg tactccaagg acagtttcac     28320
     atatgagaaa tagaattctg tcatttcttt taatcaacac cgttccatca tctatttcat     28380
     aaggttcttt attcaaagac atgcccttga gcttcaaaca tactgtgtag aatctattga     28440
     atgtgccttg gtccaccttc attgaataga tttcgtagat gtgcttgact ttggcctcat     28500
     tattagaact cgtgcatatg aagtagatag aggagataaa gaagtctatg ttctttatgt     28560
     tcacatatcc ggtgttgaca aagtatatca tcgatccaac gaatgtccta ctccttacaa     28620
     gctttatctt ggagtcttcg tccaggctta tctccatgaa gtattcaata aactcctgta     28680
     atagtctttt atcattgtat ccgagctgaa tttcaacgtg ttccttgctg ctgcccttgt     28740
     atttcaaaag taagggaaga agcacatcta ctggtatcct catgtaagag aggaaataaa     28800
     gcatcggaaa ggtgacatca aagtctaaga cctgtctaac aaaaattgat gaatgcttgg     28860
     aatgtgcata caccagaagc tctgcatcgg atttcgggca tgatggccag acttggtctt     28920
     tcagatgggc ctttatcata tctactatca ttaacacttc ctctgtactg ttgttagcta     28980
     atgctctccc aaccaataag tctctgtatt cttttatatc ttttccttga agatatacca     29040
     aagctgattg gatatccgtc cttataagct cgttgatttt ttgcttggaa agttctccgc     29100
     agaaaaaata ttttagatag aaccttctct tctctctaca ctcaggaggt tcccccttct     29160
     ctttttttat cttctccaag ctctgctcca aaaagacatc tgttccttta aaagatttga     29220
     tacgaaaata gaactcccag ggtagatcaa attcgtttag gagatcaata tattcctttc     29280
     tttggctggt aaaaactccc ctgagaataa actctattaa tcttagcagg cactctcttt     29340
     cactaccagc ctttgtgtaa ttcttttgat tttcctcgga gctttctaca atttccaaca     29400
     acaaatttct gcaaagatcc attccagacc taaatatatt gaaggctacg gccctgactt     29460
     tgtgacttgt gtcaagaatt ctctcataga tatccaaaga gtattcgata atatctttaa     29520
     agcttgtttt ctctagtaac gttgcacgga tatcttcgtt acaattagaa aggattttat     29580
     gaaatatttc atcgtgtttt ggactgcaat tttcggctaa aatcttaatt actctcttgt     29640
     ctttatctcc aatgtaaaag ttacaaagct tctcaaagtt ctcctccgtc attgctgcag     29700
     ttaaatactt caacttccct tgtcccctta tgttccttac acacaagtgc tccctaaagc     29760
     taaggtttga atatacatct gcataaactt tatcttcaaa gttttccata attagagcaa     29820
     cagccggcat cgatatctct ttcgtaacct caattatact actaatttct ggatcctttg     29880
     gtatatggag aagcacagaa cggattactt ctcttgttgt gtcttcagtc ccttcttcta     29940
     tcagtatgat aataatctct ttcaaatact tctttgcagt tccactgact acacctatca     30000
     atccacttag cttggaaatc aagtctttat ccgtcagaag actggggatt ctgtatgtga     30060
     tgaaagtttc caggtttatt ttttcctttg gaagcacttc tataagcaac ttgaagaacc     30120
     tacgtttttc ctctttactc aaaaagcatc ttggggcatt tatcctcaga acttcaatca     30180
     cgccaagcaa tgtgtctaaa acctcttttc tcagctccat atttctcacc agatgctgca     30240
     gaacgtcttc atcgacacaa gacccttgag gcatctcctt tagcttcagg tacattctaa     30300
     atgtcttatt ttgtgtttcc gttctttttg ttctcttcag attttccatc tggggctgat     30360
     gaagctatcc agatcattta tcgggccatt taaccctaat ctaggtagaa tgccaaattc     30420
     cagaggcttg aaaagactct atgactcctt tttttgctca aggaccatat atcttaggga     30480
     ggaggaaaca cttgccatca aatcatttct gcattccaag aggccggttc tccatatctg     30540
     tggaaatcct ggaaccggaa aaacacacgt tactgtcaat accatagagg gctctttcct     30600
     ttacctaaac tattacagcg agagtgatat tttttcaaag ataaagaaca gcaactctcc     30660
     agtggtggtt atagatgagt ttgacaagta ttacaacgaa agaagaaatg agtgtatgca     30720
     agccatgcac tacctacggt ctcgtcagaa gctaataact atatctaatg acctgaggat     30780
     gtctggggat gtcttatttt ttaggccata ttcctcctcc gatatggaga agattctggc     30840
     ccaaaagact ttaaaggaat ctgcggaagc cattctgagt cctatagcta taaagattgt     30900
     atcaaaaaga attgggccgt caggagacct cagacaactc tttagatatg tacaggaaat     30960
     tgtgggaaga aaaatcatgg aaggaggttc gttggaaata gatctggagg atatacctct     31020
     tgaaaaggaa aacctagatt caaagcccaa taatgtgcac cacagtatta tcacatcgct     31080
     tatctccaag aacaaaaaag cctcaagaat ggaaatatat tcaaagtacc tcagggaatg     31140
     ccaagaaatg aaaatctcct cccatgacag aacagatttt aatattatat acgacatata     31200
     tacttgaaaa tgccgtaata cttcttgaga tcaaatcact ataagatctt cgatgcaatg     31260
     gtaatcatat tgaagcttcc aatgctcgat ggggtgcctt ttggcgaatg tcattccatc     31320
     tccaaagggg cctatgagaa aaagggcata gggaggaccc aaagtatcta taaggttgtt     31380
     tataatgcct ctatcataag gagaccggag ggtggttaaa ccttggattt tgttcatgtc     31440
     ctcttgtttc atctcttcaa tgaaagtcat attcatcaag gcaagcctca actgcagata     31500
     gaagaaaaaa gatgtcatta caaggaacac aagggatgat attccagata tcaccagaat     31560
     gtagtaatcc cttctatgcc gaaggggttt gttgaaaagt agaactgcaa tgaattctat     31620
     agacatgtag agaaatatga gccagtttgc taaggctgta aagaacaaga accttataaa     31680
     atgaccttgg ttatcataat tcacacagtt attgatccaa aagcagtggt ggtccatttt     31740
     ctttatgcaa tgtccacaag aggagcaatg atgagctctt tccggcttat gatttctgca     31800
     tttcttacag aacctcttga tttcatcgtg gtctatgagg ttaatggctt ctgagttgct     31860
     ctcaacatgg cctctgtaaa gtatcgaaag cattagatag atggccgata aagtacttga     31920
     gagtagaaga agcacaacat aagtcccctt aaatgtgaag tgagccggga ggataatttc     31980
     ggacaatgga gcgatgtatg tgaatgcaag tgaagaaatt agtagtgtca ttctaaaatt     32040
     cggccttatt ttacccattc caagggttta tttatttgtg tttttgagca ggtaggtttg     32100
     gcaaaaaacg ggatgaaacc tacatcaaaa agcgtttgat ccctggaatt taggttatct     32160
     tggtgcagaa aggaataagg tctttgtaat cgtcggccca aaatggaccg agaagttcgt     32220
     aagaatagag gattcttttt ccttctctta tggcccgttt tttctggagc ttcacagaaa     32280
     acaagattcc gttttcaaat ggattttggg aaagaatgaa aggtatacag aaagatgaag     32340
     atatggggat gttgactata tagtcaaaca ccaaggctat ttccagccct ttaatgatca     32400
     agaatgatcc ttcttcttca aacacaatct catttctgat tagctctttt ttcagcccag     32460
     cagtggcttt tagacacgaa tcaaacaaca gaaagttgtt tttgagtttc acacaaaact     32520
     tagtgttgtt ctttttgtat tccctgaacg ctgacttaat tgctatgaga tattccgaat     32580
     acattctcct aaagagtgga gatccatcat tctttgtctc aagttcaaaa ggaaatttgt     32640
     acatcttctg ctcctgtgct tggatttcta tgtctgccat caggaccatg gaagtgaata     32700
     ttccataaag aatcttttca tcctcaactt taggcttttc cttgtttctt acaagaagtt     32760
     cttcaaagat agcatcttcc attcgattat ctccaactgg gcattcctca ttgcttatct     32820
     tgatcttttt gtacaatgac cgagataaaa catcgaacgg attgtcgctt accttggata     32880
     ggatgtctat tttctcatct atcccgctac ttctattaag ttttcctcca tcttcatctt     32940
     ttacattatg attccaagtt ccttccatgt ctctgtcagg cctatatttt ccatttgatg     33000
     tggagacgac ctgtatctta cattcctgct ttattgaaaa tttttgccaa gtccaaagac     33060
     atgccgggat tagtaggagg gatactggaa gattatggga atattccaca gaagataggt     33120
     ttttttctag ggaaaagaaa cggaagtaca atagaataca tagttcaaaa tacatctcta     33180
     acatactctc aggtcatgca tggcctttcc ttgatgatac aacgtagact tgtgagatac     33240
     tttcagtacg aaaagaaagt ccattatgtg ttggatgtag atatggtata caggaggatg     33300
     tattttggaa tttattgtaa tctcatcgag gatatgtttg gagcagatgc tgcagagaag     33360
     ttcatggagg ttctgataga tggcttttct aaggcggata tcttcttaga ggaaaaaata     33420
     agggagatta tcgatgctgg aatgataatc ccaataggaa gaaaggaagc aagtctacta     33480
     gttgctgggg caagagatcc gacagaatgg atgagaagag ctagaatgga gaaggaagag     33540
     gaaaaaacgg aaagaaaaaa tcgaaagaca gaagaaatcc aaaggtttta tattgttgat     33600
     tttggccttc tcgatagcat attgataaat aacatgctct tatcctttgt taggaagaga     33660
     tatctatcta aggctgaaaa gatctacagg tcgattctca agtgcaatct agtctcgatc     33720
     gactccataa ttggcagttt tgaagaggag acgagtattt ctcgggggga cattacttca     33780
     tgcatcaaat actttagtaa ctgtgggctg cttcaaaaga gcttggactg ctctgagact     33840
     tatttcaagg atgaagatag tgtaaaagaa attcttgtgg ttgacatctt aaaccggatt     33900
     ctatcagaaa acagtaagga aggacagagg attttcaata tgatgctaga gtacaaaaca     33960
     ctggaggata aagatattgt aatcaaatct cttattcctt cttatatggt caagaaatca     34020
     ctgattatgc ttcattcaaa agggtttgtg gtattaaagc gcacggaatc tggggaatca     34080
     aagccggtcc tccaatggga ggtaaacaca ggtcgtgcat caaaagttgt tagagaggaa     34140
     attaaagaaa tgctggaagt atcttgggcc tcggtaaacc agaggtggaa atacataggg     34200
     ctcaatggag atggtgaaga cgaaggatat aaggctctcg accatatgtt aggtttatca     34260
     ttagacttct ttattcttgg agttcgaaat atggacttca agtctgagat gttttgaaat     34320
     ttttgaagaa tgatttagac atcccagaaa taatggctaa aagcttggaa caagcacttc     34380
     taagaatatc cgagttggag gaaaagatag aaaaccagca gataataatc gacgctcttg     34440
     tggctcgtat gaaaaaaatg gcaggaagcg atacgagtat agctttggag aaatgttgca     34500
     aggagcagga ggaatgtaat cctagaaagg aaatttccca ggatatggta cgccttgaat     34560
     ttagaaaaga agaaggtaaa aaggaccgaa aggatggtct gtcttttgag gaggagattg     34620
     aggacttgtt tagacgggat aaggttccca aacaattcaa agatacattt acaattgagg     34680
     ctcttatatc ttactccaaa gaatcgcaca gcttttcatt aaatagtaga gtggatgtga     34740
     agatgaagaa atcattccat acaaatgtta agcagcagat tgacaagatt tcaagacaca     34800
     ttatggtgaa tctaaataca tacgacctca acactatctg ttcaacactc aatctgattt     34860
     cgggagacct tgagtatcag cataagctgg tgactgctca tgacatcatc cttttcattg     34920
     atgacttttc aaggataccg ttcattattt ccgccttatt caacaaccag ggaatccgta     34980
     acgacgtgtt aggggagacc ataaaggaaa tcctgcttca ccaatgcatg gttgatagcg     35040
     atatacataa aaatcatccc catattgtaa gctattataa caagatagtc agtaatttcg     35100
     aactccatcc gaaagaaaag tccttgaagg acatatgtgc caacctagtt gtaagtttcg     35160
     atgtcttcga gaatggagct ttcaatccga tgatatttcc aagtatgtat tctgtaaggg     35220
     ccctatgcca ttatatggac tgggactatg catataacga gttcatatgc acagtgctct     35280
     acccgaggct gagggaaact cgcgatcccc tgtgtgctat ctacatgtct actgtagcat     35340
     tgaatgcgat gagagtattt ggagccattg aaagtgtaga gcttgtattt gaaaaactca     35400
     aagagtttat gaatgatgcc tcggacctat ccataaccat ctatctattt attaagcaaa     35460
     tcgatcccca gagagccaat gtgtggtatg aatcacaggt ggagaggata aaccatgtcg     35520
     atggagaata tttgaaaaat ctcctattgt attaatgtgg aaataaagtt tttggagtga     35580
     cacagaagtg cgaaattttg tacccttaga agatgaacaa agaggccttt gaacggcttc     35640
     ctcaggaaaa gaagaagatc atagaaacag cgtacttcag tgctgtgagg aaggaaatat     35700
     ccgcgtccca gttttttgga gtttgtaaag aagcactaac caaagatcag tttgaaagtc     35760
     tgttttcaaa caacacgcct aacaaggaac agcaagaaga aatgaagaca gagcatcttc     35820
     aagatattat acagtactcc ggagtagatt tgaaagaaga agcggagcat attgtcagag     35880
     agacagagac aaacatcaac tttggagaat acgaagaaga ggatctaaac aatcagatag     35940
     gaagtctgct aaatatacct ctattcagag agtttgtagc taggattgga aactcaagaa     36000
     gagtagggat tagtgaagag tcgttttttc ttctttttca agttgttaag aggaagatac     36060
     ttgatattgt ggagaagatg gaggaatcta gcaaatggag ggttgagtac aacctgtctg     36120
     aatttataat aaggataaat aacgacctta gcagacagct atggtgcctc gaacagatag     36180
     aaaaggcaga acttgaaaag tttaccattc gaaagggaga ggaggaagga aggaagaagg     36240
     ttaaaaaaac gattcaggaa agagaggatc tggtgattaa gaaaaggttg agtaatacgg     36300
     ttgcactggc ggctcttgga atccaacaaa agtcttggat gagtgcagaa gacgtccggg     36360
     tgaatgaaga gagtacaacc ttcaattcga tctactcgcc gtttgatgaa aaagcattgg     36420
     agaggaaagt tgtaaacaga accataacga tgaaggactt tttatatgta ttggaaagag     36480
     ataggcgata taacaaatct atttttacta tccaacatta tttcagatag ggatattttt     36540
     gatttccacg tctgttcttt gttttatact taattatggt ggggatctaa aaacagcgaa     36600
     gaatggacaa agagagcctc gaaaagtttg aagcccagat ctctgtccta tctagcaagg     36660
     agattgagaa ggtcatgaaa agattgagca aggatgagtt tgatgtgttt atagagattc     36720
     tagagaggca caacatggac ttggataggg atcttgaaca tggcaagaat gagctcctac     36780
     aaagattaga aaaccatagg attctttttg aggatgcttg gaatgcgatt cccgacgggg     36840
     ttagaaagca tttgacggga tattatcaat ccatgaatga tatcctgtag aaagggttct     36900
     attcgcttga taatagtaaa taccttttta cttacgtttt tgatatttgg atggattaaa     36960
     gcccttaacc taagcctgca tatggaagac tacattggaa taaggctgtt atttgagacg     37020
     tccaaaggag taataagcgg gatgcttcgt gccgttgatg agaattcagg gaagctgatt     37080
     attgaagaca tgaatgaaat gaaggatgtt cttatcgaag acattcaaag gctggagatt     37140
     gccgaggaat cttctccaaa tctttctgta ggacataact ccaaagagga aaaaaggctt     37200
     gaaaacacgc catctatcga tgtagatagt aaaggaatgg caggaaaagt cgtttctgga     37260
     aagcacttgg taggctattc ttcgagaaag gagaaccttg acctggtatc tgagaaatct     37320
     aaaagcggcc aaacagacga aagcagaaca agctatgaga atgatgataa tgttcgatcc     37380
     tctagtaaag ttggaagcga cagaagaaga gatggttata atctggaaac ctcagaagaa     37440
     gactactacc gaatgatggg aagggcattt agctactttg ggcctcttga agaagagttc     37500
     tgttctattg ctgcacgtca aacatacaga atattctcta catacttcaa taattcaagt     37560
     ctaagggtgg aggtgtttgt ggcaggtgac gatgtctttt caagtatagg gtttatactt     37620
     ggaaggctac ttctacacac agggaagatg tcttctataa tatgcaatga aaatctcttg     37680
     aggaacacaa ggtatagaca gtcctatcta aactcgggag gagttattac caacagacct     37740
     gccccggagc caagcataca catttattct tgcaataaat ctttagttcc cgcctgggcc     37800
     aggaacaaca taagaggatc gatctatttg gacatgccag ggcacaactc cgaggagaaa     37860
     gaaacaaaaa taggtctttg ttttgggtca ataccagctt atcatcgaag attcaacggg     37920
     atagtgtact ttgtcgacat agagtatcca gctcctcttt atgaagagtt cgggcttcag     37980
     aagcctacaa gaagtaagat ccacaaggta aagtagctgt tttaattttc gatgaagttc     38040
     tcgaaaaact tgctcacgct taaggacggc tcctcctctc cattggaatc atagagattc     38100
     ctaagatcct taccttcaat gttaagggat ttaaggtcca agatgtcgtc cacgctgaac     38160
     atttcaaaag cctttttaag ttctacagaa tcaaacaggg tattgtgcat ttccttaact     38220
     attaaaagat aatcttctaa ggatattctg ccctcgggat tcccaaaagg aaccattccc     38280
     tcatccaccg aaagacctaa ctggctcaaa caccagcaaa gatccattgg acttattcca     38340
     cattcatttt tcttcactgc cttgttgaac agagcagtgg cactttcaag aatcttgtcc     38400
     tctttctctc ttttgctcag aatcttttcc aaggtttcaa gtttctttgc agcaatattc     38460
     ttaaatccct ccttctgagt ctttgtcaag ggatgtgtaa aggtcatctc cataagtctg     38520
     ctcttaagct cagaagtacc ttgcatctgt tccttcatgt tttctccttt ggcaaataca     38580
     tgcttgaaaa attcaaatat tctatttaga gcatcaaact cggattggaa ggaaggatca     38640
     aacaacttct tgatttcaat gctgttcgca atgctctccg gatgcaagga agggaactca     38700
     agcttatcga gagacacgtc ctccggtggg aaatatcttt ttattctgta gaggtcatgg     38760
     attgcgttta tacttccaaa aagagaatga atctcggtag actcatgcat tgccttggag     38820
     tttgtttcaa gcattagttc aaatgccttg ttgaggcttc ttatcatctt gcatacctct     38880
     tttttctgat tactcaagtc ttgtatcaag gaccttaagc ttcttgcttt aacctcataa     38940
     aggtttcggg cttgtatcga ccagtccaca gcttccaaaa cccccttaac tctgttcaaa     39000
     gcaagctttt ccttctcata ctccttgaat tttctgtagt atccagatac atatgtcata     39060
     atactctttt cgtcgggaat cgatacctct gcaatatctt ctacatccag cagcttcttg     39120
     atgtttagag acttctctgc aatcctaaac gcttggctta agttataggc cttttttgaa     39180
     ggcttaagct catgaaagtt tggaacaagg tctggccgga acctatggat aattgcattg     39240
     aatgcaagcc catcctgcca gcttcgagaa aaatcaacta catttacatt tttgtatcca     39300
     ttggtcactt ccttgcacca tctaagcaat tcgtttctta tagaaagttc ccctgcctct     39360
     gtaatctctg caatagatag ccttaagatc aaagaccaca caagtcctaa tataagcttt     39420
     gggtttccat caacaatatc agctggccct atgtttatga gcttgacttt ctttcctttt     39480
     ataaaggaca gaatcctctc tacgttttcc attttttgga ttcttgtgca tggggccggg     39540
     ttgtattcaa ccacatcctt ctgcaaagcc gtcaacaaat gtgcaagctt cactccgtcg     39600
     caaagatctt caaatatatc tccgatctcc ttatgccctc ccttcaccaa cttctcattc     39660
     acccacttcg taaacgtttt cttttggact tcttgccatt ctttctcctc ttgctgcgtc     39720
     atctgggata accctctttt ccaattataa aagtattgtg agtctaggca gtcaagcata     39780
     aaattaacaa aagaaaacaa gtcacatatt ttagttatga cagcaaagac tacacaaaaa     39840
     taagctcatg gacaaccaca gcctgcggta tggtctcgaa atccagccgg tataactctc     39900
     ttgtgatggt tttgacatac tctaaatcgt ctagtgttgt aaaagccgct tggggatgca     39960
     gaaccagact gaacaatccc aacaacgaat caatgttcat ttctgtcact ccagagttcc     40020
     tgtcaatcat gctaagaagt tcaaagagtg aaacaagcaa tttcctttct gtatcggtaa     40080
     atataaatgg catgtatgaa aatagtgctt ctcttgcatg ccggtcattt gagatgatac     40140
     aggatctaat cctctcaaaa gcttctatgg gaactagacc atccagatgc tctcttatat     40200
     agtttttaag agcatttgcc agcactagaa catctatact ttcaatgtct gtgcatttgt     40260
     tttcatgtaa ctgccttgct atttttgcag cacttagctt gtctggctca tacctaaaga     40320
     taaacttggt ggatattgct cttctcttta gcgactcaat gacgtcaaag accattggat     40380
     tgatctgccg acaatgtcct atccttctct ttttttgaaa gcaattcatc caagcaaaaa     40440
     gtgtatttgt tgttcttttt ctaaatgcat tgcaacagaa cctgttaagc tcgattttct     40500
     gtgcagtgga tagaagatca tatctaaatt cccgggactc tccttcaact ccaataaacg     40560
     gaaaaataga agacttcctt ctcccctgga tggttgttga actgaaaaga tcttcatata     40620
     gccgtgcatt gaagcttcga atcgatcctg gaaaagaatt atctttcaat gattttccta     40680
     ggatacgatc gttctccgaa atgggctgaa gtatgacctg aggactgcac tcttgagaac     40740
     atgtcgaaga tgaaactctt gattcaggta gtgactcatc tgtccttgaa tatgtttctt     40800
     ctatttcctt catctcggct atgttgaaga tctttctttt ctttggaaaa tctcttaaca     40860
     tcatggggtt tgtttatcaa ccttcataat gtgacggata tagtcatggt aataagatct     40920
     ataattcata aaaagacctg gttgaggtaa tacattaatg aatcccgcca ccgtagtatc     40980
     taccaggagc ccgtttcagg tttaaagaaa tgaatgaaaa tttctaaatc ccgacagatg     41040
     ccaaaactcc taaaaaactt tgggttttca tctcttagaa agtttttagc agcctacgat     41100
     attccagatc ttccaaacat agtagatagg gtgtatatca aggcagatag aaagccttca     41160
     atttcctcgt ttgactgcaa attgaaggaa atagaactta tatcaaaggc tatcagaatg     41220
     cttttgtcaa gagacaagga aaaccatcta tgtgcgggat acaaaaggtg gagttctggg     41280
     cctcacgatt cagactttag aattttatgc tactcaccca gcgcctcttc aaagatactt     41340
     aggtcacacg agtggagcca tttgatgaag tcgattggcg acgagctagc ttttttcatc     41400
     ctcacggaat gtcttgtgat tcaaatgtta aatggtagtt atatctttct agcaggagac     41460
     ttcaaaagcc tcagcaagat ggccattgaa agggggagca acgctataaa taggagtgta     41520
     atcttttaca aacataacca gaaaataagc ttttcttcac tttccgcttt tgaatatgtt     41580
     tttgaagctc acaattcgga aaaatataag acaatacaga gagacaccag agatatacta     41640
     gagagtatag aaaaaagatg gaaaaagatt cccattcact ctatgttcag gtcctttttt     41700
     aaggacgagt tgactctcga gggaaagggt aatattttgg agtgtagtgt caagcagtct     41760
     aagttagtga actttttgtt cctcatttca aagaaactgc ttaaagatgc ctttgactcc     41820
     catgcattca gaatactgaa atccaagctc tctttgttgg tccataggaa ccgctatgaa     41880
     acagtcagca aaaatgagat agcaaagtac tttagaatct ctcgattcaa gttcttccgg     41940
     gcctatcgat gtagaagaag tgaatttatt ttcaggtcca agatatcctc aagatttctt     42000
     gtctatgtga tggaaaagct gatgatacca ataatttcaa ggcatttcca ttccacagaa     42060
     acttcctttt caaagtttaa ggttcactac ttcccaagac ctatctggca gcatttttcc     42120
     gatatttata tcgaaaggtt cttgaaaagg tttgagcagg ttgaagagaa caagacatat     42180
     ccttattcgg agctaagatg cattccaaag atgagtggag ccagggttat ttcgaatatg     42240
     tccagaatta gaaatgggag accgtcgatc aacaggaata tatatcctga attctgtgtt     42300
     ttaagagagg agactcgtgg aatgcttgga aattcgattc taaaccattc gggaatgtac     42360
     gaaaaactta ttccttactt gataaagtcc acaaaacctt tgtatatcct aaaggtagat     42420
     ctttctggtt gctttgataa cattcctcag gatgaagttg tgaacctagt gaagagacta     42480
     cttagtaaaa gccggtattg cacaagaagc ttttctacac taggggaggc aaacggggaa     42540
     ctaaagaaca gatacgtatg caaaacaact gatgttacag aagccatcga tagattgact     42600
     atggagtcta gtgtctttgg aaatagaata gttaaggaaa attcgaacca aaggattttg     42660
     agcagagaag aaattgaggg aaccatgata aacattatca aaagaaacta tgtaagatac     42720
     aaaggaaagt tctttattca gaagaccggg cttgcccaag ggtgtgtggc atctactctt     42780
     ttatgcagcc tctactacaa gaggatcgat gacctttatt ttgacaaggt cttcaaagaa     42840
     ggcattctta caaggtatgc cgacgacttt cttgtggtat ctccatcctt agacgaaata     42900
     atgaagtttc tggaagtgtc tcagtccatc tcgcacctgg gggttaattt tagtaaggag     42960
     aagatagaat caaactttgg tttggaagag tattttaaaa atacatccaa catctccgaa     43020
     ctctccgaac ataagaacaa gatgaaaata accgacaagc ccataaagtg gtgtggaaca     43080
     aagatatatc ccaataagtt ttcaattaag tcgtgcacta tggatccata tcttcccttt     43140
     tctaccgctc atagctcgac taggcctgga aaggctttgg agttgaggat gagaaagttg     43200
     ctacggaatc gaatgtccag aatttacata gacccaaaca acaaaaaagc atatgaaaac     43260
     ttatatgata cgtttctgtt ctgtgggaag aaggcgtgcc ttcttctcaa aaggatggat     43320
     tttatcaatt gttcttttgc tcaaaggatt cttgaatgtt caaaacattt tgcctttaag     43380
     gtctgtagga agaatggaat ctccataaca aagaagaaga tagaggacat agcctctaag     43440
     gccttcaaga agagtggcat tagcaaagtg ataagtgctt agtcaaccgg ggaataagac     43500
     tctttaccta agtaaacgtt ttaatgtgaa tcttctaagc ttcattcaag aactctaaaa     43560
     catttagctc tcaaagtcta atctctgctt acttcggaac ctttcgggac ttttgtctct     43620
     caagccaccg cttagccttc tactaagggg cgaataagct ggacctcggg cattgctatg     43680
     ctccttgtcg tcgctagtta gttccatggt gattttattc gatactgttt caataggcct     43740
     tcccagcaca ggaacgcctc ttctcccatc tcttgagtgc aaaaaccatc taggcatcat     43800
     gatggtaaga tgaggcttgt aaatccaatt gtagacatag tcaattgaca gtttcattgc     43860
     tccaaccttg tatttcatgt tcaacttgtc tctgcaggcc atcattagca ggtgcgatgg     43920
     aacagaatct ccacatattg atcttacagc acatataaac aagtcattca ggcccagaaa     43980
     gtttacaagg cctgtccctt tctccttaga cataaacatt agaacaatat gtaaaatgtt     44040
     tctaagagaa atatcatcaa cattgaagat atcaaacaga agataaagag cattgagtaa     44100
     cgattttgcc cccatgtacc ttttcatatc caatcttact ccactatgaa gagaatctct     44160
     ataacccccc tcaagtaaac acccatcgaa atcctttttt tcaaaaagga tctttgcaac     44220
     tatttttcta tacagcccat caagaagata tcctatatat ctatctccat ggtaaatcga     44280
     tattgcaaac acattgaacg acaaaaacag cctcattctg tcatcgggat tctgtagcaa     44340
     aaacaatgtt ctcagcattt cctggctagt aagtcctgat ctctgaaccg gagtgagtct     44400
     aacaggccta aatccatcaa tcatctcctc aacatcccca aataaattga agctgtccag     44460
     aagaaagccg agaaaaaggc ttttatccac accatctatt tggaccatca atccttccga     44520
     taagattgca agctccttta agaagtcaga aaaccccatg acaaaatgaa gggaactctt     44580
     aaagatattg tagttgattc taatctttct ctcccatcca ttagttttta caaaaagaat     44640
     cctctctatg ttcattctgg ccattgtgtc atgccctgct cgtcttttat agttgttctc     44700
     gtcctccata gtgtacttct ccctagcttt ctcttcatga tcttcatagc tgctgatgca     44760
     tttttgtaca tactttcgtg cgctagtgta aatatagttc acgggcattc ctacatcgat     44820
     ctcatcatca aaattaactt ctaagcatgc gatcccgtct tccatccgtt acggctgtga     44880
     ttaaaattat tttgttcatt tttattataa aggtaattta aaatgtgttt aaaattagat     44940
     ttgttattcc atcggacctt cttttcttgt aaacatttac ttttcttgaa agaaatagaa     45000
     cctggcattt tgatctttca tccggctaga tgctctttat ttcctgctct ccaaatgtaa     45060
     tgtttatcag agaaactaag ccgattaaaa cataaaggat taaaatacac ccaggctcac     45120
     cccaggatgt ctaatttgga tttctgcact atctacacaa caacaggcca aattgatcaa     45180
     ctttcctatg cacaaaaggc tgcagattca ggcgatacat gtatcggaat aaaaagtagg     45240
     aatggaatag ttctattggc agaaaagcct cggatttctc ccctctatgt gcttgaatct     45300
     gatgaaagga taaaaagagc aggaaattct gttgcagttg tatccacagg attgactcca     45360
     gatgtgtttt atgtcgggtg tgcagttaaa gatcatgtat tccatcacaa ggaaaacttc     45420
     aacgaggacc ccactccgga gattatgaag gtctatctga atgatatatt ccattatttc     45480
     actagaagca ttaatctcag ggttttgggg gtaaatagcc tggcaagtgt atacaaggaa     45540
     ggaaggtttt cattactgca taccgattgc tctggaaaaa cactctccta caaggcagca     45600
     tgcataggaa aaggaacgag aagaatcaag acagagcttg agaagctaga catcgacaat     45660
     atgacgattg aggagatggt ggacacaggg gtgaaagtgc tgtatatggc acatgatcct     45720
     tccaaagaca aggagttcga tattgaagtt ggaattgtat ctacagagac agggggaaag     45780
     ctaagaaaac ttgaaagtaa tgagatacaa atatttgttg acaagcataa gcacatgagt     45840
     gttgatgaag actagggaaa ggcccctctt gttctgcaat aaatcccttg gtctactgca     45900
     ccctttatga catctgtaat aaactaccga tttcgctcga ataaaaactt ttcacggatt     45960
     gtattccaag gaactggact acctttgtgg gaactcaagt acgagataat caaccaaaga     46020
     aagatggtct cgaaggattt cgacctacta tttttcgatg gagaaacgga tgaagaaata     46080
     aatgacgaat atcagatcat ttcgatgaat agccatgtga tagtaaacag gattcccttg     46140
     tggatgtcaa aaggaggata caatgtcaaa gagaagaggc ttgagtccca gacccatcac     46200
     cacaatacac aaagacatgg aaagactgtt cctgaaagct atgtgtgctt ccggtgcggg     46260
     caaaaaggac attatattca gaactgccac acaaatcaag ataaggcatt tgacattctg     46320
     agaatccgga agccttcggg gattcccaaa gactttcttg tccctgtatc tggagaaagt     46380
     gtcccaacaa atgctgccat gttagttact ccggaaggag gatacgttaa agctcagcct     46440
     caggttcaag aatggaagaa gtacaagcaa aggactaaaa tgacagttga gattccagac     46500
     agactgaaat gtcctttgtg tcactgttta cttgtaaatc cgatgagaac aaactgcgga     46560
     cacacattct gtgatcaatg cgtagggatc gatagaaaat gctatgtgtg ctcgaaagtt     46620
     gttgaaaact tcacgcaaga catagccatg aaagttgaag ttgagaaagc tatagaacaa     46680
     agaagataag aatatgctaa acaattaaaa caccatataa atattctaaa gaaaggcaac     46740
     cataaaactt gtatttgtta taagtgaagc ccaagagtct ctttttaaag tatgtttttg     46800
     tagaggaagt attcaaagaa ggggttgtcc ggaattgagt caacatgtgt agagtcctgg     46860
     tcgaactccc ggcatcttgg gtttgtacag tctgaaaact ctatgtcata gtatgcagag     46920
     atgtccttaa ttagacttct gaattcgggc acggatctgg agcagcagca gagaataagt     46980
     cttttgagga ggacatgtgc tctatggatt ggctggcgta tctttataaa taagaatctg     47040
     atgaccttga cgagttcatc attgtccaca atctcagggt ttattggatg aatcatggag     47100
     tacagaagat ccaccaatcc attgaaatca tagcattcat cctcatacaa ggttagtatg     47160
     gaaaggatcc cctggacctt ggcgtcagag ggtatctttg aaaggctgtt gtttagtagg     47220
     aaatagaggc cctccatgaa ccctggacga agaattttcc tatacttcac aagccccata     47280
     aacacatatt tataacactc gtatctatct cccttaagaa ccgtgaagta caacctttga     47340
     atggcatcat agatcctctt acaacttttc atttcttcaa tacgcccttc gatgtcctct     47400
     tcatctttaa cctcagactg aagacttaga cgctctttct ccatcttctt aagttttttg     47460
     ttaaatatgc gttttctatg gaatatgcta ttcttgtctc tcctggatac tcccctgttt     47520
     gcctcccaat actctttggc tttctcttca tcactcttca aagagttgtt tacaaatgga     47580
     atgtccaaca agtattccag aatcaaggga ttgtactcga agtcaagcat ctggtctagt     47640
     atagttgcaa tcaactcacc ggaacaatcg cttctcagct tcaactttat tgtgttgcag     47700
     cacatcatcg gtacagaccc ctttccaaga gatcctctca gaacccccga gacaatcttg     47760
     tctgtggcat taaagtggtc gaaatgctgt aagacctcgc acaatgagat ataactttcg     47820
     ttagatatat catcaaccat ggtctttaca taagatgtgt accatttaag aagattctta     47880
     tcatggtctt tcaagtgaag agcatctctt ttgtctttca ccacgtcttt caaagacctc     47940
     actttgtaca gaggaatgac tgctttaaac actttaaaaa gagacagata aaccattccc     48000
     tttgctttcc cttcaaatga tccatttcta agcatctcaa atattccctc catcatatct     48060
     aggttctcct gtgggttttc tatgatcttt gtgcatatgg acccaatctt cgacttctgc     48120
     tgatccattt tatccatcgg ctaacagtat attttttatt ggagcaaaaa gcagattggt     48180
     tggaaaccaa atatggaaga attgataaga tttattgact tagatacgga tatactgaat     48240
     gaccacgaca gaacttccta cggttctatc cgagcttcgt tgtctatctt ttgcttgctt     48300
     gggctacact ggcacaagat ggaaatctta cttatataga tgaaaggctt catttctcta     48360
     atgcaaagaa catctccatc tatttcgtag tgaatttttg aaagacagat gcaattgctg     48420
     gccttgtgct tcttgcattt gctaatatca ctttcacacc tgccgttctg gttgcactgt     48480
     tctcctgtat tcccagtacc ttgagacaaa tacaacacaa gtgtgtcttc tccagaaact     48540
     tccccaattc gaatatcccc gggcctggct tcggtgtttg gaatactgtt ttcggcggtg     48600
     ttctcctcca tcttaggaat tccgtctttg cacctcggag cgttttatct gtttcataca     48660
     tgacgtcaaa ataaggagat gataggatct atctattgac catctgcttg gaagcagaag     48720
     aaagagacct gggcaaagaa gcaagatttc cctgcaaaat tttacccaag atgattgcag     48780
     taatagacac aggatatttc atagaaaggc agattcctac agacaaggtg attaggggat     48840
     atgttacaga ttctgttata aatgaactta agactgcaga gtctgaagaa tatctcaagt     48900
     tcttctcctt catgatagag gtaaggaatc cttcggaaga atatgtagag aaggttagaa     48960
     gagatcttag aaaagaggtc aacaacttga gtaatacaga tatcgaggtt gtagcactaa     49020
     cactggaact aaaagatgag gtctcggaaa tgtgggttgg gccggaaagc cagaaccaag     49080
     aggaagttgt ttgctttaca aatgacaacg ggataaagaa tgcgttattg cggtacacta     49140
     tatacgagag ctctatgttt tcctctcgaa agtataaagt ccgatgctat ggatgtttta     49200
     gccttttttc cgagaatctg gacttctgca aaaaatgtgg acatcgaaca ctgacaagaa     49260
     tagccgttgg agacacggag aatggggagg ttatgttttt taagaaagga tacgaataca     49320
     ggaagccaaa gacacttaag aatgcaaagg gagtggaact ccggagtgca gatcagagag     49380
     agtatgtcca gtatcaaaaa aatctaaaga gtaaaagcaa caggtcccag agaggactag     49440
     atttctgaaa tcatgagtta ttgtttattg aggcttatga tgtcgtataa aaagaataaa     49500
     ccttccgaaa ctatcacttt ttttatatca tctgccgata cctcttgctt ctgtctctta     49560
     ccagatatct cctttgcctt gttcaatata aactctgaga ggatggagac gtatttcgat     49620
     atcagtttca ttcttctctc ttcggtgcta aggtttatta aagctgcaat atcagaaaca     49680
     ttttgaagat ctagaatctt agctggagcc tgtttccctc catctacctt aatcttttta     49740
     caaaccgtca gtatattgtt tctgtatccc ataggcatcc ctgggtggag gatttatatt     49800
     tgttagataa agacggagta caatctcctt ccaaagattg tgagggccta tttctggaat     49860
     ctgaaaacac cgttaaatga aggggaaaga cttgaaggaa gaaataaaag aatcctctgg     49920
     agaaaatcga gttatgttcg gaaatcctac aaagaggctt gcctgtattg gaatgaattg     49980
     gagaaacata aatgtcaaag atctgtttaa gatcttcaac tcaattctac tgggctcatc     50040
     tcctctgagt gtgaagctct gtaaaaccaa gataggaaga gaacgtcttg gagacaacaa     50100
     catttttgtc aagagctgtg aagagggaag gatcgatgaa tgttacactg ctgttgccga     50160
     atttgaggat gtagatgatt caaagcacat atatactgca tgcgacggag taagattagg     50220
     gaactcggga atggtgtttg atctgagatt tgtgccggac tctcttgatc ttcaaaacgt     50280
     atgtgatgag gctttcaacg atgacggatg tgaagaaaag gactttgttg tcagagagaa     50340
     gaaagaggag gaagatgata gtgagataga gtctcggctt gagaaattat tcaaagaaaa     50400
     ggaaatcaac ttcgaccttg tctccgagct ggtcgacatg tctgatgatg agaacatttc     50460
     cggcctgcaa gaccatctgc caatttcttc ggagaacgag aagagcaagt tcctagagtc     50520
     cagctccgac gattttaacg acgaaatatc ggaggataag gagatcgaaa ataagaaagc     50580
     caagaagaaa gagtctagta agaaagacat agaaaccatt cccagaggaa agccaataga     50640
     cgagtgtgat ggctttatgt ttgatccaaa agacaaaaga ttcgaggcaa tatttgaaga     50700
     cgaagacttt gccattgacc ccacacaccc cgagtataag agaaagggcg gtttgaagga     50760
     gatattagat gaaaagagaa aaagaattaa ggataacatt gattaaagtt tctttggatt     50820
     aacacacaac cggtttgaga tttacaatag tgcaagtaaa ccgtttattc ttaatagatt     50880
     ttcaacttct ttgatctcca gtgtcttctt gccttgttgt actccccctt gtgctccttc     50940
     atcattctct tccatgcagg aatctctctg ttcctcttca aggctctcat gagccttgtc     51000
     ttcaccaaag cagtctttct tgatccctag aaattaaccc gagtcaaatc gccttaccat     51060
     ttcgtcgggg ctcaaatttt tctcaaaata accttaccga ggagcttcca agatgaggag     51120
     ccaaaggcta ttttttcatc tgctctctct ttttgctatt ttcccgcatt gcattgtaaa     51180
     atgtgcagag tttctcgatt gttaggctgt ccttgaggct ttccaatata ctgcaaacaa     51240
     ctcttatgtt gttgggtgtg tctttatctt ctctgatcct atacaatttc cacccaccct     51300
     tcctcagtac aaactcatca agatcccagt aatatccgtc gttgtcgtac agaaactctc     51360
     ctatttttcc atctacttcc tcgtcttcac aaaaaaaatg gccaaacaca acatcctttc     51420
     ctctctttcc actgcacacc agatcgtata catggccaaa ctccttggcc tttgtaatct     51480
     taaaatctat tgtgttcaga aacgtaggct tccacttgag aattacacct cttttcccta     51540
     ccgagtaagg ctcatctgta ggagtgaata ttaagccgtc atttccatgc ttcaggtccg     51600
     ggatcttctt gtacacctcc cagaaaccat agctcttcat catctgttta acatagaaat     51660
     gtatactgat acatccaggc tcctggccct cagccccaat tggaattctc ttcggctcaa     51720
     acccatcctc gtcctctttt tttaaggctt tggtcttttc gacacttccc ttcattctat     51780
     ccacaaacat ttgtgcgtat ccaagccttt tatacaagtt cttaagtatc tggggagcgt     51840
     cttcatatat caagcaatca aatatggcgt aagtggtgac tgtgccatct tccagaaaga     51900
     tctctccatc tatcaagaca gtcgaggaaa agggaaagtt catgtccaat tcgtagaagt     51960
     cgttttttct atcgtaaaag tatcctttgg atatgcccat cttttctgta acaagcagca     52020
     aagctctgat tccgtcggac ttctcgcaca caaggaagtc cttgctcaac aaaagatcaa     52080
     tgttgtccag tgttagagac actggatggc atcctggaaa cctttctctt ttcttggccc     52140
     ctgctatgca aagcttctgg tatatgccta ttctgagggc ctctgcctcc tcggacggaa     52200
     ctttgttccc tagatgtaag agctccatga ccgattcagg actccgacaa aactgcattt     52260
     tccatagccc atccacaatg aaaaagatta cagcacccgg gattcccgag tggtctcccg     52320
     cctcagtact atccgggctc gcacaggctt aactgcggag atctgacgag ttccggtgct     52380
     tttctgtgga tatggccgta atcagtcata aatcctttcg actataaaaa cagtcccaaa     52440
     actccaagcc aaaacagaac catcttttaa ttaactacac ctgccctcca aactcattcc     52500
     ttctccctaa gccttatata ctccagcacc tcagacccgc tcaaaatcct cttttcgttc     52560
     aaagtcttta tcctggaaaa cacttcgaaa tctctatccc ggatcttctt caagactcct     52620
     gtctcctcgc catcgttgtc ctcctcgtgt gttttgacct cggcaaaacc tctggtcgct     52680
     gtaaagctaa acagctcgtt tatacatgac ttgttgaaga atctacttag cccagggtta     52740
     ctcaagacct tcttcccaag tagatcttta aatatctgct tttgataaac cttctcttca     52800
     attgtatcct tgcaaataaa cctatatatt tccacacctt ttctctgtcc atatctccat     52860
     gccctctcct tggcttgtgt gtctgtcgat ggattccagt ccgggtcata tataacaatt     52920
     cgagacgctc cagtaagatt tagtccaagg cctcctacct tggttgtcaa aagaaacatg     52980
     aatatgctat catccttgtt gaatctatcc acaagcgaag accgactcga cgtcgatgtt     53040
     ctaccatcca ttcttaagta tgcgtacttt tcaacacact tctctattat atctagcatc     53100
     cttattgtct gcgaaaacac cagtactttg ttcccctcac tcttccattt cttgagaaga     53160
     tccatcagaa tctttatctt acacgaggag ctcacaagcc catactggct ctcttctttc     53220
     ttcaaaagcc ccaaggtctc ctcgttattt ttttcgccag atgcttcttc agaaaggtct     53280
     tcagaaccgt cttcctttct gggaataaac agtcttggat gattgcatac cttccgaagc     53340
     atggaaatcc cactcagaag gttcgccttt ccaatcagaa ccttcattat gtgttttgac     53400
     tcgagaatcc tgttgtagag ttcaatttgg attggtgtca acgtgcagaa tattattttg     53460
     tcttccttgg aaggaagctt atgcgaaatc tgcgactttg ttcttcttag tatatacggc     53520
     tctatcaatg accggagcat caaactgtgt ctataagcct tttcaacctg gagattgcta     53580
     gcactcttgt accctcctct acgtattatc tcctcaaact cctcatggaa agaggtgtgc     53640
     gaccccagaa gccccggatt gacaaagtca aacatagacc atagctcccc aaggttattc     53700
     tggatgggcg ttccagaaag aacaaagcga ctccgagacc ttactttctt cactgaaagt     53760
     gtgatctgcg catttctgtt ctttatcttg tgcccctcat ctaggaccaa agtatcccat     53820
     aaaaggtcct ttgcccttgc cttgaacttc tcatacgaca tcaaatacac tcctctgcag     53880
     tcctcggctg ggaatccaaa gaaaactctt acaaacggat aaaatctttt ccattccgcc     53940
     atccattgcg agactattgt ggctggacac agtattagtg ccttttcgat ggatttgttg     54000
     tggaatagaa ctgctaaaaa cacaatcatt tggatcgtct tcccaagccc catatcatct     54060
     gcaagaactc cacctttctc tctcttatac agccccagca tccatgccac cccatcccgc     54120
     tgatattcaa aaagcgagtt ccaaaggaaa tctggaatct caaatccctc gcatatacta     54180
     ctttcctttc ttaaattctc ctggaactca ttcttcataa ttcccatgtg attgcagtac     54240
     ttctcaatcg acttctcaca cctttcgttg aagacttcaa tgtccttgtc atcttccatc     54300
     ccagaccatt cgaagtcgat attcctcttc tcttctacct cctcttttct actgtccttc     54360
     ttgcacataa tcgatttgtc tgctgcaagc ctgcttttaa cttcctctat ctctctctcc     54420
     aagtccttaa ccttccccat atctccttta cctttgtgtg cctctatttt cttctttagc     54480
     tcatcgatct tggaagatgc cgccctctcc aagtactttt caacaaacga cttctcatag     54540
     tcttcggctt tacagtccat aatgaaaggg aaaattcaaa acaatattta atatccgact     54600
     tcttctcact ttcctcatag ctgttcacaa tggtgaaata gtgctttaat ctcttcctcc     54660
     catagcatct tacactcgtt gagcttctcc ataacctcat tgtctataga aaccccaact     54720
     gtattactcc gcaagcggat cttattaaca agatacacaa tgtcttctac ggcactttcc     54780
     ttgtcaccta acatcacaat cccaagacac attgtgaagt atttgatctc aagatctttg     54840
     tacatctgca agagccttgg cctgtaccgt cctactccaa ccatttcgtt caaccatcta     54900
     tctaactcct tcggggcctc tagaggtatt ttcctcacat attcgtccac ctcttcgtca     54960
     attctattct caatgtattc atggatcttc aggccatttg tctcgtcgta ttcttggagt     55020
     ttcttaagaa gctctatcct tgatacagtc gagggttttc ttgtctttga gtaaacactc     55080
     tcaaggtggt ctatcatcat taacctaggt ttttctcgtt tcaagcctag gatgcacata     55140
     catttaatga tctggtttat tctctcctta ctgttgaatg ctatgcttct cttgaactcg     55200
     ctggttagaa acccctcgag gtccttacac ttgtctgcat ccgtggtcag tatctccaaa     55260
     agcatttcaa tgttctgagt tttctttgct tcctcaacaa ttctcctcac ctctctttct     55320
     cttctttcat gcatcaagcg ggtgtgctcc ttcttcagct cgtaccattt gttaagcttg     55380
     tttaccagag attccatggg cttgccttca tgactccgaa aacaagtata taatccatgt     55440
     ctgcttccca tcacgataca atggcatctg gacagagaga cagagaagac acattgtacg     55500
     agagtacttt ctacgagaaa aaaaacaacg aggaacaaag gaagaacaac ggaaattctc     55560
     actattttct cacaaagctc cagctaaact ttaaaagtat ctttgaagga ggcaagagat     55620
     tccattctgt agaaaatatg catcagaacg aagaaacaaa ttcctaaatt ctgaagattc     55680
     ctttaataaa gccttaactt cctgatgcgc tatgtaaact ctttatttca gacgccctag     55740
     atgaaagagg aaatcgtttt ctgccagaca cacatagatt tttacatgag tgactcggga     55800
     ctaagctatc cacatcccgt gttcgccata tttggaaaca tagagtctgg agagccgatt     55860
     caggtgcttg tcaagaactt ttttccttac ttctatatag aaactgtcaa cggcaaggaa     55920
     tacaaggagg aagatataaa ggattccatt caaaggctcg atataaaagc cacagtggta     55980
     gaagttgaag ccacgatgaa acaaaccata ctgggatata cagaagggaa atcaaggttc     56040
     tacaagctga ctctgaacac gccccatgtt tctggagctc tgcgggcatt ccttgagagt     56100
     ggaataacaa ttagaagaga gaaagttcga ttccgagtgt acgagagcag ctttcccttt     56160
     gtgttgaggt ttatgtgtga ccttgggatt gttggaatga gctatctaaa agtaaggaag     56220
     tatgaggttc tagacggtaa gtatctaacg gtgagcacgt cttatgaatc cttagagccc     56280
     cttccgcctg taggcgttta tgctattctt ccgcccctca aggttctaag cctggatata     56340
     gaatgtgtaa gtattggaaa cgcctttccc tcttctaaga cggatcctat tattcaaata     56400
     ggaaacactc taacgatgtt tggaagtgat aaatacttgt ctcaagacat attctgccta     56460
     aaggaaacca ctgggattcc cggcgtcaat gttcattggt atgagacaga aaaggaactt     56520
     ctggaaagct ggaaaaaata cttcatggaa cttgatccag acatcattat aggatacaac     56580
     gtgaagggct ttgatcttcc ttacattctc ggtcgaggag aagtgcttgg aatcgagaac     56640
     ttctctattc taggaaggtc caagaagaaa gcaagaacaa gagacacaac aatgtctagc     56700
     aacatgtttg gatctataat gaccacggag gtggagattg aaggacgtct gataatagac     56760
     atgatggttg tgatacgaag agacttcaag ctaagaagtt actcattgaa ctctgtcagt     56820
     atacactttc tgaaggagca gaaggaagat gttccctatt catccattgg ggaactccaa     56880
     tccaaggata aagatacaag aagaagaata gcctcttatt gcctaagaga tactgtactg     56940
     cctcttcgct tgttctcaaa gctgaatgtt ctaatcaatt atgctgagct gtctagggtg     57000
     acaggagtcc ccatagaata cttctttaca agaggaacag ccatcaagat atttgcactt     57060
     atctatagaa cagcttccaa ggagggtttt gtagttcctg aaacagatcc atttgaatct     57120
     ggtaagaagt acgagggagg atttgtcatc gagcctaaga aggggttcta tggaaaacct     57180
     atatctgtaa tggatttcac ctctctgtat ccttcgataa tgatcagcca taacctttgt     57240
     tataccacat tactcacgaa ggatcaatac agaatccttg gagggatcag aacgccaaca     57300
     gacaactatt tctgctcacc tgagagaaag aaaggccttc ttccaaggat tctggttgat     57360
     ctgctagact cgaggaagaa gataaaggag gagttgaaga aggaaaagga tccggcagtc     57420
     aaggcatgcc ttaatggaaa gcagctggct gtgaaactct gtgccaattc tctgtatggg     57480
     ttcacaggag catcgaaggg gaagcttcct tgttttgaga tatctcagag tgtaacgggg     57540
     tttggaaggg aaatgataat gcttacgaag aagctgattg aggagaactt ttccaagaaa     57600
     aacggataca cacatgattc ggttgtgatc tatggagaca cagattctgt tatgatcaat     57660
     ttcgacgagg aggacataaa aaaggttttt gagatgagca aggagatatc tgagtttgtg     57720
     acaagcaagt ttatgaagcc tgtgtctctg gagtttgaaa aggtttatta cccatatctg     57780
     ctcattaata agaagagata cgctggcctc ctgtactcga atccaaacac agctagcaag     57840
     atagacacaa aaggaattga agctgtaaga agggacaatt gtgggcttgt taaggaaact     57900
     gtcgagacgg tacttgagat gattcttcat gagaagaatg ttgagaaggc caagcaattt     57960
     gttcgagatg ttgtaagaga cttgtacctg gggaggatag acttgagtct tctagtgatt     58020
     tcgaaatcct taacgaagtc tggggagaag tatggaagta gacaagctca tgtagagctg     58080
     gcggagaagc ttaggaaaag agacgaaacc acggcacctg tgcttggaga ccgggttcca     58140
     tatgtgatag tgaagaaggg caagggaata gcagcatatg aaaaaagtga ggaccctgtg     58200
     tatgtattgg aaaacaacct tccgatcgac acagaatact atattgagca acagctttcg     58260
     aagcctatgg agagaatatt cgagcctgtt atggataatg tggacgagtt gtttaagggc     58320
     gaccacacaa gagtcgtgca aagggcatct cttaaagggc cgatgaacac ctttttgaag     58380
     ctagcggatg tctgtgttgg atgtagagca gaaggaaaga tcatatgcag caattgtaga     58440
     aaggactttc atatccatct tcagaaaatg caacaggaag tggaaaataa aaaagaaaga     58500
     ttgaatagtt gctgggtgga gtgccagagg tgccagggaa gcatccataa ccaagtattg     58560
     tgtgttaata gagactgccc aatcttttac atgcgaacaa aggtgagaaa ggagttgatt     58620
     ccccttaatg aaaagctcgg gaaattaagg tcttttgagt ggtgaagagc gaaataaagt     58680
     aaagatggat gttgtgtgtt ttctttttgg gcaaagaacc gaaaacatat attacttagc     58740
     aagttctgtg tatgagagag aagaagcaca atgaacacga gtatttattg aaacaatcag     58800
     tagccaatat acttgatacc cattcttttt agggagtgaa gaatatctga acatgtgata     58860
     gtctttctct tagcatgtgt ggagtaaata catgcgatgg aaagagtatc tctgatatat     58920
     tctcttgctg cattatttat ttctttaaag caacctccgc cgactctcct cacaccagca     58980
     cgcctggcaa ttctcctgat tgctggcttg gagatgctgt ctgtcagccc ggactgtttt     59040
     ctgtgtctct ttgcaattcc ctttgctgcc ttactctttc cttttgcact gatactctgt     59100
     gtattcattt aggggattct gttttgatgt tttatagttt tatttttggc ggggacattc     59160
     cctccaatct aattatctat tctaaacatt ctaatttgta agttctggac cttttttttg     59220
     gaaggtactt actttggaca gcgaaaaaga tgcacagtcc ctcctaaaga gatgaatctg     59280
     ccatatttgt actgagagga gctgtgataa taattaaata cgtctttttg gaccagcctt     59340
     gtttctatag cctggatttc ttgcaagaag gcatttggcg cgaaaatctc ccggcaaata     59400
     aaattataaa tatacactgg agatgaagga cagaaatgtc aagaacaaaa cagacagctt     59460
     caaaagcact tggaggaaag gctcccagaa agggcatgtc gatgaagtcg gtcccgtcgt     59520
     ctggatcttc atctgccgtg cctaagggga cgaggttcaa ggctggagct cttgccctga     59580
     aggagataag aaaataccag aagagtacag atctgcttat aaggaagagg ccgttccaga     59640
     ggatggtccg ggagttatgc aagagcggag aaggcataag attccaggct tctgcaattg     59700
     ttgccttcca ggaggctgtt gaaaatttcc ttacaaatct tgtggaagat gcctatagat     59760
     gtgttctaca tgccaaaaga gttactctga tgccgaagga tatttgtctt gtgtataaga     59820
     taaagtatgc gaacattttg tatgcagccc ttgactgaaa taaagtattt ttattcttct     59880
     tgattatagg aatctttatg aacgggaacg gaatatttgg agcgcactgc ccccctccat     59940
     gggggatgtt gtttacatag tccatagaca gcttgaaaga ataccaacca ttccagagca     60000
     tgcgagaaca gttgacctcc gccggaacaa catatcggtt atggctttga acaaggcaga     60060
     gtctgtcgag tatcttgatc tatcagacaa cagaataaag gtgatttccg accttgaaaa     60120
     tgttccgaat ctaaaggtgt tggatctaag ctacaaccta atcacagaaa tttccattcc     60180
     ccgcatgggt ctctcggagc tgtatctgat ttctaatgac atttcgacga tccatgggct     60240
     agatcttccc tgcatcaaga agctagacat ggccgtaaac gacatctgtc agattgaaaa     60300
     cctcgagaat tgtgcaactc tagaagagct ctacctcgga agcaacagaa taagaacagt     60360
     agaaggactg tccgagctca aagatttgaa ggtattggat cttcaaaaca atgaacttga     60420
     agtggtagat tgctcggcag taccttgtaa tgttgaagtt cttcttcttg gagagaacag     60480
     aaaccttcaa atgattgaga atctcgagtc attaaagaat ctccggattc tggggctgga     60540
     gaagacaaga gtgccttctg atctatttga ggggtgtttt actgtttggc gctaactctt     60600
     gcgagccctc aattggtagg acttgattct tcaacacata ggccattgga taaggatact     60660
     gacaaaacat tacccatgga ggaatgcttt gaaaaagaaa acaagaaagg atggattagc     60720
     atccaggatt caatgaaaag atctaacgac ttttggctca aggatgacga tgcaacctcc     60780
     tatctgaaca ggtttgttgt gtagccaagg aattggtaat taaaatggtt ttctatgaag     60840
     cattctttga gtacttttcc aatctatcct ccgataaaga aattttccat ccagaactat     60900
     cccatatgat tggaggccga tcaatcctga agtttccatt tgttggtatt agaaaaggta     60960
     tttcggggaa tgcagttccc ggacttgcat tgtcaatggc tgtccttaag cccattagtg     61020
     ttgtgatgcc caaggtcctc acagataacc tctacaaggg tgcaatggcg cttgctactc     61080
     gcccgttttg tgttggagac aaaattaaaa tcgacaaata tgatggactt gtgagggaca     61140
     taagcttttg gtatgtgacg ctggagagag gaaaaggcta tgtgttcata cccatgtccc     61200
     atgtatataa tactgttgtt gagctgttca aatagcttca atgatgctta agatgcaaag     61260
     ctatccagat ggaaacaggc atcataataa ataaggttta ttctcttgtt ctttctctgg     61320
     gcttgcactt gacaattgca tcgcacttga ttatcatttg tgcagcctcc gatgcagcag     61380
     taacaacacg atgcttgatt ctaaagctgt ccacaacccc agactccttc atacaaccaa     61440
     cacttccgct acggacattt actccatagc ttgtcttacc agagttgtgc tcggccctca     61500
     gacttgccct tatgccttct ccatcatatc ctccgttgtc cgcgagtatc tttggaattt     61560
     gctgcaaagc atttgaaaat gctaaaatgg cttcactttc aatcccagga acctccatgg     61620
     cataagtgtt taggtcgact gccattgcca tctcactgga ccctcctcca tagacaacac     61680
     gcggatcctg ctttatcttc gacagaacac atagtgcatc atgaacactt ctttctgcct     61740
     cgtccagcat ctctttcgat gatccacaca ggacaatggt gcttgctcca ctcttcaccc     61800
     cgctaaactt tattgctctt tcgtttccaa tgtaaacatt cttgacattc ttgcaggtcc     61860
     catagcatgt ttcatccatg ctgtcgaacg tactcagtat ctttcctcca agcacattgg     61920
     agagtctttc aaccccatca aagtctgcat gttcaatggc ttggattccc tttatcttca     61980
     ggagctggag aggataatcg tatataagct gtctattaat aaacatattt atcccgttct     62040
     gggaaatccg ctccaccttt tcttgaatct ttcccttctc caccttctcc atctcctcaa     62100
     gctcccccac agagctgaca ttgatcttag ccccaaatat cttaattttg tcttgatcca     62160
     tgctggtgtt ggctatcagg atctttggat cgttcacctc ctctattcgg acgtctttct     62220
     ttagaagaaa cccatcgtcg agatatgagt cctcgagctt cccagaacac ttgatcacct     62280
     gtacaagatt caagtcgttc ctacccccaa ggttctcaat agcattgaca cagatgttgc     62340
     agaacttctc cagatcatac ttcagaacct tcgagcacag tgttgtcctg gcaagcttga     62400
     ccagatcctc tttcgatggg ttgaagctaa ttctcttcag cacttcagaa cacctagcct     62460
     gtgccattct atatccctta aggatcttcg ttggatgcat ctccagcttg ctggcctcct     62520
     tgacaagtag acttgccaaa attgcaacag aagtcgtccc atctccttcc tcccagtcct     62580
     gtccagtgct ggagttgatc aatatccttg cagacgggct gtcgatcatc aggttcttga     62640
     gaataaatgc cccgtcgttg gtaacatgga cgctttgtcc cttcagcatc ttaagcatcc     62700
     cctttggtcc aagggttgtc ttcagtatgt ctcccacaat atccgtccct gcaagaatcg     62760
     ttctctttgc atcatcgcct ttttcctcgg tggttcccag atttgcatgg ctgaagatgt     62820
     tcatctgggg tgaaaatttt gttcttcttg taaacccatg aacgaagaac ttcctgtggc     62880
     tccacttgtt atgaagccca caagaatata caactatact cagctgatag cgtgtctgaa     62940
     ggcgaagcaa cagaaactgt caagatacaa ggcttcaata ccgcctagtc ccttcaaagg     63000
     tatccttggg cccaagcaat gccaatttga tgttgaggac atagttaatg ggtttctgca     63060
     tgaaaagctt agggccaggc aaagggaaca tgagaagtct atggacaaga tgttttccca     63120
     atgtgtcagg agacatatta aggagctgaa gagggaaaac gatctttttg tggttgggaa     63180
     cagcaagatt ggagggagga tcaaggcttt ggaagatgtg tttgacaagg attttgaaga     63240
     caaagagggg gccaatatcg ctgaaatgga agggaagggc aagttctttg acgatgcttt     63300
     ccttcttgac atgtatatgt ttcttaagag actgaaacct tcggactcct ttgatcaaga     63360
     gattaagttt cttggagatg aatacttgag atatgtggag aggtttctaa aggagaatgc     63420
     agacaagatt aaagagccac tttgggggga agaagacaag atttctgttt ttaccaagct     63480
     tcgatatagc aaggaggaat atggcctcga agtgtatgag gggagatata tgtttgcaga     63540
     gctctacact ctttttagat gtggactctt ggattctgca aagggacttc ttgagcgatt     63600
     ccatgttttt tttgagcaca tttcacacag attcaaaaca agctttggta gttggattac     63660
     cacaagaaca aaaccggcag ttcctgtcaa gatagggggt tctgacgacc ttttcaaggc     63720
     gtttcttctc ggattgatgg atgaaaaaag cagaaggatg gatgaaagga ttattggcag     63780
     cattgaggat tttgtgtgga tgaatctgat ctcgattaac gaagggagat ctgcctctga     63840
     gattttgaag atgtttagga actaccagaa tccaaagggc cttttccttg catatgtgat     63900
     gcttaaggac tatgataaag caatgagctt gatgttcaag ggagacttct ctataattcc     63960
     atcttatttc ataatgaaag ccctctgtcc tcgatgcaag aataagaaag tgtttgtgga     64020
     ctttgtgttc ttggcagcct cccgattttc atcgactaca agaaaggtcg aaattataag     64080
     ctccttgaag tctgtaatag aaggatacta tgagatagtt cccgaaatga tagtcaagat     64140
     ggggctatac gatgtacttg ggattgattc tggagcctgt ttatacctcg ataagaaagt     64200
     taaccagaaa gttatcgaga tactgaaagg aaagaatgag aagaagaaat taatcaagct     64260
     ctactatttg attgatgatg aaacacttgt tgtggatctc attaacgaag cggttaccga     64320
     ggcaattctc tcagatacgg acattgacga atatcttgag attatcgagt actatgaaag     64380
     ggtggaatgt acaagacaga cccgaatgat gtctgcattg aagagcttct acttgttcaa     64440
     aagaaatccc tctccctcta cacttggaga aaccccattg cttgactcag actttgatct     64500
     gacgaacttc cgatatgtag ttgaaaagat ttttaagcca gcatgcgaca ttgtggagaa     64560
     gatgggagac aacgagatgg caaggacctt gtttaagctt tgtggagttc ttggacttgg     64620
     agacgagatg tcaagctatg caaacagaca tcttgtacta cttatatgaa ggaagtttaa     64680
     tggccaggta attattcgat gtttccagta ccccatatcc ttatgaagtt caactctgcc     64740
     gactttccga ttatgaagag gatgttggtg gctcgggagg aagggatata ctatgagatg     64800
     gagaagaaca gcctggccga tacatgggat aggttgctgg agtattacag cgaaaagatc     64860
     ctagaggagc acaaagaaga gattgaagaa gaggagcttt acagaatact ttgcaaggca     64920
     agggtggaag cggaaacagg gagaagggta tatgagctaa ttgataaaga tgtgcttgag     64980
     acacacaaag tgaaaccacg gagtgtagac aggtgtgaat tcaagacata tattctggac     65040
     tcgtgcatca ggatattaag aaaggggatt tctgaactta aagatgggat tgaaaaggaa     65100
     tcaagagtct ggtcaaaagt ggaaggagct agcatgcctg taaggctagt gagaggaaag     65160
     gttcaagtct atgtaacaga gacggaatat ctagtagtga atgaggaagg agactatgtt     65220
     tacccaagtg attggaatgc tcaaggagtg acatgcaaga ttagatatat ggatgttcat     65280
     ttggaatgtt ctgtgcttcc aaggaacagc atggataaga tagaaatggt taaggagtac     65340
     tttcttgaaa gatcaattat tcagaaattt attcgaaatg acattgagat cgagataact     65400
     ccaatggaaa atccttcgga aagggaagac ataatctgca agtatgtagt ttgccatcta     65460
     aagagaggaa agagcatcaa agagatattt gaaaaagtca atctctatct ttcaagaaag     65520
     cttgttgata tcattgtctc tggaagtaag aaatgcactg tcttaaggta cagtggccat     65580
     gttcttgagg acggattacc cgaggtattt tttgtactta cggataacaa ggtcgtcaaa     65640
     gccatgagac aacagccagg gaagtttgag atatttgtaa atgaagttcc gattagatcc     65700
     tttcgaaatt atatctcaag agaggagcct tgaagccttt acttcctaaa tctatggacc     65760
     atgcagggct ttgaataaag actttggtgt tcaatctttt ctactttctt tgcaaacatc     65820
     ctggcctaat aataaaccat ttcggttgga actcgcttct taagttggtg gttatctaac     65880
     ttgaagttta cagcccagag atgataagat gtgtctatac aatgcaaaag cataagaagc     65940
     tgaaaacatg gatggacggc tttatagaac agaaagggaa aagaatacat ctttacaaca     66000
     ccgacatggt gaagatagac agtttggttg cttcttgtct agataacgag atggagaccc     66060
     caaaatacct tttgtacatc gagtcttttg aggatcctga ggaaaatgag ataaagcatc     66120
     aggaaaatcc tccttctacc tcaagaacat tgaaagacag accagaaaaa gacatagaag     66180
     gtaatgtgaa atgttcttca ccacaaggaa ggtctgaaga ggagataata aatttgtttc     66240
     aagggtaaca tggctttatt attacctaag agtcttttca atactgcttt caaatgaaga     66300
     cacaaccttt ccatctattc cattcagttt tagattgttt ctcttttcaa gaacgtgttc     66360
     cctctgtgca ttgatgttgg atatgacgtt atccatcact tccttgaaga ctcctatcct     66420
     tagcttcttc aattcgctta ccacaacagc agcaagctct ggaaacccaa tactctttga     66480
     aaacacagac atgtgctgca gaagaagaga tcctgcctcc tctataacaa acatctgatg     66540
     ctcttcgctt tttgtcctac tggggtccgg attaaccatg tcgtagctta tttttcttcc     66600
     ctcaactgaa agattcttta cggatatggc attcttcaat attctgatta tatagaagga     66660
     taaagggaca taaaacttcg acccagctac agacttaata gctcgaaggc agaatatcga     66720
     ataccgataa tctttatatg tttctattat tcctaccaga agctttatgt aatctctgaa     66780
     atcagagtgc ttttttagac acttacttaa aacctctatc ataaatgtga tctttgaaag     66840
     atctgggttt ttggttctgg catatttctc taagtaaaat atttccgcat cgacatcctt     66900
     cggattcaat acataatttt gaatgtcctc gggaagtgtt aatgcctggg atgtgtatat     66960
     ctttgaaaga tagctttcct ccaattccac accattgtcc gtttgtgtca ttttggggat     67020
     tagaaaatac caaatatact cttaaaattc cagaaatgct tacgtgtttt gtaaaatctc     67080
     aaggaagagc tgatcttctc aaatgtccac atctgtcccc agaaggtcct ttgaagtaac     67140
     tttagaactc ttatattgtt atttgtcttt aagctgtact taatcatcca acaccctgaa     67200
     tttggaactt cggaaatatt cccccaaccg gtgccaaata gagcaagagg tctttctaca     67260
     aggagaggtg gcagtccagt ggaggatctc ctcgaaaact acttctggtt gagtagattc     67320
     gagagtagcc actgttggtt tgatcccatc agacaaaggg acagggtaga tcctatttcg     67380
     tgtgggccct ttggatggaa gggcctggag agcagcggag ggcatgtgtt ctccggcaat     67440
     agagagccct ggtgaattca tcgagttcct gaagcccctg atgatcgaaa gtcctgcaat     67500
     aaaaaagttt attagatgca tttgagacta tgcaggaaaa ggtaagtaac tttgatgacc     67560
     acatgtgcga tctggaaaag aagattaaag acatcgaaac agctttccaa cccatccttc     67620
     tttccaagga atcccacaaa agatcgttgc ctgaagatag ttttcttaag aacatatatc     67680
     ttgtgttgat aattgtgtta tgcatacagg gtgttctctg gtacacagac aatgaaaagt     67740
     cttctgctgg aactgtgtgg aacatggtag tgtactctgt ggcagttgtg gggacgattc     67800
     tgtacatggc ctgggtgtgg ggatttggcg gaaggagatg gactagtgtt gcgagcatgg     67860
     tacctatgat ggttggattt ctgaatttgg ggaagagggt gagctgtgag tacgggatgg     67920
     agatggcagg gcttgggttt atgatggttt gtatggagag tcttgcaaga cacgggatgt     67980
     catcatggga gattttggca ggattgattg gaaatggaat tgtagtgatg ggatgggtca     68040
     gttgggctac aatgagggat agatatggag agaggatggg ccagtggatg tgtgggggac     68100
     ttattgtgtt tggaattctc atggctgtga tgatgtatat gaaggaaggg agaaatgtgg     68160
     aaaggagcac tggaagttat atggtgttta ttatgacagt ggttgttgga acagctgtgt     68220
     cttatgcatg tggagaggat tacagacaac ttgcaactaa gaggttgttc caaagacctc     68280
     ggattgtgga aagtaaatgc cagaatccaa tttaataccc aatttagata tgtatttgtt     68340
     tctagatata gaactaggca tcaaacatca aaataaactt caaagtataa atctttgtac     68400
     aaaatcttta agtcatcctg agagatataa tggatgttcg tgtgatcaat aaggcctaga     68460
     cctccctttc gacatatctc agacgtaagc ttctttgtag cccttgaact cgtcttggct     68520
     agttctgtga acatctcctt gctaacaaga atgttcaata gaaacggccg ttcttcaacc     68580
     accctcagca aaaaaaatac catctgctta tagttcttgt ctatgtattc cttgacaaga     68640
     gaaataacct cttcgttgtt aaagttgagt atccagtcca atggcaaggt gttgaacacc     68700
     ttcatctttt cttcgggaaa caatggattc atgagaacca tgccgaaaaa ttccctgaac     68760
     acctctgctt tgcagctgaa cagtatgtag aagtccagaa actctttgaa tcgtgagatt     68820
     ctcttaccca tttccctgat tacagatgaa gagtctagtt ggcagaagtc tgaatagaag     68880
     aagtccttca ggaatttgag tctgttaaac tcaaaaggaa gtagggtgaa gcctatccca     68940
     cagttcgact tcgaaagcgc ccattttata tcgatccctg cattagcctt ctgtctctta     69000
     aacaccctcg attggttttc tcttattcgg ctttcgatcc taagaacatc aacctccttc     69060
     tttagctttt ccatcctttt caagccgtct aacaccgttc gacttttttg ctccttcata     69120
     gcaaagttct gcgtttccag tgcaatcatg ttctgcctca gtatcattat ttcccctgta     69180
     agtctcatgt tttcttgccg aagtcttccc agttccttcc ccagcctttc gtcatcttca     69240
     tcatcaccac taagcacttc tgatcctcca aaccccctca tttctatctt ctgtttgaaa     69300
     agattatctg cactccccgc ctatgcttaa gcttgccctt ggagaggctt tacttatagg     69360
     tagaacaaaa acaaggttat caagctctat cctatatgaa aactttacgg aaaacagctt     69420
     acaatcaaaa gtaaaacaat catgttcaac cctgagagga actgctttat agagacacat     69480
     gtccgagttg aattctttca ggagcctctc ctcgccattt gaaacctctc cgctgataaa     69540
     ttcagttacc tccagtatta ttcttgtttt cttggaattt ctcttatacc atatcatcat     69600
     cgtatcctct ttaacaagaa gctttccata ttcaactgta gcaacctctt cctcatcgtc     69660
     ctgaacagtg actttgtatc tgtcctcctc aacctcagaa ccctccatgg atacatagaa     69720
     gtatatgtct cccttacttt ccagtttgta cctctccaca acctctctca tgaatctagg     69780
     gaagtcttca agaaaatgca tctttcgtcc taccatctcc tcagttgttc catagtcttg     69840
     tccagccttg tttcttagaa agtcaacaat ctccccgaat gcagtatcat ccgtgtttcc     69900
     aaccctaatc atgtccgaat ggactattat gttttccatc ttcttcaaag gcttgaatcc     69960
     aaacggatgg acactaaaca tctttgttct tacttctctc gttactccat aatatacctc     70020
     gacaattatc gtgtaaacaa cctccaggct tctcagtttc atcgaaggaa gagcatctct     70080
     cggtatgata catctgtaaa cagtttccga gtcttctttc atcgaaagtt caacgggctc     70140
     agactccaga aatctaatct ccttcctgtc catcctcaca attcctgcaa tccttgctgc     70200
     caggaaatca ggtcttttgg atgtctcctt gcacttcctc cactttatgc atgatttgaa     70260
     cactcctcct gtataggcgt cacaaggcca tatttcaaaa tccatgctca gagaacaaca     70320
     gggattctaa agtcagtttt tacttcttcc tggataagat aggtaaagaa tcagatctaa     70380
     gtctttaatt aagtgcgtct ttggatcatc ttcttctgtc cagtttactc ctttcaaaag     70440
     gatcgtcgtc ggctgcattg aagattccac cgcctccaaa gaggccccct agccccttgt     70500
     catttctttc ctctgaatcc acatatccta tgcttggctt agccggctgc tgagaagacc     70560
     ctccctcaaa cagacctcca aatagacttt ttccatttcc aaatatgttc cccatagacc     70620
     ctgttagatc aatctgctgc tgcggcctag cttgttcttg tcctgtgctt ccgggtactg     70680
     gaaagctctg taagccagga attccactac tacccgaaag aaagatattt cctccttctc     70740
     caaaagaaaa gttagccccc gagtcttgta cggcttctcc atatcccccc aactttctct     70800
     taaggagcga agatcccggt gttggtgaat gcaattctac cgattcttgt cccatgccag     70860
     actgggccgg gaaagatccc cctccaaata caaaaggctt ggtctcaggt gccttaccat     70920
     ctgaagcaaa cggactggag atgttctcgt gatttacagt agaaggtgaa tcttgagccg     70980
     gaggaagtgg agctcccgag ttgaagagaa acatagatgt atctccttgc acatttggtg     71040
     tccttccatc ccagaatcca aacttcttcg gctcctcctc cactgcaggg ccttctttct     71100
     tttcattttc taaggattcg ttgatttccc ctccaaacac aaatggctct tgcatctgaa     71160
     cagcatcctc aacttttttt gcatcttcac tcatctcaac agcctcccta tcatcagatc     71220
     cattttcctt ggtctcggaa atgggctcta aaataaaata aggcttggat ggaagagatt     71280
     cagattcatt actggttttt ataccaacct cttttctgtc ttcctgtcca ctaccattta     71340
     ggacttgttc tggctctgct tctttatcat tcttctcacc atcatcttta atgcctccaa     71400
     tctccgtcac ctcatttcta ctctcatcaa aactagcctt tcggctctta atcttctcta     71460
     tatcaaacag ttgctccttc cttgcctcgc taagaactct cgtaagcttc tttctctcct     71520
     cgtcttctag atcatccata tcaaacttgt catcagtcac atatcttgcc actgcccttt     71580
     caactccaaa gtccttctca agatagaaat atgacttagg aactctcgac tcccatctgt     71640
     cttttgccat ctgccttctc ttctcagctc tttccctctc ctccttcctt ctctcgtttt     71700
     cctttctttc atattctttc cttatttcat actctacaca tcttttacag ttatactccc     71760
     ctccaaaatt acatcggact ttcctttcta caacttcgga gttcaatttc ttaatatttc     71820
     tttcgcagaa atattcttct tcctcatcgg tagacacctc ccctagttga aggaaaagat     71880
     tgtcctctgc atcatagcag attgcctttt caatcgtctc cataggcgtc ttcccctcta     71940
     ctctgtattt ctttggaaga actccccagc taacatcatt ctctttcttc agggcatact     72000
     tcttttgata tccccttttc cgatgcttct taggcttccc ttcgcccccc ttcgtatccc     72060
     cagcccccaa gtctcctttc cacttcgctc ctgcctttct ttccgatctt tctatctcca     72120
     ctctcttcag ctcctcaaat ccttcgtcta gtttctttct acatcctggc tccgatattg     72180
     ccttgcacaa ctcttttatt cgatcaagct cagaaacctc aataggcttt tcgctttcaa     72240
     atctagagca caactccttg tatgagttca gatccacctt cttcccaggc tggagtgcat     72300
     ctttaacgct gttccatgcc tccttgattc tctcgtaaaa ccctgccatc ctctctgggt     72360
     caacaataat tttttctcaa aaaagtactc ttgaagtcaa ctttatttca atctttacat     72420
     tcctttgcct cttcctttat gtatctcttc aatcgacaaa gactattaag gatctcgagg     72480
     tcgtttcctc caaatctttc attgtcttct ctacatctaa ggacatctgt cacacaactc     72540
     cttcttctgc atccaggaca tctgtcatca gacttcaaat gccttttgat gcacagatag     72600
     cagaaactct gcccacatcg ggtctcatgt ttaacagaaa tcttccaatg gcatatccca     72660
     cacaattcca taaagggctg ttctagatat atttaaatct catcccatca cctcctttcc     72720
     aattccttct ccatctttac atacttcaga atcctcctca tagctctctt gagaatccca     72780
     gatatccata aaatcgacat agaacactta agaccagaaa tctctcctat agttgcaatc     72840
     gtaaacagga cgtatttgca tgcaggtgca tcacatcgga tcactgctat ttgactatgc     72900
     ggtaagtatt caacaaccac cagattcccc accattgatg ctccatagct tccataatca     72960
     atcccaacct tcgacttaac aattgatccc aacatctccc ccagggccct gctttgatct     73020
     ccctcgtgcc gaagtcggat aactatatac cttgctttca cacgaatcat ctagggctag     73080
     aaaatccatt ctatcaaaca tttatcgtct tcatctcctc tttacaagca accagaaatg     73140
     tccctttcaa tcccagcccc cgcaggacgt catccacatc cgttggtggc tttatgtcca     73200
     tgggaaaaac tcctcgccaa atgctaaacc gtctgagaat ccatttgtct tcggaaatta     73260
     agataattgg aacacctggc ctacctagat agagtcgctc aacatcctcc atagaatctg     73320
     tacaaactac aattcctttt acgtaaggaa acattttgtg aaatcctaag tccttcttgg     73380
     tttcttgata atacgtctct gccttaatac aaatgttcct cataaacttg acagtctcaa     73440
     taggaaacat cccaacagcc gactctccgc tcagcatcac acagtcgcat ccctccagaa     73500
     ctgcatttcc aacatcagaa atctccgctc tgcttggtgt gtcccgggaa gtcatacttt     73560
     ccatcatctg tgttgcacag attgcaggct tcttccctct tttggtctcc aagagtatct     73620
     tcttctgcgc actaaatgtg tctaccagcc caacctctgc cccaagatcc ccccttgcaa     73680
     tcatcacccc gtccgagcac aagactattt cctccagatt cttcattcct aggcacgact     73740
     ctatcttcga aaccacagga atcctattcc ccacaacctt tcttatctcc tcaacatcct     73800
     tcttggaatt cacaaaagac gcaaaaatca tgtctattcc attctccaga ccaaaaacaa     73860
     tgtcactcct gtcttcatca ctcaaaaact taatccctac atctatgtta ggaaagttca     73920
     tggacttgtt gctcctgatt atcccactgc tcagcacctc gcatccaaat ccatcttctt     73980
     ctacatcgac tacttttaga tctattcttc catcatcgac cgatatccta tcccccattc     74040
     ccaaggacct aaagtcaatc caaggtatcc atatgctctt tccagaggag accgatgaaa     74100
     atcggagaat gtctcctcca ttaacctcga tattcttatc tcctggtgtc ctaatcctta     74160
     tctcaggacc ccttgtatct aatgctattg aaacatacct ccccaagcta cagatggcat     74220
     cctttatgtt cctaataacc tccagatgct cttctcttga tccatggctg aagttgagtc     74280
     tcgcaacaga catacccgca tcaatcaggt ctttgatctt ctcctttgag gacgaagaag     74340
     gcccaatggt acatactatt tttgtcaatg aagccttcat agatgaatgg gacaaatcct     74400
     ttccaaattt atcaatcttg ttttgagata catgataggt tctttggaga taggggccga     74460
     tccagagtat ggacataatc caatgcttct ccctttgaag gaatgaagac tgttgctgtt     74520
     gtaatgaaat ctttggatga ggaaatccca ttgtctaaga actctgttgg ggatggattc     74580
     ctaggatcag caaagcatgt tgtaatgata tttatagaga agaacaagat gtttctcttc     74640
     aatgatcctc acttgatgct tgagtcggaa aagaccctga ggatggaaca gaagctccat     74700
     agaaaggctg ttgttgaaca tctggaaaag gctgctcagg ctgtgaagaa gttaaacttc     74760
     aaggccgaag tatcgaagtt ggtgattaat ggagatgaga aatacaaaat agaaaaatgc     74820
     ctggcatgtc tggaggtcca agcagtgatg ttcatcggta gacataagaa aaaaaggttt     74880
     tatgaatgct ttgtccaatc gttggaggac tatgtgtttg aggctatgaa gattcctatt     74940
     atcaagatac cagcttctaa gcatcggtct tgaagcattt gaaccataga tttacttaaa     75000
     aataaattac aacctaatag atccaaggat tcttttgcac atcaatgctg tgatgagttt     75060
     acacccacaa atgcatccaa ctgcgatttc attccgtact agacatatct ctgagatcac     75120
     aattgagttg gatgctatgc ataggaactc tattacaaga agatattctt cccattggta     75180
     cttccacatt atcatgatga atataaatag atagtagaag cttgaaagaa ggagtgaact     75240
     ggataacttt agaaatcgaa catgcctatg gaacacagtg aatgccagca ccagaaggag     75300
     aacagtttcc acaagactct ctagggcatc tctgcagatg gtggctatgg ttgcaatcaa     75360
     attcactttc ccggaactct ctccaaagaa gagaatccta agggccccat ggtggtgaag     75420
     tataggtcct gtaagcacct tggcgattag cataaacaag gcgcttctgg tgagatcctt     75480
     tttgttattg aagagatagt gtctgaagat cctcctcttc agcaagagaa gatctacaag     75540
     cttcatcaaa ctattcagct caaagtatct gtccatcttc ttggaacata gttggcacct     75600
     cgagatctgc ttggcagagg agttcttgag aaacagatgc tttgctctat ttccacattc     75660
     tatgcataca tacattagag attccttagg gctctagaat gttttcagga caagatgaag     75720
     ttttatggat cccaagaccc ctaggaatgg ctgttgcata tatattcgac gaggaggttg     75780
     gaatgttcca ttacgggcct aggcatccca tgaagccgtt tagaatggtg gttacacact     75840
     ctctagtgaa gtcgtttggc cttgacaaaa agatgacgat agtcaaaccg gcactctttc     75900
     ctctgacata tcacccaaag gagtatcttg agaatctcgg gaagaatgaa acaccggact     75960
     gcccaaactt cattggcctt tctagattct gcgagctgta tggaagtgcc tctataaact     76020
     cggcaatgat cctctctgaa ggaagatatg acacagttat taattggagc ggaggtctcc     76080
     atcatgcaca taaagcggtt cccagcggat tctgccatgt aaatgatatt gtgatggcga     76140
     ttctggagct tctcaagaca tatcagagag ttatgtatat agatatagat gttcaccatg     76200
     gagatggagt ggaggaagcc tttttggaat gtgatcgagt gctgacactt tccttccaca     76260
     agtacggaga cggcttcttt cccgagacag gaactctggt cacaacagga cacagggctg     76320
     tgaatgttcc tctcctatca ggaattgatg atgcaagtta cagatacatt ttcgagccta     76380
     ttgtggagtc ttgtgttaag aagttctctc cagatgcaat tgtcctgcag tgcggagcag     76440
     actccttggg tgaggacagg ctaggatgtt ttaatctctc tatagagggc catgcatctt     76500
     gtgtccggtt tgtgagttct ctcggaattc ctctgctctg tctaggaggt ggaggataca     76560
     ccctgacgaa tgttgcccga tgttgggcat atgagacagc tgttttgtgt ggagaggatc     76620
     cgattacgga tattcctgca gacaatccct tctacacgta tttcagtccg tcgtatgtgg     76680
     ttaatcctgt gttcaaaagg aagtatgtca atagaaacga tagggagtac ttggacatgg     76740
     ttatgagttt cattcttgac aaagtagaca agttttaaga ggtccttgaa attatagaac     76800
     aagcgatttt ggagaataaa ttttttgccc attcatgcca gtagagaagc ttgagaagat     76860
     caagtcgcag gttgagtttt actttagtga tgcaaacttc cgggtagaca agttcctccg     76920
     ggagcaatcc ctggtaaacg acggctatat tccgatcaaa acgattgtct cgttcaacaa     76980
     gcttcggaat cttgaagcaa cggttgaaga tgttaagaag gcccttgaag acagcaaagt     77040
     ggttgagctc aaggacgata tgataaagaa ggttgagacg gaggagtatc tctcgtatgt     77100
     tatggagaag gacataaaca agagggtagt gtacatcgat gggtttgaga aggatgcaac     77160
     tcttgaggac atcaaagaaa tattatcgcc acatattatt ccggttctta ttaggatgag     77220
     gagagacaag gggaagaact tcagcggaag cgtgtttgca gagctgaaat ctgaggaaga     77280
     ggcccaaaag gccttggagg agaagattcc agttaagaag caagcggagg acgaagagag     77340
     gtccaagaag cagaaaagcg aggagaaata tcttttaatt atggcaaagg acgaatatct     77400
     caaggagaag gagaagatat ctggagagaa gaaggagata gaagcaagaa aagcccttga     77460
     aaaggagttt gtacccaagc tatttaaata cgagtgtagc gaggatcttg acattaagac     77520
     tgtgaaaagt ctagtcaaga acaccgcttt tgtggataca aagcagaagg tgataaggat     77580
     gaagcatgca gaggatttca aggaaaagaa gtttgaggag gaaggaaaaa gcctgaccct     77640
     cgtcaagatg gaagaagatg aagcccttga gtactgtaag agcatcaaga ttgcacccaa     77700
     gggatcgaaa cccggaaaga aataaaggat ttatttacat ccggctttta ttgataattg     77760
     tttaattgga acccatgacg aagtacaatg ttacattgag agtctatccc cttggggacg     77820
     aaacactcaa gaggtttgtt gcctcagcgt tgaaacggga ggaggtccat atctggcaca     77880
     catccatcga ggtttatgga atagaatact tcttccagaa tggaatagtg aaggcggttc     77940
     cgggatctac ttcccatgga actcctttga agacccatga tctaggaacc acagagattc     78000
     cagagattgt gtttgaagac tttcttcttt ctataacaga ggattttgct cctcacaaat     78060
     atcatctact tagaaacaac tgcaacaact tcacaaatat agtggctttg tatctggttg     78120
     agaaaagcat cccggaatat attcttgagc tccaaaatac tgcattggag tctgaggctg     78180
     tgtcgtccct ggttgatatg ttttttggat ctcccgggaa gatataaggc tagatctctc     78240
     cttcctcctt ctcctcccaa accacttcga agtacttatc cactgctctt ttgtctattt     78300
     ggctgatctc ctctgtcctt tccttctcgt atcttttcaa cttgttttcc agatcgttga     78360
     caaactcaaa gtatacctcc ttgggactct ccatactccc cagaagattc cagaacggct     78420
     ctgagttctt gaataaataa aatgcatcct tgaacttcat cttgtagtag atcagccctc     78480
     tactatacag actgttcaga acttgcctaa actcctctct gtaatggggg attttctcgg     78540
     ccattgatgt ttttttcttc tcgatatcca acagaaactc tctttcaagt ctacggaagt     78600
     accgaataaa cgaaaataga accacctttc tatcaaatcc ctccatttcc ttcatcttaa     78660
     ggacgtcgct tgccgagctg ttcagatcaa ttccacaggc tcggaatatc tcttccaact     78720
     tccctgctgt cgtacccccc atatgcttct caatatacac ctcatagcat ccaaacttgt     78780
     ccttgatcct ggaatagtat ggatgtctcg aaaatacact gttgaaacca aagaaatcag     78840
     acactccgac gtcgaccttg caaacctcgt ctacataata tttctgcctt tggacttcct     78900
     cctccctgtt attttcctcc ttatcttcaa agtatttcct caccagggac tctcgaacgt     78960
     ccattcttat cgcccggaat ataggctctg tagacagctt ataaaataca tctttcatgt     79020
     tttctacctt gtactgctcc attagcctgt acagtagata cttagatgtt tcgtggtctg     79080
     ttatcctcat gttcatccct attcctttta tcagcgtctt tccttttctc ttttctccag     79140
     gcctctccca tctgctttcc ttcgtgatag tgttatgata aaagactttt ccttgcctgc     79200
     ttctacactc aatccatgga tccacgtcga agtcttcgtc cgaatcttta agtacatcgg     79260
     gtttgcgaaa actgcttttc cccgtcttct tgttgtagta gtatgtcttg ccgtcgggcg     79320
     caactagtac ttcatagtcc acttttgcat ctttggcctc catttcagtt agggttctct     79380
     taagaagaaa gcatattttg tttatacaca ggcattctct cttcattaag aatacattat     79440
     ttattactgt tcctattctt cgatctcgca ttcagctcat tgcaattata gcaatagaac     79500
     tcgttgagat cgtattcgct cggatgaacc aagccgttgt gatgattgca tctcttacaa     79560
     atcaacgcat acatagtact tggatcgtcc cccagtacaa tgtccgtgac actgtccatc     79620
     atcccccttc ttctttgctt aatgcttcca aagtaatgcc ttctcatcga ctcgctctcg     79680
     tacttgtcaa taactttctt tgtcgcttca aaggactcct cttttttcaa aagggcaatt     79740
     tgctccttct gtatctcttt tagagcttca acactagact ccagtctttg gattcggatc     79800
     tcatacaaat agatcaaaac acacctcact atatagcatc caagtgcact tcccactcca     79860
     aacagcacca tgttctgatc atcggcatac gagtaagcca tagaaagaac aatgaccaca     79920
     catgacgcca gaaacatctt tattctaaga ctgttcagag ccccagaaag gtccttggct     79980
     gctttctctt tcttgcttat ctgctcttca agccttacca agctttctcg cagcggaacg     80040
     tttcttgaga gcacattccc cattcagagg ggtatcccgc gagactttga gtctaacaaa     80100
     ctaaatttta atattcctca acaacatcaa acacttcctc cttcttgatt tggaccgagt     80160
     ccaagggata aaccaatgtg tctgtgtttt cacacactcc aaccctcttg tagttccgaa     80220
     gaaactcgac tccagagtag tcgatcacac acacatcgat gttggatcca gagtacagat     80280
     cgttgaggat cccagcctga acagcatcac atgcgagctc aatggcctca ttcttatcca     80340
     tggccctgta cttgctttcg agaaccccaa tggctgcaag agacccagat cctagagatg     80400
     tgaataatgt agagtttgac gatccatggg gatgaatatc caaaagatgg catccctcag     80460
     agtctatccc tccaacaatt agagctgctc ctatttgccc tccgtattta tgcaggtggt     80520
     tcacacacac ctttcggaaa tgagatacaa gaggtgctcg gaaatacttt ctttcaaaga     80580
     gtcggagctc ccgtgatgcc attctcgcca ccctttctgc atctgctgca gtccctgctc     80640
     cacagcacat aatcttgtct gaaatcctgt gaatcttttc acagttctta tccgagacca     80700
     caggcccctg tgtagatcgt gtgtctgctg caagtatgac tcccgtcttg tacttcatcc     80760
     ctacaattgt tgttcctgtt tttgttatca tccggggttg cctatactca atattaatca     80820
     ggcctttgca tcttccacta gcaaataaca aagaggtgca caaatattaa aatcgatttt     80880
     catccctgct tatggttttc aaggagatta ccatatcgct tgcatatgtg gcccagataa     80940
     ccattcttct ttctctggac gtcttatttc ttctctttac ggtccaaaga tccctctact     81000
     tctttgggaa gggaatgaaa agaaagcctg acgccatacg agtccgattg attcctaaga     81060
     gccagagcga tctttatctt atagacggaa tttctggaat cgatctcatc tatcttcctg     81120
     gaaactttgt agctgtggag gagcatatag agttctgcaa atatctatcc aagatcttcg     81180
     agtgcaatgt gatttccatg gtgtatagag gagtggcagg gaacggatat tctccatctg     81240
     agaagggcat agtggaagat ctatctccag cctctagatg gctttcaaga aggagtactc     81300
     ggaaagttat cctggggttt tctataggat cagccgtagg aatccgtttg gcagaaaaat     81360
     gtcgtgttga tgctctagtt cttataaacc cgtttatatc actaagggag gtggttggga     81420
     atgtctcctt tggtaggatt ctgaagcacc tcgtgattga tgagtggaac aacctaaacc     81480
     gaatgaagaa catcaatgtg cctgtctatt ttgttgtttc ctccaatgac gaaatagttt     81540
     ctccatccca tacggacgag cttatcaaaa gaacaaagca tccaaagaag attgtgattc     81600
     gcaatgccga tcacaacgag cccatgcgga atttcacaac acatttatgc tctctaatgg     81660
     atgaggtact aagaaaaaca ccatcgggtg gatgaggaat atggatttta ttacctgctt     81720
     gctttaatgg ggatgagaac aatgaattac agcagcactg gttagataac ctgccagaag     81780
     ggtcagtatc ccatggatcc tgtttacctt tggatggttg aacatcggtg gaatcatttc     81840
     aatagacacc atgaacatta tgcttcccag agcaagtcct ttgaagatac ctctgatagt     81900
     ctggttgaag aacccaggag cagagcctat catgatcccg atgggtgtga gggacgagta     81960
     gaacacagcg agaatcaagc cgcttgaaaa gttaaatcct gaagtgaaca agggaactcc     82020
     aagggcaaag gactcaagga ttttgtgtag aatgagcccc atctccatcg agcctatctt     82080
     gtcaatagag ttgaatgcca gtccctcgaa gaacgaatgg atggaaattc ctagtatgta     82140
     tataaatact tgtgtcttcg aagatgtatt ctttatagct tcactaggat cgcaacatcc     82200
     tagtctctcc ccctcttttt tggagtcatg ggcactcgag gcttttgcag aaatttgagg     82260
     agacttgatg ttttttttcg catctactac gtgatggata tcttttccat ggcacccgcc     82320
     cccatgggca tgttccttct tttcattttc ctcacagtgc ttgtgtttta aaacaataga     82380
     gtcaatggcc aaaagaaaga taaaggaaag gccggcagtg aagaatccaa gaatgggaga     82440
     ctcatgggaa tggtggccat ggttgtggtc atgttctttg cctccatggc agtcggagac     82500
     catgtgtgga ctcagctcca gaagctgaac accaagaaga aatcctgctg ttagaagagt     82560
     cagaaaaggg aatatcctct tgactacttt tagagaagta atgacttttg gactcaagca     82620
     aataattagt gacgacgaga acaccattgc tgcaaacaac actacttgtg aattcatttt     82680
     tgaagggtgg taaaatgttt gatattgaat atagcctaaa acataattca gctgcatgtc     82740
     tttgctatct cctttcctat ggagttctta tctcttattc ccaacttcac tatcctcttc     82800
     agattctcag aaatgccatt gtttccacat agaactgcat ctgctatata ttcatacaca     82860
     tccctccggg aaattcctag tccctcaata tacccaagga acatggaaac cacatctcta     82920
     ctatctccaa gaagatcgat agataagcaa tatcccttgt ccttcatctt gaagtgtctt     82980
     tctctcatct tggccttctt gatgtctttt ctatgcttta catattctct ctcgattaga     83040
     gccctctcct ctctatcaaa aggcagcatc tgggtaggag ggctttggag ccagatgatg     83100
     cttgccattt cctgcagatg gatataaaaa taaaaaaatg atagagtttc catgggtgtt     83160
     ccctcactat ttaggtggct acaactctcc catagggagg cagtgcacag catcatggaa     83220
     aagccatctg tagactgtct gtatctcgac tttaatgcaa taatccatac atgcatcaag     83280
     cccgggttgg ggtctgagga agagatcgaa agagatctgt ataagaccgt gggagacttc     83340
     attgactaca tcctcctcag aacgcggcct aggaagcttc tatacatagc aatcgatggg     83400
     gtggctcccc gagcaaagct gagccaccaa cgggcacgca gatacaagtc tgcccttggg     83460
     aagaaagaag ggaaggctcc tgtgtctact gggaagacag atcctacagc gtcgtcaata     83520
     agcgagaaga ctgaggaggc caccgatgtg gagttcacag gagaaagctc cctatacgac     83580
     aaattcattg cagaagatct ttctgagtcc tcctctcttg ccatggatgt ggaggccgag     83640
     aaattcgatt tgaattgcat tactcccgga acacctttta tggaaagact ccataatgtt     83700
     ctgatttcct atatccaata caagctcagc aaagacccag aggtttccca tctgagaata     83760
     atatactcca gttacctggt tcctggagaa ggggagcaga agatcatgag cttcataaga     83820
     aaccaaattc cagctgcaaa gaacgatgtt cacatgattt actcgcctga tggagatctg     83880
     atctttcttg ggctctctct ttacaaaagc agggtgttga taatgaggga ctacttcagt     83940
     ccaagcaaag cacgcaagaa aaagatctgc acaaaatgcg ggcggacagg acattcaaat     84000
     gatgaatgtg gagtgtttga caactaccac tttgtgtatg ttaacattgc ggagcttaga     84060
     tcaagactta tcagggagtt cagaaaacac acgacacaga gattcaacga ggaaagactt     84120
     ctaagcgact ggatattcct ttgctttctg cttggaaatg attttgtgcc atcgatcccg     84180
     tgcctcgaca taagattcca ttccatcgat actttaacag agattatgat gaaaaacttt     84240
     tcggagacga agtcatacat cacctgcaat acatccatca actaccaagt gcttcggaac     84300
     ttctacacta ttcttgctcg caaggaagac ggtctttacc accggaagtc acagtctctg     84360
     gacagactta gagaggagtt gaaggacatg ccgaacatta tctatgagaa gattccaatt     84420
     catacaaaaa caggaaaaat tcaatattac acctcgaagc tgaatgccaa aacagactct     84480
     gacatcaaga acatatgtta tgaatacatc aaggcactct actgggtata ttcatactat     84540
     attcttggat acaccggatg ggactggtat tatccacacc attttgcacc tcttgcagca     84600
     gatctgtcga agctttccat cagtgagatc cgaatcaact ctgggcttcc cttgaggcct     84660
     ctagagcagc ttttggttgt cctcccgcca atgagtaagg gaatggttcc ccgagagctt     84720
     caaccgatat tcaacaacta caaggactac tatccagaag atgtagaaac cgacatgttt     84780
     gataaggttt atctgtggca agaagttgtt cttcttccgt tcatggactt ccgaagtatt     84840
     ttgtccgaaa atgcttcaag attcaactcc cttggatatg aggatttaag cagaaaccta     84900
     agaagtttag atctgttctt cacagttgac aagaagtcta cagagaccat cttgaacatg     84960
     tactcggagc tcaagccaat gtgttttatc aaagaccctg gatacaccgg aaatctctcc     85020
     ccttattcat ctgcaagctt ccctggagac atggctgagt acaacggtac tcaattcgtt     85080
     aacagaacca ttgcgggctt gatagagccg aagaagaatt aaataccgcc tctgagtttt     85140
     taatcgaaat ccttcatatc aaatctcacc acttccagct ctcttgttcc tgtgtccaga     85200
     acaaccactt catgtctctt ggaaaacttt gggattgtaa aaaacaatgt ggagttatct     85260
     tcggattgcc catcaagaaa ctcgtcggtg cctcctacac agaaatagtc gattggatcc     85320
     gccacaacaa ataggtcttt tcctgagaaa ggcaccgatg gcacagtatc aggggctgtt     85380
     ggacagacat ggcccgcttt cattagcact ctcattgcat ttataatgtt cctttcactg     85440
     ttcatacttt ttggccttat atcttctatc ttctccatgt ccagatgcat tttgtattca     85500
     aaggcctctc cctggacatc cttcaggtcc tgggggagat atcttagaat atcttcaatc     85560
     acaaatcttg ttgtggttag tacctttctt ccatctatgt ccaaccggca gggatttgcg     85620
     tgagaagcca cagcaaatgt aaacagcttt ggatggacag gcatcaaagg tagaattttc     85680
     gatccaaagt ctcctgtgtt tggaacaaga ttaatctttg ccttggcata tcccagaaca     85740
     tcatccagct cagaaagcat ctgtctactg acttccttgc tctccccaaa aaaacttcca     85800
     atgacaacat attcgctcac cccaacgatt ctcaggtagt cgcatagaac catcattctt     85860
     tctttgtttt tacttccatc gtctagagaa agtccgctta tgaagcagag ccttttgcct     85920
     ggccttactt cgctaaaacc caaaggaagg ctccggggat tcgaaaacgg gaaaataatg     85980
     tcctctgcaa ggaattttcc cttttttgct ctccttcctt ggactccgac acacatcccg     86040
     gtgcataaca caaaatgctt ccggtatata tccccgacat cgaggaactc aagctctatt     86100
     ctcccactcc cgtcttctaa gagatatttt atgtcctctg tgtagtatgt cttcgtttcc     86160
     acctctttga gcttcttgga ttttctgtcg atcttgtcga atatcgaagg cttcaagtcg     86220
     ctggccacaa aaagagtccc gacaatcaca catgttgagg tatccaactc ctcctcaacc     86280
     ccaagaatcg tgtccaatat aggaaccccg ttctgggccc ttacagacct tataatataa     86340
     ggctttaact ctgcaagcct tgcatcatat gttctgttga attggtgctc gtagctcacc     86400
     gatgccagat catccataag agaaacaggg gttaaagagg tctcgtccca tggaaagtaa     86460
     atagtttatt gaagtgttga ggccatgagg gtttataata gagaaggcct atctccggaa     86520
     atgtatatag aactcatgga tactcccggc aacctcctct aatatcggca ggtcaaaggg     86580
     aaaaaagtat aggcagtcgt ggtcgtggct ggaaaactct ttgcattcgt aatcaaacag     86640
     ctcacaaaac atctcaacca cattcttgtt catatatctc gccattccag aactgaagat     86700
     ccgttctatg atgtcctttg catctgctac agactctctt ctgaagcaag agatatacaa     86760
     aagacattga tgagctgcaa ccgattggat cgaaagagac tttccatacg atcggacata     86820
     ggcctgatag tcttggacat acattgcctt aagaccctcg tccactttgc acctcacaat     86880
     taaagatgat agatagggaa gaaacgcaat tggatttttg cggactagtt cgagcagaaa     86940
     cccaaagact gcttgtggat ttcgatggca tagcttgaag aggaggaact ggatgttccg     87000
     tgtccttgag agcatcgaag tctcaaaggc cttgaacacc tcgtcgatct tgaagtcgta     87060
     tatagcattg tctagattct catatgcaaa tagaaacagc ttgatcttct ctctgagctt     87120
     tgcatggcct ccctctatag gtgtgtcgta gtcggaaacc acctcgtccc attcatcctg     87180
     cgtcagtatc ccatgcatca cactgatgta ggcatcaaga ttcgtaagtt cccgtacaag     87240
     actctgaatg gtaggtctca tcaatgttct atcatgtgcg tagagtacca ttctgtctgc     87300
     aacagacaga tcaataggcg ccttcctcaa gctctccagg aattccaatc tttctttata     87360
     agttaacgcc atggggatca atttttttac agtttaatgc aaaagttcga atctacaaga     87420
     ctaaagatat ttatttggta ttattttaaa gacatcttat ctcttcccgg tgggggccct     87480
     gatttccact cctcctcaag cctcttgtag tacttcttgt gttcctccaa gttcgagagg     87540
     gcttgattgt ataggaatct gaagtcttca aacactaggg aaaacgagtc tgccagagga     87600
     atcgatatct tctccaacag attgacatct tcagatatgt cttgaagggt tctacgataa     87660
     ttatcatcgt cgtacatctc cgaccagaat gcaatcgagt tcttgttgaa gattctgtag     87720
     tccttgtagc acgatccaag atcggctatc ttcacgatca ttttgagctc gatctccgat     87780
     atttctccag ccgccttgtt ccttatcttt ctccctttcc tttcctcaaa gtatttagta     87840
     ttgaactcct cgattatctc tttgttcatc ttcaagtccg ttgcaaatat catttctttg     87900
     atgaagttca atttttccct catctcttca tcctccaggt ctccaaacag tgcatgccta     87960
     tacttgctga taatcctttt gcatatagtt gcatggatca gttcaaagga cattgtttca     88020
     tcagagttcc cgtacaggct cgacagtctt tcgatctttt ctcggttttt ctctccagga     88080
     tgccctatat cgtgtagtac aagcgctatc atcaagcaca tcttatccat tatcggtaaa     88140
     gagtatttct tctccagtct ttgaagaata aagtccccaa aatatagtgt gtttatcaaa     88200
     tgatcaaggt tgtggtactt atggggaagc atatgaaaaa atgaaaatga aaaaaaggag     88260
     tccaatgtct ccggactcac cccaagaaga ctaaacctag aatctctcag aatcgttttt     88320
     atagctgccg atattccatc ggcaagagat atttcttcta ggtgaaagaa cctgtaagaa     88380
     aataaattca ttggaaggtc ttccatcgac ttggagccaa agtcctttct atcttgaaca     88440
     gttcttatta ttacatcgaa tgcatcctta gatatctctt tatcttgatt cattcccgtt     88500
     tggatttcta ccaagggtcg atatacaaag tatttcttta ttctatgcct tttgatacgg     88560
     ttttttcttt aatttaatat taaaaaattt attcgttaac aataaccata tcttcaggta     88620
     atatcatgta gccgaaaagt taaaattttc tctttcattt tctataacag aaattcccag     88680
     attgtttttg aatgcctgga ctgcgatgat ataatgaggt gtcttgagat cgacctttag     88740
     agaaaggttt cctgttatga ggtcgaagac cttttccttt gtatctgggt ggcacattct     88800
     tccctcatac atgattttat agctcttgtt ttcatcaagc cctctaatgc tttccagaac     88860
     tttcccttca tcaaaccgga agaattcttc cagaggcctt atagggagta catattcaaa     88920
     tctcgtttct gattcccgaa gcttggaaaa tagtgctgaa gacgactcac tacttcggtt     88980
     ctctaggaac agaatacatc tgtatccatc gtgtttgcga aactttgttg agcttttata     89040
     ttcttcaatt tcctcttcaa gaatctttcg aatgcttttt cctgcagtat ctttctttgg     89100
     ggtctcaatc agcccctcta gctttccaac cacttctttt agtcctttgg tctctttgtt     89160
     cagacggcag gagacaaaga agccagttct catggggtga tggcgtgata tctcttacag     89220
     ccttgccccg gagatctaaa tggaaggaaa atccgacgtg gaaatcatag aggagtacac     89280
     cgagcttctt ggaagccatg aaagcctgta cagaagaaag acattgcttg caggtgttga     89340
     agaaagagat ctgtcctact tcaacttcat tggacagaac aaatgtagga aaacagttgt     89400
     agggttgttt ggttttggag gagcaggaaa aacatccttg gttaagctgc ttggaagcag     89460
     aagtaccatc caggccactc gtgagtgtct atctacagag accccttatg aggccgagag     89520
     aagatgcacg atccatgtcc atccgaccac tgttttcttg caaagaaaaa acggtatttc     89580
     acacataatg acacttttag acacacccgg acatgcggat ctgattccag agaccatcaa     89640
     gacattagaa caggtagata cagttgttat ggttcttgac atctgtagag atttatctct     89700
     ccagtacgaa ctactttttg gtgctattga agcaagtaaa aaacctttga ttgtggtatt     89760
     caacaagatg gacctcattg gaaaagaagg cattgcagtt gcagctagca ggataaaata     89820
     tcttcgagat attattgaag catacttaaa tcccagatgc tggtttgtaa gctctttcaa     89880
     ggagtccaag ctcagtaaac tggatacaac cataggcaga ttaattgaag agtatgtaga     89940
     tgacttcgat tcatttatag aaagaattat cagtaaggag ccaataacac atggcgatag     90000
     agacaagatg gaatgtctaa ctgggtttct atgggttggg ggagtattat tgtgcagcct     90060
     tgtgcctaaa accgacatcg gtgtaggatt ccaagttgaa gtgtatggta ctaccctgac     90120
     aattgaaaga ctctatcttc catttccagg atgtcttgtg aaaacccaac aaattcaaag     90180
     caagattgga gtattggcaa agttcccaga ggacatgcta caaaaggttg tgatcccggg     90240
     attccaaagg gacccgagat tgatgaagga ggttcttaaa agaaaaggag tggaatatgg     90300
     taatccagag tttcttgaag tagaagatcc cctggttcga gtccaggtga gtcctgataa     90360
     tgaagatcac ttctcattgg ggacttggaa gttaaggtta atgtatccaa gtctgaagat     90420
     cgacggaaag attctgtatg gagacgggga gttgtttatg gatacagtgc tgtatgactt     90480
     aaggaatagc ctaggcataa agtttgaggt tctaagtgtt tcttcaaatc ttaaggaaat     90540
     ctttggagtc tcgtttacag aggaagtgga tacaggaaga ggcctggtag ttgtcaaggg     90600
     aggccctacc agaactatgg gcaaaatcca tgactttgga gcagtagaga aacggatact     90660
     ggacagggga cttctggcca aagatccctt tgtacattca tatttagaag tatctcctgt     90720
     gagcgaagaa gtggagttgg aatgtcttaa aaggttggag aattctgtga tcggacatgt     90780
     ctcacttcta gagcctctat atctagtcga aatagtatat acttcagact ccgaggattt     90840
     ggtcaatgaa gtgatcacct cttcctttgg agaaatcatc tcccgaaagc cttctccctt     90900
     caacgaactc aaaaacatcc tgtgctacat ccctgttcca gagtcgtttg ggtttgagac     90960
     cgaccttagg gtctattcct gctcaagagc agactgcgtc aagataccct tttattggcg     91020
     tcctgtggca gacaaagaca ggactcaccg tctagctaga ttcataagaa aagccaaaag     91080
     gcccgagcca tagaatatta ggccgcagac atcctttatt aatgaagagt tactttttca     91140
     ttccactttc caatactgca gccctgtagc tttcatatat ttctcctgca gtgtgatcaa     91200
     tgagtccata gatatgggta ctgagaagca gctccctcaa tgcaggaagg tcgcaatgct     91260
     ccgggttgtc tatactcacc tttccccact gatagtttct agcccgtgag tcgaggtttt     91320
     ctccatctgc agaaatgatc agaaacggaa caaggctgtt tagatcattt cctgctgtcg     91380
     gggaggaata gagctcggga tcatccaggt taaatgtagg gatcttgtag tattttagct     91440
     gtcttatgac ctgcttcttg atctcaattc tctcagaaat actcagcccg tcggctttac     91500
     tgatcacagg gataatgtta accaaccccg agatcttctt cagaaacaca atgtctctgt     91560
     tcttaagccc aaaagatgtt gaaggtatga aatacaggag gcaatggact cttgtgtctt     91620
     cgtacttggg atttctccgg atcttggatt cctctgttat gaacatgtct agctgagctt     91680
     tgataaagtt acagattgtc tcctggatct ctgtatcgtc aaaggtttct ccaaaccctg     91740
     gcgtgtctat cagggtgatt ctttgcatga ttccttcgca gtccaggtta agcatataga     91800
     gatcgatccc ttcttggcct ttcgatgtga taatctcttt ccctatcaga gtgttgaaga     91860
     acgatgactt tccagatccc ttcggcccgg ctgccatgat cgtgaatctt ctgttctgtc     91920
     tccgaataat catttgtttg tttattagcc taaagattta ataacaaaag ccggaacttt     91980
     tggtctctat cattctaggc aaggtgaaaa gaagtctttg aagcacttgc taatagcatg     92040
     gcaagcatcc actccttcaa gaatcgagga ttggagcctc tcctgcacaa tccttccgtt     92100
     cagagataag taagcaatat tctttttgtt cattagatat gcaacagtaa caacaggagt     92160
     cttcaggctt tcctcagtag acgtaaggtc aatacaaccc tccgaaacag tggctgaata     92220
     gcacatatcc ctcagaggga ttccaaagta tgacaagcac aaagttatgc aattaatcat     92280
     tgcagaaaga agagatcccc catcttcccg gacaataact ttgatgtctg ccgatccttc     92340
     aggaagcagg acgctactga agatgtccag taaaagcccc tcatattcca gtgctcttct     92400
     ctcgttgata ggctcttgtc ttgagaccac gtagaactca accccaatgc ttatcttccc     92460
     aacctctcga gaacctctac atgcagcaga cacctgggta tttccctgtc ttatctccac     92520
     aatcccttcg tctccaacca ttcttctcct tgcctcgacc cttcttaact ccttgggctt     92580
     tcttccatct tctcggaatc cctgttcaga gactagcatg gcaccaggac cgaaacaatt     92640
     ttgcataaaa tagccttttg gagctgaaaa aagattcgct ggggaaatcc tctaaaacac     92700
     aatgggccct gagtatgcac aatgtaagga tttacttaat tccaagaacg ttcgggatat     92760
     tgtaaacata tcgaggctgc ttggaatgcc acagaaggcc acatacttta ccctggcaat     92820
     ttattacaaa tatatcttca tgctcaagga cagagaggcc attccaatag gtgcagcatg     92880
     catattacta tctggaaagg taaatggatc actgagaagc cttgggcaga ttctaaggac     92940
     aagctacaaa tactatggaa tggatccaga aaggtttttt caggaagact acaaggatgc     93000
     aatcgacatt gaacttcatg cttgtattgc aatggacttt aacttcgaga tggaggatcc     93060
     ttatggattt ctggagaaga tgtgcatgga caacgacatt gacaggtcaa gggcgcaaac     93120
     tatatgggtt atgctgaacg atacaatgta tctacccttc gtactgtcgt tcagcataaa     93180
     aagcattgtt gtaagctgta tatttatttc agacattgtc aggggcaatg gagaagagga     93240
     catcaatgga ttcaaagaca agtacaagct cgctgaaatt gatagtgcag aaatcgggtt     93300
     tatttccaac gagattgtat cgttctatga gcgtgtattg aaatagacag acatccacat     93360
     cgaaagattg gcttctgaat gatgttatga catggtattt ttgcaacatt catccaccca     93420
     ggctgaatac acatcgatgc ctgtggtaag cttgtttgct tcgcaggtga agcttgcgtc     93480
     acacacagag caatttgcaa atcctttcat caatggcctc ttgactgtac attggacaac     93540
     gttttcatgg ttgcagaccg gacagttgaa tctcttttcg agtttggact gcctttttgg     93600
     ggcgttaatc tttctcttta cccttttcct actcataagg ggatctttga agctaaatta     93660
     acatatctct tggatacatg agggtgggat ttccaaccca gaaatggaca tactggatgc     93720
     tgaggaaagt gatgttgatt taatcgagct tcaaggagag gttgagaata tggaggcctt     93780
     tgatgggagg ctcaacaagg agcttgttca gcttgagttt ggaacatgtg ttcttcacgg     93840
     aagaaagatt gacaaagagt ttaatatcat tgagacagac gtctgcaacg gaaggccttg     93900
     tttaaaagtc ataaagaagg ttaaatgtgt atatttattt gataagcctc ctaggtatag     93960
     aagctcaggc ctagggcgtg gaaactaagc atccgtgttg cacacaatgc atttttcgtc     94020
     tctgtctaaa atcagctttt ccaaagtaat attcttctcc ccgctgtaga atatgaagtc     94080
     gtagtgcagg tttgttgcat ctatcaaccc gcatgccaag cttgcacaca cagagttaat     94140
     aaaacacaca ttcggaatta tctcgtcaaa catcccaaca acatcaaatg catttacttt     94200
     cagattctcc tctgcaagag cattgaattc attgattatt ttcttgatct tttcctccct     94260
     acttcccggc tcctctctcc tgagctctac caaggaccgg agtgttttct ctctgttttc     94320
     cggtgttatc ttctttggca gagatcccaa agaacatatc tcagggccgt cttctctgta     94380
     taactccctg atacaatata aacatgaaga gcctctgtag actgcctttg catgtgccct     94440
     gtatccactt attccacagt cgataagaag tttacactca gattttcgga acatcaggtt     94500
     caggttcatt cttccttcga tgttgtcaag agccccaaag atcacgtcgt actgattcaa     94560
     aacattgata ggaacctcct ctatccttcg tactaggaag cttgctctac ctccatactg     94620
     cttgtttata aactcggctg ccttctctga cttgtatttc ccttgatcct cctttgtaaa     94680
     catgaaaagc ctgtggagat ttgtcagatg aattcggtca tggtcaacca caagtatctt     94740
     gctcgccctt ccacccaaaa gcttcagtag ctccattcca gttcctccac atcctgaaat     94800
     tagttactcg ccacttacca actagaacta tcctcataaa gggcataggc aaaagacatt     94860
     tcacattcaa gacatactca tttttatttg agactctcat gtcaatgtgc taaaaggtct     94920
     tgagcacatc tggatacatc ttcattatct tttcctgtac atcaatgaga attaaggctt     94980
     gataaacaag aaacagctcg tcatagctta ccgcacattt cagagcttcc tcataaacat     95040
     gcctcccgtc cttatcgttt ctcccaagga gaatccctcc tagatacaca taaggcttaa     95100
     agaatcttct atcggcctca attgcaagcc tgaagtattt ttcggccaat tcggcttcgt     95160
     tctttgtctg tgcagctatc cctttgagca gaagaaatcg aggatccttc tggaaatgct     95220
     cctcaaaggt tgacatcacc atctccagtc tcgcatcctt gttcctaatg tagtattcac     95280
     aggcaataga caggatactg atactaagtg gatgggcttc aagtgctctg ttcaggaact     95340
     cctgtgctct ttcacttctt ccatgcccca cctcatagat tatcctgtct acatacagaa     95400
     agtcatggtt ttcacattct agtgccatgt caatgaactt ctcatacaat tcatggttct     95460
     tgagattgag atggatcttg gatgcataga atagaacgga gacgcttttg ctgttcttgg     95520
     acacaaagtc ttctatgtcc ataggtgtat ctccgtgaag agttttaaga tactcccgga     95580
     ggctgattga aaaaatcatc ttttcgttct ctagtagaga aacagcttcc atgtcctttc     95640
     cccttacatg gactattcct gcaaccacaa accttgatat actgtcatct ctcttctctg     95700
     ccttctcaaa ggcctcatcg tacttcccac ctcgaataag cctaaccaac tcgtcattta     95760
     caaaagactc gctttcaaac aaatcaggaa aggttgcgaa gaagttttca tatgaaatct     95820
     tggacgggca tgcctccctt gtacctgcca tcttcctggc ctcggcctct gcttccaact     95880
     tcaaaatctc ctgtgcaagc tttctatact tctcgtcctt tgtcacaagc ccgcacaaaa     95940
     aggcatcgca aagggtctct ctcctcatct ccagagccct gtggcattcg tatcttagcc     96000
     tcagagcctt ttcgttgtta agtatgttta tttggaggga tctcccggca tatgctactg     96060
     cctctttgta tgccttaatc tttgcaagac atatcgtaag attgttgtat acactaacaa     96120
     gcctctcatc acactcctcc attagattca ggcactttag gtacaagact gcagcctcgc     96180
     tgtacatctt ctctttcaac aacaaaagac ctctatccat gtactctctg atacttttct     96240
     ctctccggtt tcttctccat gcacgaaccc cctgccacac aagtatagct ccagacatca     96300
     cagtaacagc tagaaaagca gaagtcttcc tccctaccat tgggtccaaa atattgccca     96360
     atttttactt caacctaaat gcctgttctc tcagacttct ggtttccata aagctccttg     96420
     aacttgtctc taaaccttga acactcccct ctaatcaaca accccaactc atgtacctgt     96480
     tctctatcgg catcaagcag aaagtataac attgtttctt tgattctatc gacatactcc     96540
     tcgggaaacc tcccttcaat ccatgagaga caagagataa taagctcata atacctttcc     96600
     aaatgagagc ttgtctgtcc aaagtccact gtggcaccag acaaaatcat agccctcgat     96660
     ccaacacaca tgtacatggc ctccagatcc tttgaagctt cttctctcct ccactcacat     96720
     acagcgcatc ctctaatgta cagacaaacc attcttgatg tttccagaga caccctttgg     96780
     actccattaa gaagtctatg cagaatccca atgacacttg cattgaagca aacaaaatct     96840
     ttttgcaatc tccctacaaa ggcattcaga aaaatcgact tctcctcttc agaccctagg     96900
     gaacttatgt agtcggatat aatacatctc aatctgatag tcctttggtc caagctctga     96960
     atattcctta gaaacaagtc tacaaggatg ttccacttct tttcagtctc aatatgtcca     97020
     aaaatcttta tcagcagata tccagagtac agcagaagat ctggctggct tcctatagat     97080
     tccacaaata gctcgatata tacaagatgc tcagggttct ttacgaagag actgtcaaac     97140
     ataaacgcta gccactcctc ctgtagtcct ggatggcaag caaagacaat catgtcggac     97200
     catgaaatat ctcttttcag gctttcaagg actctaagta ctttggacgg atgtcttgca     97260
     cgttctatgt cattgtagaa cataatgcga tcgaaagacg tcttccatgg atgcaaggat     97320
     tccaagctcc tatattttgc cacaagaaac ctgttatgga ttcggtccca ttcatccaag     97380
     cccacctgtt ctaccctctg taaggtcagt ccttgcagtg aggagtaggc tgacgaaaag     97440
     ttgaacccgg ccgacccttc caagagacgg catatcgacg gaattgtctc cagaacacat     97500
     actactgcaa agacttcttc atagagcgac atactcccag aagaaagaga ttcaagacgg     97560
     aatattacct ctttgagtat tccggaggat gttttggaga cagaggtggt gaagtgaaac     97620
     ctagatagaa gatcaatggt tgaaatgatc tctcctgcat ccttttcatt gatgaacata     97680
     aagcttgtgt gacgagaaac tatgtcaaca agataagaga ttagtgacag gacatattcg     97740
     tctcttccat tcatagtgtc tgggatgtac ttgagcaccg actggaggac gatacagcag     97800
     gccacaatgt tcttatcaag gagattccgt gttacatatg tagttagcct ggaaaacatt     97860
     ggaaggagtc tcttgaaaca cattgtttca ttatctagca gaagcatgac cagacctatt     97920
     tccttatggc taaatccaca actgaatatt ctttttatca ttgacttgta caggctgtac     97980
     gtctggctat atccaaagta tcctcgatag tattcaagat cgatgtggga caatcctaac     98040
     tcactgatgc agccaacaaa gtcctccatc ccaacaggga ttatggcttt ctttacgaat     98100
     tcggacattt tctggtcgaa atccacttcc acaatcttct cagcttctgc aaactcctta     98160
     aaaaaggcct tgagctcctt catgatctga gaagttccct cctcggccga gatagggaga     98220
     tttacaagca ggaagtatct tacatagatg tctgggatgg aaaggatgtc tgctatggat     98280
     ggaggcgaag tccccgctgt tgtttctata atcttctgtc tatctgtttc tatgtagaag     98340
     cctatgtcgc gtacaactgc catccaggcc tggtgtggaa tgagttttaa gtgcagagcc     98400
     accaatgaag ttccaggaca tgtgtcgtgt gatggaaagt gtttgatctg aacacaccga     98460
     tttgacgagc cccagagcgt aaccccggat gtcaaggata ggggataaaa gccttgggct     98520
     cgagaagaaa atacacaagg cagcacttct tgagacagtt acggtcttga acgatgttgc     98580
     cgatggcaag aaaaaaagaa agagcagaga ggatacttcg gtggcagagg taagggagaa     98640
     aaaaaataag aaggataccc gaaagaaaac cgatagccag ggaataagac ccagtaagca     98700
     aaaaagaaat gcagctagaa agaatggaga gattacaaag aagaaagtgg aggaaaagac     98760
     aaatgaagac aaagactcta cagaatgctt gaaaaagatg acaaggaaag aaagaagact     98820
     ggaaaagcta agaagtaagg ggaaaggact accttcgaaa gaatattttg agaaatttat     98880
     caagaagtat aaggatgact ctccacagga gaaggccacc cggggtgttc tcccttccaa     98940
     gcggaaggag gacttcccca aaggagatgg aaacaagaga aagaaaggat ccttctccaa     99000
     aaaaagaaaa ggtagagatc agtaaagatc tatccctgga attaaatctt ttctgggctt     99060
     ttttctctct attgaaatgg cttttgtatg tgacagcggt atgtcttgac cggaatggag     99120
     ctttacaaca gagcagtata tggacgacac atcttcgagt atgcagactt ctattgtttt     99180
     tcttgctttg aaataaatcg gcgtcttatc tgaagaccag accttcaaat ggacgtcttg     99240
     gtgatctttc tcgaagagaa gagaggctga aaatctcaca ggcatccgac cgcaaacctt     99300
     gactcttgat ggaacatcca catcatattt cagaaatctt atggagccaa agtccaggct     99360
     tcttatgtat tctgctatgt ttttagtgtt gttagccatc gagggatcaa agccggtatt     99420
     tgcaaagaga aacgggattc tttggagtat attgcttttc cctttacgga gcagctcggc     99480
     cattcctttg taaatatagt agataaacca atatcggtgg tcattttcct ttttcatacg     99540
     gcggaacagc ctcctgtagt tcttttctct ttgctctccc ccatccagct cctcaagaaa     99600
     ttgatgaagg atatctctaa agaagacata tcctcctcca cacccgtccg gctccgagca     99660
     ttccatgatt tcaagaaaca ggaaatggtt ctcaatcacc tcgctcattc ttattcctgg     99720
     gttggctttc ttcagctccc ggagaaccac cagccttgca atatagaaag tatcttctag     99780
     agaagactcg acctgtgcaa tgcttgtatg cttataaaat ctatccatat ttgcaaagaa     99840
     cagctttctg ttcctggata caatctttct tatacatcta aacacatccc tggatctcac     99900
     gttcacatcc atgtgggaaa ccaggatgtc gaagatctcc acatcctcgt acttgaggtt     99960
     tgcaagtaga ctaagaatgt ttgccttgac cttacttctt cgctctttga gactttcgca    100020
     gatctgtcgg actatctctc ggtctatgac cagcgtgtac tttatgctca tcttcttgag    100080
     gcatagtgta gaaagctccc gaaggtctcc atcctcatcg tttagtgaat caacaatgaa    100140
     gtcgaaggct cgggaaacaa tccccggcgt gaccagagag tatacagaag agattgtatt    100200
     cctacggacg tcggagtatt catcttcaac cccatatatc agtgctccac atagcttttg    100260
     gtcatcaagg cttgtgactt gcttgctcag gagtttttcg acgacctcat cagaaaggtc    100320
     cttaaactcc ccaattgccc tggagacaaa cacccgtatt gtgagctccc tatcatgtat    100380
     cctgtggcat acagatcgga gaatctttat tttatacttc tcgtcctcag aaaatctcat    100440
     taattgatgt aaggctgcaa tcctaacgtc cgggttttca tcctcagcct gtttaatcaa    100500
     agaagaaatc cttaggttcc acctctggct caaatagact gcccggacag agtggtctgg    100560
     atcatcttgg aaagaaggcg gaattatgtc tggaaaattt ctataatgca acatcagtga    100620
     tatcctcctt accttggaat ttctatgcaa aagcattctg gatatgtctt cgtattcaac    100680
     ttgagtgcct cggcagagtg cattctccaa atacacaatt agatgatgat cgttgcactc    100740
     ggaggtgcat tccgaagagt ggtacttgga tattggcttg gggctgcagt cctcgaagtc    100800
     tttgccaatg gtgtttagaa tcttgcactt cgacggctcg tgaaggtcga atatctgcaa    100860
     tcctggaagc atatgggcgc ggaagtggaa gcttaaaaaa tacccctgct cttagtccat    100920
     ggacggacca aaaaatgtca gagatctttg cagaaaagtg aaggacgagc tttcgttcag    100980
     aaaagaggtg aagggtattg acttcgagaa ggaatgggac ttcatggaaa taataaagtc    101040
     ttttgaaacg actgggttcc aggggacaaa tctatacaag gcaattgagg agattgaaag    101100
     gatgagaggc tcgaagatat tttttggatg caccagcaac ataatcagct ctggactcag    101160
     agatattatt gccacgcttg tcaagaggaa gtatgtccat gtacttgtga ctacaggagg    101220
     aggaatagag gaggacttga ttaagacatt caagccgacc ttctgtgggg atttcaacct    101280
     taagggaaag gacctccgag acaacgggtt gaaccgaata ggaaaccttg taatcccaag    101340
     tgaaaactat gaagacttcg agacgtggct gaacgaggtt gtaaacgaca taaccgaggg    101400
     atatacaaag gaacatccaa gaatactgac gccatcgtca ttcataaaaa tccttggaga    101460
     aagaataaat aacgagtctt cggtgctcta ctgggctgca aagaataaca tacctgtata    101520
     ctctccagca gttaccgatg gatcaattgg agatatacta tcattccatc caagaagaaa    101580
     tatgctgaag ctggatattg tcgaggatac atatcggatg aactgtgaag ctgtttttaa    101640
     tggggaaaca ggggccatca tacttggatg tgggattgtt aagcatcaca tcctcaatgc    101700
     taatctattc aagaacgggc ttaattactg tgtcctaatc aacaatgctc aggagtttga    101760
     tggaagtgat gcaggagcca atatagatga ggcagttagc tggggaaaga ttaaatccga    101820
     agcaaaggga gtgaaggtgt ttggtgatgc aacaatcttg tttcccctgg ttgtagcagc    101880
     cacatttatg aagcaggaca aagcctgccc ggaaagataa taaagccttt atatctgttt    101940
     gttcagtcta ctgtgtactc aagcccgaag ctttttccat atccacagag cttcattgat    102000
     gcgttgtatg cagctccatc agtttcggag gaatcacctg tagatttcat ccccacacaa    102060
     tatagaaaac actccatcga ctctgtcctg cttgctcttg gtttcagtag aaccactcca    102120
     ttatagaatc tcctgaagtg gttaatcatc cattctgtgt actttccttg gagacacttg    102180
     cccacaaatg aagagcctgg ctttgaaatc ctcaaggaag cgctaagtgc agacatcagc    102240
     aactctattt ggagatactc atctatctca tggattccgg ttatgtccgg agctccgtca    102300
     cacattacaa ggtctgccag tactccttct agagcctcta ctatactccg taagcacgag    102360
     tctgaagtta tatcgccctt aatgcacacc acaccctcca tcgggacaat gtcctggaca    102420
     tccacagaca ctatttttgg acatccctcc ttggaaagca gcctttcgga tgcatactga    102480
     gaccagcttc ccggcgccgc acatagatca acacactttc aactccctca aacagattgt    102540
     actcctcgtc gatatcaatg agcttgtaca cgcttctggc tctgtacttg ttcttctttg    102600
     caagtctgta atagacgtct cttttttctt ctccatccat tcccggggac aaaaaccaca    102660
     ttgccattgc acctcatact ttgggccaaa aaagccccta aatgtttagt ctgatgtctg    102720
     ttgtgtacgg agtcctgttt ctcttgaact ccatagttat actcgacgaa aagagatttc    102780
     tgtccagagt gggccttccc ttatctccag aagccagagg catccttggc ccaagccgta    102840
     agaaggttgt cgacttgatc agagcgatca agaccgtaat gaagattcct ttaatagtgt    102900
     tgaatataat gtgtataaca tacgaggtat ttcttggata gaaaggagga gtggattctg    102960
     tttatttcac agagtatcgc tcagatcatg gcagtctatc tcgaacgaag cgtcgccgtc    103020
     cttgtcggat tcctcggata ccactgcatt gttcctaaat aaatcattgg agtctaaagc    103080
     cttttcattt atcttgtgga ttctttgtat ctctttgatg tagttcttgt cataacagca    103140
     gtttcccagt gagtttccga actgcctcag agccctcttg agagcatccg ttgctgcttc    103200
     tttctttgct ttttcatatg caatggcctt ggatttctgg ttttccgaac tcccaaaccc    103260
     gatgtcttct ctgtatgttc catccttgag catgacccta actaggcaag atacccccag    103320
     cccaatcttc ttgtcccctc cctcttcata atcaatcgtc atgctccgta tttccgacga    103380
     ccagccgttg aatccaaaaa tccggtttgc caggcttatg gccatccagc cctcgacata    103440
     tgctatcttc gacatgttaa acccaggcct gtagctgata aactccggcc caagcttttg    103500
     cctgagaagt ttcgatatct tctttgcttt cttcttacta aaagtaccgg gtctccagct    103560
     ccttggttct ccttcttgca taatacccct taaaggactg catttccgaa acaagaacaa    103620
     ataaatattt ccttggtagg ggtaacaaaa atggatcctc tcatgagtgc gttcaaagca    103680
     agagaaagta aaacatttta cagcccaatt ccacataagt atgaacagat gttcaagcca    103740
     aaaaaatatg atctagaaca cttcggactg actttcttcc aacgtgcagt atgcttctct    103800
     gcatgccttg gggccgggat tctttcgttc ctctacagca tgatcaagat agtccgcctc    103860
     tctccatctg ggttcattct tccatacaca atctcaaact ttctgttctt cattatgttt    103920
     gggtttctgc ttggcttcag atcctatctc gaaggcttgt tctctaagaa gaagcgcatc    103980
     cacagctcat ggtttattgg ctgtacactt ctgaccctct atgttgtctt gaaatacgac    104040
     agatacctcc tcaacttagt attctgcttc gtccaagtga cgtcgttcat catgttctcc    104100
     ttgaccttca ttcccggagg aacctcgggt atgtcctcca tggtcaatat gttcttcaag    104160
     aaataaatgc tttctatagc cttaacacac cggctttgat gtttgtagcg ttaaaagaaa    104220
     ctcctgtaaa gaattcaatc atttactaga taagaaggaa aaggcaatgg acaacaagac    104280
     caccatcagg gctattgcgg cctgtggtag tgacgagctg ggcacaagct ttccaagtat    104340
     gtgtaggaga aacacatttg caatgaaaat cagggatatc acaagaacct gcatcggtga    104400
     tattagaagt cttgatggct ggttatacag cagctcgttg agcttgcttt gcctcttctt    104460
     gtactgctga atctggttcc tattgcttat ttgcttcacc attttgaggg ctaaacatac    104520
     gcaattttaa gcatccgaaa tgcctacatc cattgattct ttgctgcaca ggtctaaaag    104580
     tccatatcaa acccaaactg cagcctctgg atctgtttgt tattggtaag cggaatggca    104640
     aagcttatgc ctaccaccgg cccgtccttt gccttcatga caggaacact tgctcccagc    104700
     ccaacagatg ctccaagaca ctcgctatcc ttgtaagagt gggactccat gattgacttg    104760
     aagctcctcg ttatgtttct atcttcagac acatagccta acgaccagaa gaaaaatcct    104820
     tttgcatccc atctggacac ccccatccga tgcgatactt caaagaagga gtttcctcca    104880
     atcttcagtc cagagttgct tggagatatg ctcattcctc tatatccccg gatattctct    104940
     ccaaggtaat acctctctgc aatgtgtggc tctccaagta ttgttcctgt cgaaagatgt    105000
     atgtctgtga acaggttcct tggaaaagct tttctcagaa tcatttctgc ctgtgtcttc    105060
     aaaaatagtc tacacggccg tgagtcaaat attcctatct tgcttttgat gtcgattgcc    105120
     ccaagcttct tcctgagttc tatgaatgcc tggtctagat atccaatccg ttctctcccg    105180
     acacatatcc tttgtgtttc cctttcaacc tctagagagg cacgggtatg aggatactct    105240
     tcatgaggag acttcattgt gtctctagac ccaaatatcc taagaaaact cagagactta    105300
     gccagaacag gtttagagaa ctggaagctc atgtccttgg aggttgacac agacacctcg    105360
     aggttctctg cccttccaaa gagattcgga agtttcatct tgagatatcc cttcgggact    105420
     ttccctgtcg tgtccccgct gaagctaatg cttctcttct cttcggtcac agacagtccg    105480
     tcgcaagtct tggcaactgc agaaaatatc ttaagctttc ggagtctgcc tataacctca    105540
     tccactccgc ttttccccgg aatcccctgg atctcgtcaa ggaaactttt gtctgttctt    105600
     cttgttcccg ttatcttgaa cataagatat cctggggaga ttccaataca ttaaatacta    105660
     tcgagccaat acactatcct ccttacaaac agacttagaa caaatccttt aatatttaga    105720
     tctcgacagc tgtcttgcag aagagaatat ccttgaccca tccaacacga gggaagtagc    105780
     atccccgaag ctcgaagcag ggcttgtcgg aaagatcccc agctatgtcg tatgtgcttc    105840
     taaacacccc cctaagcttc tggggatcgt tccacccaac aattctactc cagattatct    105900
     ccgacttgtc tgttctccct ccataaatgg ctcttacata cacaaatacc tgcttgaggt    105960
     tgaagtgaaa ttggctcgag aggtcgatgc tcggctcaaa aagaaccacc tgtgttcttc    106020
     cataggcctt gtactctctt attcgcaggt cagacacagg cggcgccttc gttacaaaga    106080
     acgaaaatag aaacacagac aaaagaagaa tgactgtggg gttgaatgta aacgatacca    106140
     atgcgctgag tctcttacct gctgttttca tggggtaaat aaaataattc aaaaaagctg    106200
     agcctgggcc ttccatagac ggccttattg ggaaatacag gtctcggcac tcctagatta    106260
     atcaatacat ttattgactg ggaaacaatt tatccgaaga ttttggaatc tgtaattaat    106320
     ttcctatctg gggatatgat atatagctca acaccagcca caaaatgtac ttgataggaa    106380
     cattccagtt actaactatc ttgatccttg aaggtctttg tgattcttgg tctttgctac    106440
     tattgtcctt cttcaaatcc ttggagaccg accgggagtt ttggaaccat atctgtattg    106500
     ttctcggaga catgttcagt aaaatagcta gattttgcct tgtatcatgc gggggatagg    106560
     gagtgatttc aaagacttgc ttcaaaacat agacttgaac ccgtgtcttg tacttgtagc    106620
     ccgaaagacc aaggtaactc ttatccgata gtcttcggag ctttataagt ccaagtattg    106680
     cctcaccttc catcatccat cttgagtcct tcatctgagc aaatccctgt ctttcgttca    106740
     ttttatctga tgatttgttc agataaatta aatcgaaggt tttcaacggg ttaattactc    106800
     tgcattgtac ggaatacaat tcctgcccat ttctaatcat aattctgtct tgaatttaat    106860
     tatcctttcc tctcctgcat aaaaccgctc tagctaaata caggacctcc atggccaccg    106920
     gctacttcca cccaaggcct tccaaggctt tatgtgtctg aaaacacaat aacaaaggta    106980
     attgtgtcca agatgtattt gatttttaag tccatcccca atgaaagagc ttgtgtccaa    107040
     acttctgaat ctcgagcttc ttacagagat agaagtcgag aatatctgca acaaagtgtc    107100
     tgaaatcctc atctgcgagc caaatatccc aaacaaaaag tctccagtta ttgtctgtgg    107160
     agacatccac ggccagttct ttgatctggt gagtttgttc aggatcgacg gagttccctc    107220
     gaaaaaaaga tatgtcttcc taggagatta tgtggataga gggagaaact cccttgaatg    107280
     catattgttt ctctttcttc tgaagatctt gtacccagag aatgtcactc tcataagagg    107340
     aaatcatgag cagtctacca taaacagggt ctacggattc tacgaagaga tcatggagaa    107400
     gtatgggacg ccaagaatat ggaggatgat caacgaagtg tttaatctta tgtgtattgg    107460
     atgtctgatc gatggaagga tactgtgtgt gcatggaggg atatcaccca agatcacgtc    107520
     actgaaccaa ataaaaaggc ttgacagact gcttcccatt agggaggaaa gtgagtttgc    107580
     agacatccta tggggagatc cttacgatgg aaagggcttt caacctagtc ctcgaggaag    107640
     tggatatctt tacggggagg acgtggtaat aagatttctt gaactgaatg ggcttacaag    107700
     cattgtaaga tcacaccaac tggtcataga ggggtacaag ttccattttc ctgggagaaa    107760
     cgtgattact gtgtggagtg ctccgaatta catgggaaag tgtggtaatc ctgcaagtat    107820
     cctgaggatc aacgagacac tggacatttc cgataaggat ttctgcatat tcaaggccac    107880
     accgcagaga aaggagtttc tcacaaagct agaggggctt gacttatagt agattggagg    107940
     atttctttat tcgcttcatc ccatggatgt ttagtaggct caagagtccg gaggaggagc    108000
     ggggagtcga tgttcttaaa ggatatgcag tgaggacctc caagcatgaa ataaaaaggt    108060
     ttctccgctc catggagtac aggagacttc ctcggcatct gaagagaatc aagacatgga    108120
     acgaggattt gcttgtactt gttgatattg ttgaggagtg tgatccgata gactctgttg    108180
     ccaatctggt tgaagaaatg gtcaaagaag ggtttggatc taagctttcg gggcgtagac    108240
     aagagtctct gattgagaca gtaagcattc caaagtatca gccgctaacc gactcccaat    108300
     acgtcgaaag tgcaaagctc tggccgtgca ttagatcgtg cagatttgag gaagaactag    108360
     atgatgatta tattggaagc atggtaagag ttctgaagac aaaaagaagt atggcgattt    108420
     gtacaggggc ctgcatcata gcagatggga aacaagagct atcgattcat gaggacaccg    108480
     acaatgtcct aggacattcg atactgaaag ccgttgaaga ggtcagtaag gcccagattc    108540
     tctatctgtg cactgggttt gatgcattta tactcaagga gccctgtttg tcgtgttcga    108600
     tggcacttgt gcacggaaga attaagaggg tcttctgcct caaaagggat cctgaaggtc    108660
     ctttctcgag aattaagatt aactacaaca agaacttgaa tcacagatat cctgtttatt    108720
     ttatggatga aacatgtgca gattgcccaa tgtaacaaca gaattataat aaaagtttag    108780
     cttttcctgt tgaagccttt gcttggagaa aagacaagga catatataat attgaagagt    108840
     ttaatggact tcggcgactg tttctgcctt ctttgctccg tagaatgcct tcttctctgc    108900
     acttgtctgg aaccgcccat gtcctatctt cgacgatgtg tcgacaaact tgatcacaag    108960
     ctcctcgctc ggcctctgct gtgtaagact ctttcgaagc gtcacaaccc tcttccgtgg    109020
     cccgacaacc gcccccttca ccatgatgaa gtcgttcttc acttctccat agtgagggaa    109080
     tcctcccatc ggcgaaatcg ccttctcggt taggtcaaac tcagtcttga tcttggtgct    109140
     tccatttcca atcatgtaca ccctcttgtt cttctctgtt cttctatgga accccatctg    109200
     ccctgctcgt gcaacagagt acatcacacg gctcggatgc catgctccaa tgcatgcaac    109260
     ctttcggatc ccctttcgag acttgcgcgg ctgctttcgt actccaaacc tcttcactgt    109320
     tccttggaat ccctttccct tcgtcacccc aatcacatcg atgttctcat tctctccaaa    109380
     cacctctgca atctggatct ccttctcaag cctctccaga gcccactcaa ccttctcgca    109440
     gatgcttcct ccattcaact gtatctccgc gatgtgtgct ttcttcagcc caagtgtctt    109500
     caccatctcc ggctgtgtct gaacaagtac tcgcacacac tctgccctct tcttgatctc    109560
     ttcaacccgg gactccgtca cttctcctcg gcagaactgg gccgccgcct ccttctccat    109620
     gtacttgtta ccaaacatcc tgcggagaac tccatcgttc acataggata ccgtgacaat    109680
     cgggagtctg tgcagtccag tcacagtcct ctcatatccc acaatcccat acacaaccat    109740
     cggcggtgct tcaaccacag tcactgcatc catcacctcc ctagaaagtt gcttgttctt    109800
     tgcaacctgg gtcttagtcc ttatcacatg tgtcatccct gccttgtacc ccataaatcc    109860
     agtcagatgc acaggctggg agatatcgtc agccggaaac gcccctacag acggcctgat    109920
     tgtcttcgat cttttccttg ggcagaactg caaagatcca tgtctcggtg cgttgaactt    109980
     cctgcagctc atttggcaag ggcacaaatt tttccattaa ccgatcttct ctcgaaaagt    110040
     atcaaacaat gctaacaaca ggcccaaggg cacaattgag tgtactccca accacttgat    110100
     ggatagaatt tcctacccta ccgatgagtt tccatccgga gtacaaggag tattttaaac    110160
     aaggatcaac agcaaaaata tacaatggag tgtttgagga tgcaggattc tacgacgagg    110220
     tagacataaa ggagttcaag tacaacaagg agaacaagac attctattat ccatgtcctt    110280
     gcggggacaa cttcgagata tctctggaag atctaaagaa tggagagatt gcagctagat    110340
     gtccttcttg ttcccttatc atttgcacgg tgtacgaagc agaggatctt aagatgtatc    110400
     tctagtatct atgacacaag gagatgccct ggaaaaaaga cccccgacct caacatccca    110460
     caccccaaga cttaaaccta ttgctaagta aacccaaaat ggcgaagaaa cagcaagaga    110520
     ccaagcaaaa gtccatcaga gacattcgga aggagctaga agaaaaggca tttgggctga    110580
     agaacaagaa gcagaaggcg gcgattctaa agcaaattga aagtcttaat cttaaggaac    110640
     agcttgagaa gaaggaaaag atgaagaagg aagagaagaa tgtgcctgtg aagcaggtga    110700
     ttccggtggg cgtggatccc aagacgattc aatgcgtcaa ttttctaaac aagatttgcc    110760
     cggatggcga tgcatgtaag tttgcacata aagaagtcaa gaaggttgaa aagccaaaag    110820
     aggaaaatgc atccgaaggc cccaagcgca tatgccagtt ccttattgat gctttgaatt    110880
     ctggggaata tggagacaac tggaaatgcc cgtttccaaa atgtgttgac atccataggc    110940
     ttgtggaaat caaggaaaat gcacaggtgg agctgagtct tgaagaatac atagaactgt    111000
     ccaggcagtc tcttccggag aagcttactc cactaaccga ggaaacattc aagcaatgga    111060
     agctcaggaa gcagaaggag gagaaagagc atgccagaaa ggtcaaggcc atagcaacag    111120
     ggatgaaggg aatagagctg tttgaagcaa ggagagagct attcaaggat gacgaggagg    111180
     ccgaggactt ggactacaca gaaagatgtt attcggagtc tgaggacgag gaggaccatt    111240
     ccaaataaat actttattct tattattctt ctttgcatgg caaaaagtcg tcttcgcagc    111300
     atccatactc ttctatatcg aatccccatt tcctaaggga gaatgctctg aaaatttcaa    111360
     ctggatgtat gttgtattgt gtgtgcaata tcgatatgca ctcggagaca cagtctttcc    111420
     atctttctat cacgctttcc aagtccccat gtgtttctcg gaattgcttc atcatcctca    111480
     acttcctatt ggtgtctttc tgaataaaca acggatcctt gaactgatcg gaatatcttc    111540
     tttttcttac cgcctcctgc ttctttccct tgagcttata gaacactctt ccatccacat    111600
     gtagctcccg atagtcttct aagtgctctg gcttgtcagt ggtgtacatc gggggaagat    111660
     gattacagag atattttctt gaattccaag gatttagctc tgttttgcca gatggccaat    111720
     gctcttgttc tctgggaagg acccattgat gagttctccc gccaatatca aaatgttttt    111780
     atgggctgga ggaagcctga gaggatgatg aaaagggtat ttcaggacat cacaaatgtc    111840
     agtagaaaga acatcaagct gacaatccac cggtcatcac acagaagaaa actggtcaaa    111900
     tggctgtacg aggtgatgga cgacttcgga tactcccagg tcacattctc aacagcagtt    111960
     ttcatcctgg acagatacac agaagtaaga ggacttgacc ttgggaagta ccagctggtg    112020
     gggatctcat cactcttcct cagtgcaaag atagaagaga agaggtgtaa ggaaatagat    112080
     gactatgttc atgtcacaga caacacatac tctagaagag agatcctaga caaggagatc    112140
     gagattctgg aggtgtttgg gttcaatctg atgttcaggc tccctcactc ctttcttaag    112200
     gagaagtatc ttgagaagat gtccagcgaa tacactgtga agcaatgcca ggaaatattc    112260
     ttttgtgcat tttcgtatgt aatagagaag aacatctgtg gatccagtat gtattggata    112320
     tacctggaag gaatcaagga ggctgagaag gtgctttcgg ggcataaggc aagcgaagac    112380
     ttcaggttct atctggagaa caacagaagg attaaaaaca tatttatgta gacttataag    112440
     ataaggttga tcctataaaa aaacatcttt gaacaattca ctctcctccg taggcttact    112500
     tttttttgca gcatccatgt ctttctcaac ctcctcgaga acacatcttt ccaactcccc    112560
     aagctcttcc tcagaacgga actcaagaag acgtttcctt atgtcttcca tgcagtcgtt    112620
     cttcctttct ctatccactt cttctttgct tctgtatgtt tccttcgaat caactgtaga    112680
     atgtgtgcaa agtctgtatg tatcgatttg cacaataata ggccctttct cagccgagtg    112740
     tttccttgca tatccaagta ctgatatcag cccaaatata ttgttgtgtg gaactcgaat    112800
     tcccggaatg cgtcctcctc gaagatagaa gtttgtgtct gcgcttacac tttctgcagg    112860
     agtccacatt ccatatctgt tgttttcgca cacaaaaact ataggaagct tccaaaccat    112920
     tgccatgttg aagctctccc acgcctggcc ttggtttgca gcaccgtccc cataaaagac    112980
     ataggaaacc ttccccttct gacttttgct cccaagtact ctctctttgt atttaattgc    113040
     atatgctata cccactccaa gaggaatctg tgccccaaca attccatgtc ctccaaagaa    113100
     gtgactgttg tacagatgca tggatcctcc cttacctttg gaaactcccc cctgccttcc    113160
     aaggacctct tgcattatct cacgagttct acaaccagaa acatatgcaa ttccatggca    113220
     tcggtatgaa gacacaacta tgtcatcatc catcatatac tcaagagcag tgtatatccc    113280
     ttcctgccca atcgaaaggt ggcagaatcc cctaatattt tcttttttgt actctatgtc    113340
     cattagtttg tctacaaatc gaatcttcat catctgcttg taaatgtata tcatctcctc    113400
     tattttgagc ttgtgtacca tatctatttc ctccttccgg acttcatgaa ccctgatggt    113460
     cgcaaggatt tcctgaacat tacactgtat atacttctcc ttctccattc ctccataatt    113520
     ctgagatgag ttcaaacttt tcttgtgaca atgttttgtc tgatgtcatt gagatggcaa    113580
     ctaggccccc aacaaatggc cagtcaaaga atcctaagtg cagttgattc gatcaataat    113640
     cttctaaagg ccctgccatt caggccgtct gttagaagat gccacgattc atttgttccg    113700
     aaagaaatgg ttgggcttct aagaaagaga gcattggaaa gtactcttcc tatccttaag    113760
     gaaatcatag acggcattaa gcttggacag aagaaggagg atatcataga tgaccgagaa    113820
     atatgtagca gaagagaatt tgcaacaggg cagctccggc acctgagact ttccatggaa    113880
     agtgaatttg aagagggcag aatcaacaag atcaaggatc ttctcaacga aatcgaatat    113940
     tatgaaaaaa taggagtgaa gcctatcaag aaaataaatg ttggaaagga gatgaccttg    114000
     aagattttcc aaatgctgtc ctgcagtgga gaagcaccaa tggatcccta catcggagaa    114060
     tacctaggga ggaggatctg ttttttccat gagtcccctt cggaaatcga aatttcgtct    114120
     ctgaggacaa tgttaaggtt tcttcaggag agtggagggg agacagctgg aaggagagga    114180
     gaggatcagg cttacgagga tctggaataa agtttaatat agtctttctt ttcgaatagg    114240
     cttaggatac aaagctctaa cttgtttagc cagccccgtt gaccaccaca cgcttgtttc    114300
     ttagagatgc tgtgttcatt cccacccttg tcttctcgac aaagttgggt ctctttggtg    114360
     gtggtgtctc tatgttgatt gaggtggcaa ttcttatgag tatgaggttg agcaggttca    114420
     agcatagcga cggaatggct atggtgatgt agtagtattt gatcattgag atgttcttca    114480
     tgattattct agtgcatgtc atctggttgg tgcactccat gaaatacagg attatgtttc    114540
     tgacagatgc attgttgtag agtcttccta actgcctgga aacatcggac tggtagccta    114600
     tcctaacata aagaagcatt gttatcaaca taaaaagtaa aagcacgccg gtcaaaagat    114660
     acagtttcat gtacagcctg gtcttactat tgattccgca gcttgcaaac aatcccagag    114720
     ttatgtttgc catcgaggta cttctgaata ttgtagtcac ccctctgatc cccattctga    114780
     gatgctcaga ctccatccgt acaaacatca gatgaggaat gaggaagaat ggtagtggga    114840
     tgttgattac aatcagtagg acggacacaa gttggctgag agacctcacg ttcttgaatg    114900
     ccgtggttgt cattgaatgt caggcctcgt tgatttttaa ggccaggttc ttccaatcgg    114960
     agctttatgc tttaaggggt caccttcgat tcggcctggt aataaaggag aatatgcttt    115020
     atctgctgtg ttctttaagt tctcttctca agcccaacac atgccctgaa gcccaaaata    115080
     gatgccttcc agtccttaag cccaatatta cgctatctca aggccaaccc catagtagga    115140
     aatgtctctg gtttttcttt atgctttgag tgttgcagca aagaactatg ccatcttaat    115200
     gaattcgtca cggggattcc acaactacag acatatggca aatgtatata ttttctacaa    115260
     tgtcctaaaa gagaacgggt tcaaggacga ccaaatcctg atcatctcgt acgagaatca    115320
     aatcgaagac atccgaaatg tagaccgggg tggagtttac atcgatgagg atcagaggat    115380
     tccctactct gcattcacac caagcagcaa tgctcttgca gatcttctta atgcgcttga    115440
     gggaaggaat atcaagctga aggatgcaga tgagtcctct aatgtcttta tatatctcaa    115500
     tgggcatgga aacgagacat tcctgaagtt tggaaacatt cactttatga ctaaagatga    115560
     cttgatggca aggatattga agttggctga aagagtcaac aagattctgc ttgtgctcga    115620
     cacgtgccag gccgaagctt taattgatag agagattctg cctagtaatg tatttatagt    115680
     ggccacgagc aagacggggc agccggccat ttcctcattt agctcatcac ttatatgtgc    115740
     aaatgtttcc gataacttcc cgtacttttt cttcaagaga tttggaaagg ggattgacag    115800
     gaagatcaga cttcccgatc tattttccga aattgccaaa gagcctcttg gatcggagct    115860
     tgtgtttgac gaggaaaaag acttcaggtt tgaggacttc tttgtgcaaa acaacagtgc    115920
     agagcttctt cccttcaagg aaagatgaat gtgttcgatt aaagaatgta actttgtaag    115980
     gctttttgag ttaaagtatc ggtcccctga tggaagaaga aggaaacatc tctgcttcta    116040
     gagggagacc tgacaaggat agatgggacg agtatagcat cctcaacgac agttcttaca    116100
     aaggaggagt gacggataaa ggaaactctc ttgaatggaa gtcatttgaa aaagaagaat    116160
     gtgtcttctc ggaagagttg ccagaaaaga tagagggttt gcaggaagag gagggatcta    116220
     gggagaagaa aaaagactgg gatggagaga tcaggaaggg gaatgataat cccataaggc    116280
     caaggaaata tgttgcaagt aataccgagt atgatagggg agaaaaagga agcccaactt    116340
     cggaggaagc caaaaaggag atcctcttgg agaatctggg ggttcatcaa aacatttcaa    116400
     agcagagata tgaagagcat ataaggaagt taagggcggc aagcgataag tacacggggg    116460
     aaggagaaga agtagaggat ttggtagggg ctcggaaagc acagacagaa aaagaagaga    116520
     atatgagaag ggccctcaag atacaagaga acgatctttg gatcaaggac caagagattg    116580
     tcttacttcg agaaaaggtg gcaagacttg aaatgaagat ggaaattgaa gggaaggagt    116640
     atatagagaa gtgtatccaa aggggagagg cagccgtgaa gattctagag gaagaaatga    116700
     agaaggaacg aagggagctt ctggagagga ttgggcagga gacagaaaaa tcaagggtgc    116760
     tatcccggag ggtcgagggt cttaagaaga tcatcaacga gctggttcgc aagataaaaa    116820
     gaatgaagca gagatcggag gggtgagaag atggaatgaa gagatagagg aggatggata    116880
     accccaaatg tttgaatcgg aatacttcaa gaatcttctg aatgaaacta cggcgttgat    116940
     agccaacaaa gtggaggagg gaaacaacag agaagagatg gaggcccgga tcgagagcaa    117000
     cgtggcaaca ttgaagtatc ttgcaaggga aataacagac agagatctgc aaagcaaaac    117060
     actgaagaga atagacatgc tgtgtctcga gcccgaggag tttgaaatga gtgatgttag    117120
     aaacaggaca gtgggagcta gaggtagtga gcattcggac agaatggaaa gagatatcct    117180
     caagtacaca aaaagactac gtgggaaggt caaggaattt atggaaagcg ttgatatgga    117240
     cagtagggtg ctggaagagg tgaccgacaa aatgtccaag aatctggcag ggacatcttc    117300
     tacactgaag tccttgaaga tagagggatg taggattcca attctgggcc ttcttacctc    117360
     tgttacagca gtctttgttg tgatgtactt tgtcataaga tttctgtaga agataatgtt    117420
     taatggaagt ctgctactaa atttgttgtt ttatatgtcg tcttggaagt cttctttact    117480
     tcttcttcgc tccaggaata tctcttttcc tgttttccct gtcctcggct tttctgctct    117540
     gggagttccc ttcttccagt tcataaagtc ctcctcggtt atcttctgct tatcgtctat    117600
     gttgtagctg attgatattc tctttacatc actcactatg ttgcttcctt ccagcttcct    117660
     gacaactatt ctaaccatat cgaagatcat aggtgtcgag atgtacttct ttgtctcctc    117720
     tcttacttct gctaatatgt tgtcttccac atccgatgac atctctggaa tggtgttggg    117780
     gtagccttct gagcatcgga actcaaagga gttcccctca gcagatatct tgtagacatg    117840
     ctctgtgtcc cttgtgtagt gttccaaatc gcctccaaaa atatatctca aagcatcgca    117900
     ctcatccatg gggtattccc atcgagcctt cttctccaga cactgatatt tagtctgtct    117960
     gtcttttcta tctaataaag tgtttttatt aaactctata gctgttctcg ccaagcatat    118020
     tctatttata gaaaccaatt ctttatataa tctaagccgt tgtttgtaca gatggaaaac    118080
     acaagatgga taaaagctga aattaaaaat gtaaacgatg gctctgtagc cagagaagtc    118140
     ttggccaacg agacaaattc ctttgtcaga gaactcaatc actatgaaaa aaatcttaag    118200
     gatattcttg aagaactaga gaatcaaaac ataactaaca aggaagaagg aatttcgtcc    118260
     gttaagaaag ccttggaggt gttagaaact cttgaaaaag atgtcagctc agcagttcct    118320
     gaagagacat ctatttggac gaaagacttt ttcaaagctg ttgatagact aagagatagt    118380
     tgtaatctat cactcaagtc acttgaggag gctcttgaaa aatttctggc ctatattgat    118440
     aataactcgg atctaaaggg agatcttttg cagaaggcca agctcattcc ccttctgtgt    118500
     gcatctagca agcttaaaga attttcttcg ggtataagga agtcggggac caatgccttt    118560
     acgtggtttt ttaagtttgt tagaaggatt cccgtcgaga atttcaagaa gaacattaac    118620
     tcgagcttaa atggcctaaa ggaaaagatt tgccgtgtat ctggatccca aagagcaaca    118680
     gggaagcaag aaatccggga ggcacagaag attgtggatt cttttttacg cgatgtaacc    118740
     gaacttcagg atgaatatga gaaaactctt ggccttctta taagatcgga gatatccttt    118800
     tcagatgcat ttgagactat gcagggaaag ataagtaact ttgatggcca catgagtgat    118860
     ctggaaaaga agattaaaga catcgaaaca gctttccaac ccatccttct ttccaaggaa    118920
     tcccacgaaa gatcgttgcc tgaagatagt tttcttaaga acatatatct tgtgttgata    118980
     attgtgttat gcatacaggg tgttctctgg tacacagaca atgaaaagtc ttctgctgga    119040
     actgtgtgga acatggtagt gtactctgtg gcagttgtgg ggacgattct gtacatggcc    119100
     tgggtgtggg gatttggcgg aaggagatgg actagtgctg cgagcatggt acctatgatg    119160
     gttgggcttc tgaatttggg gaagagggtg agctgtgagt acgggatgga gatggcaggg    119220
     cttgggtttg taatggtttg tatggagagt cttgcaagac acgggatgtc atcatgggag    119280
     attttggcag gattgatcgg aaatggaatt gtagtgatgg gatgggtcag ttgggctaca    119340
     atgagggata gatatggaga gaggatgagc cagtggatgt gtgggggact tattgtgttt    119400
     ggaattctca tggctgtgat gatgtatatg aaggaaggga gaaatgtgga aaggagcact    119460
     ggaagttata tggtgtttat tatgacagtg gttgttggaa cagctgtgtc ttatgcatgt    119520
     ggaaaggatt acagacaact tgcatctaag agaatgtctc tgaaatcttg aatgcaagat    119580
     gtcaaatctt taaagtaatc aaaaacacaa aacagaaaac ctctaaaagc tagctatcct    119640
     ttttttcttg gatgtttagt agtctaggtg tattgggcaa ttgcatcaag gatgaaccaa    119700
     acggacacca acttccaatc acttcatgga atactatatt tccaaaaaag gcacattcct    119760
     cagtgaacct gttaagtttt tttctaatca tctttttaac ccgttgtata aaccagggac    119820
     tctaggaaac ccttatgatt agcattttat tccttggcca tgcagaagcc gcaacgggta    119880
     tcccttcaga tctctgggat tcagtaaact actatagcct ccttttgcca aagaggcctg    119940
     aagtggcctt gatcttgttt gttgcgggcc tctttgtgaa ttttctgggg attcgtgcaa    120000
     aaagatgctc tctgtctatg atctcgttcc ctttacttcg tctgagcatt ggaagcataa    120060
     tgaatgtgct aaaggaaata gttatagata aatatggaag catatccgag gctccccaga    120120
     tggttaggaa tgggcttgag atactaaaga aggtggacga gaacagattc ttcatgatct    120180
     ttctgtctgt tgttcttggg cttgtgatgg ttttctttgc caaggctgta atatacatct    120240
     tgatggtata tcttgcattc catctgtggg gaatactgga atcatctgcc caggggacaa    120300
     tggaagggaa actgtattac atttaccaaa caataatgtt atgcattggg atcttggttc    120360
     tggttcttgt aaagccaatc accttcttaa tctacatcct catcttctct gtgtttggat    120420
     ctctcttcat catagtcgga gccaattttg gatctggatt gaacctccat ctaaatcaat    120480
     acatcgatat gcttcgaaaa ggagacttct atcaagatct ggttgagaat aagatctctg    120540
     taggatatat ctccctcgtg acgatgggga ctatttgcca gatacttctt aggaagaagc    120600
     ccacggcgaa ggcaaactaa atgcctctgg gaaaggaatt catttctata ttaaaagttt    120660
     tggtataatt taattgcctt cctcagcacg gtggataaaa gcatccaaaa agaattgcat    120720
     atgctattcc aaatccaaag tagaacctga acagaacttt tttccagagt ccgttattca    120780
     ttgtgtagta tttttctgcc agaatccaat atattagagg attgaacgag acaaatctaa    120840
     agtacatgtt ccaatgaatc aagaatactg tgataagagt ttgagccaga aggacaaccg    120900
     cacacatgtc tgtgttgaag tgctgaagga tgccaatggc cttggaactc cctgcacatc    120960
     ttttgttcca gtactctctg agaataaaca aagaaatcag gatgaatgga agcccaacca    121020
     atacattggg gatgttcttg tatgtgaaga atcggaatag tccttgttcc cacagggtcc    121080
     tctgtatgaa agaataagga atgaagattt tgtaggtatt gttagctctg ttgatcataa    121140
     gcagggtgta gtattgaaat gcagcaagtg gaagtagaaa tacagcgatt tttgtgaatg    121200
     tatatctact taaaggacac atgagaaatg gagcaaataa aaccgcattc gatctgcaca    121260
     ggccgcacaa agacaaaaac aacactccgc gaacagtgtc tctgttttct atgaaataca    121320
     ttcccaagag aaagagaagc atgaacaagg attccgaata catggctgtg tacactatag    121380
     atgccgggtt gaaaatgaag aggatacagc tcatcgctgc tattttgttt ccgtaccttt    121440
     tttgggtgat cctgtagagc aatgcagaac taaagacaaa ggctgtacac gagacaagaa    121500
     ctcccactgt gtatggatct agtggaagaa ccttgtggat acagcgggat agatacggaa    121560
     gaaggggaaa gaatgcagcc tcatgggttt tcctgtatcc tctctccatg atctctagga    121620
     agtgaatgga gtcccacgaa aggagaaatt tcatacatga gttgctggga ataagttctg    121680
     tggatttgtc aaagcgagga agaaggagat atgcaacata tgagatacct atgtagaagg    121740
     cacgagaggc tgctgccaac ctgattactc cttgaatgtt cgtggcgaat ggcattccaa    121800
     taggggagca tcttggaatt tgtttatctc aacttgtaaa ttttacaagg ttacacaccc    121860
     catgtttgtt tttcttctcc acctgctcgg atgtttgtgc agcgaacatg tctttataca    121920
     agaggcgtcg ctactgtcgc catatgtaga tgagattggc aggttcctca actggaagac    121980
     atttggggag caagtaataa aggtccatgg aaaggatatg tttgtacagt taggatactc    122040
     gtctccaaat agctctgggg ctgttgtggc atctcacccc ataggttctg agaggtttgg    122100
     gatggatctg attattgagg tggactctgg acagaaaggg gacaccaacg agggaatggc    122160
     catatggata tctgatgagg aaacgtttaa ggaggggcct tgttttggga ggtcatgtag    122220
     tttcaaaggc cttttggttg tcataaagcc ctctggaaag tcttatgttg gggtgaaggc    122280
     tggtgatgtt atgatcaaca ccagtaatat ggccaagaat tttgacaagg ttgaatacag    122340
     agacttttcc tctggagaga aattcgttct tagaattgag caaaaggatt atgagctgtc    122400
     tatatatata ggagaggggg aagacttctc tcttgtgcat tcttacagat acaatcttgt    122460
     aaaggaagga gaccttcttg gggtttctgc atcaacggac agatcgtcga cttcattcag    122520
     gttgattgga attgaaagtt accatctaaa gaacatggag ggcaagggat atgcaaagga    122580
     agatgtacac agcggtggaa gacttatttg gtttatcctt gcagttgtag tttcaataac    122640
     cgcatactac ctctacaaca tccaagtaaa aaaggataat taacttctag tccttctatt    122700
     ctatagtctt taagctgtac ttaatcatcc aacaccccga atttggaact tcggaaatat    122760
     tctcccaacc ggtgccaaat agaacaagag gtctttctac aaggagaggt ggcagtccag    122820
     tggaggatct cctcgaaaac tacttctagt tgggtagatt cgagagtagc cattgttggc    122880
     ttgatcccac cagacaaagg ggcagggtag atcctatttc gtgtgggccc tttggatgga    122940
     agggcctgga gagcagcgga gggcatgtgt tctccggcaa tagagggccc tggtgaattc    123000
     atcgagttcc tgaagcccct gatgattgaa agtcctgcaa taaaaaagtt tattgttaat    123060
     tactttattg aacacagcca agagaacatt gatgatatag cagccaggat cgacggatgt    123120
     cttcggaaga ggtttgtgga gaacgaggtg gtgtctgttg taaggtctgg ggagtgggga    123180
     aggatttctc gagtggctgg agacaggtat gttgtaagca tcctgtctct agatggaggg    123240
     cgagaggaaa ggctccactt ttcggagctt gcaaggaagg acatggcggg gcggacggag    123300
     gtcaagggat atctgcttgg gataacaatg gaaactcctt ttggacgggt gctgaaggag    123360
     aatgcattcc gaagcataag agactctggg gaagtgatga aatgcaaggt tccacagagc    123420
     cagtgctatg aagggagttt tgtgtctcgg aggggtgttg gggggacgga gagaaggaaa    123480
     tggaagacgg agaaggaagg gcaaggctcg agagagaaga acgaggaaag ggagacagag    123540
     ggcagtaggg cgaagcgggc ctccgtgcga aaggagggga cgaaggagac gagtgtgagt    123600
     tcgatcctct tggtggggcc ttcgcaggct ctggagatcc cggggcttag gaaggaagat    123660
     atcgagctag tgatgaagat ctttggagtg gtagcaaact tcggggggtt ttttgggatc    123720
     caagagattg atgttttgtc gctagggagg gctattgttg atccttggta tgaggatgat    123780
     acgatatgca agatccattt gaagctgatc tctggacttc ggacagaaat ggattctgtg    123840
     gggatggagg agtttgtgga gaacagcaag gcatgcattg aatgggccaa ggagcaagga    123900
     agggaggagg atttggctgg agatgggggg gagatggagg agtgtcttga acagtctctg    123960
     ggctgtgggg aagagggctg gaagaaagac ctaaggaagc ttattgagag tatttgcgat    124020
     gatggggaca cagacatttt tggtattgtg aggagcatct ctggaaggag cagggctctt    124080
     gggaggggag agataagaaa gaggcttgtt gtgattgagc tgctgatgaa catgttcttt    124140
     acaacagaac agttccgaga gattatatgg gagaagatgg aggagtcgaa ggatcttgag    124200
     aagaagaaga gggagctcca gacaaggctt aagaggagtg tgggatggga tggagagagc    124260
     aaggaggcag gagaaggctc tcgagccgag atggagaagg agcttgggga cacaagagag    124320
     aagatattcc agcttcctgt gaatactggg gttggaactg tggatggggt tgggcttctt    124380
     catcttggga ggaagatcta tgcagcctgg gaaggagact actatttggt ggggagagac    124440
     aggctggcag atctatgtaa gaaatataag gcaaagaaca aagaggagag acatgtgctg    124500
     gaaagcatag gacagaacat agaagggttg aaaggccatc tttgactgtc tgtttgttta    124560
     tgatgtattg gaaggggttt tatctgtgag taaacaacca atacaaatgg aaaggcagag    124620
     atttacaaac ctgctgaagg atggagagag agggattcct ccggagtaca gcatgagctt    124680
     ggggaaacac tctgtgactg tgcggaacct aaagaaaaag tatcttataa acaagattac    124740
     attgctagac atctacaact actacagaac cccgttatcg gtatacacat cacagaagat    124800
     caggaacatg ttcgtaacgg catctctgtg tcttactgtg tatctggcat cgaacataga    124860
     ttcaatcaga agcaacaaga ttccgaggct tggagtaaac ttctcgtctg cagccctggt    124920
     tattggcggg gtgtttgttg gcagggaggc gatttcgtat gcgatcaact tcaggaagat    124980
     ggtgtctata ttctacatgt acagatacat tctggagaga gacatggagg agatccggtt    125040
     caaggatgtt gtgtcgggga tgatcaagct ggaaagagag gtgcacaaca gagacctgga    125100
     ggagaaggat gtgcgggaca ttgtgaacca taacaggcta ctccttctgt tgatgatgag    125160
     gaagtttcct tcgatattcc ggccggcatg ttccaggttc ctgctgcaca tcctccatgg    125220
     ctacatccac agaatagaag agggccctgt ggaagagctg ggagacgaga tccgggtggt    125280
     ttcgattgga atcttcatat tgtccccggc gatttcgatc ttctttattc tgtactacat    125340
     tgcaaagatc atagaaaagt cccagagcaa tatgttctat gtgttcaaga agtcccacag    125400
     gccgtggttc aagtacatga tggccaaaag aaacgagtat ccacacgaaa cacacaggaa    125460
     gatacagaag ggagctggat atctaaacgg attttttctt tcaagaaaga gagactgcat    125520
     cccaagggtc tgctctggga tctcgtttct tctgagctgt cttgtgtttc tggttggata    125580
     tcttattctg agcatcttgg ttgcatccaa gccaaacctg agccagagcc tttcccagga    125640
     tataactgtc tttgggagga caacaaacat agtgtatctc tcgtacctca tggggggaat    125700
     atcctgctgc ctgagatgtc tcagcatcga gtatggggtt tcgaaccgtc gaaagatgtt    125760
     tgccaagtgg tgtgtgctga tggagcagac ggaggtgctg aagtactgtg gaaggcgggg    125820
     atcccttgag gcgattatgt cgaagatctt tgttccgcgt atatatttat ttcttgtaga    125880
     gatagtgtct ccatttattg ttcctttcca gttggaagga atgagaagga ggttggagag    125940
     gatccggcag gagtttgaat ctgtggggga gggggagtac gacaggcggg tctcgatcct    126000
     tgatctatga cgggaggaaa cacggcatgg atcatattca cagattgatt tctttgtggg    126060
     gttccagaac acccaggtct cggagcttgt cgctcaccac agatgccttg acaacatact    126120
     tacttccaaa tcttcttaca agctctccga gatctttaca gcgaagaagc tctttttcaa    126180
     gttcccccaa aagctcttcg ggaaatactt cgcgctctac tagtggaaga gaaatccagg    126240
     aggagcagaa tgacggaaat atagtaaact tacaggaagg aaatccaaga catggcttcc    126300
     gacatgttct agatggctcc atcctttccg aatccaactc tatccattca caactacttt    126360
     cttcctccga agattcctct tctgtgcttt caataacttc tgcatcctcg caatcttccc    126420
     aatcagaatc ttcctcgtag tctaaaactt gtggaagcct tgtaaggctg tttttcacat    126480
     aatgtttctg tcctccaaat ccatagagag gtggcctaag ctggttggaa aatttgatga    126540
     aggataatct tcttggatct tgaatgtctt ttcttatgcg tattgtggaa ctgagaggac    126600
     tcgaaggcat gctgactgct gtctccttgt cgaagcatat tggggaaaat agtccaagca    126660
     tatccgccga aggcttcttt atgccttcta cctgaataaa tctcagcata ccagaagtgt    126720
     ttgcttcttc tttttctgta tctctctcca agccagaaat ccctttatct ttagcttttt    126780
     tctttctcgc tctcttcaat aggcttcgaa cacctttaga gattccatca aggctcttaa    126840
     gaaagtatat atttccctct ccacttactt ccacatcgaa attggactca acagccttct    126900
     tcagactatt tactctgtct tttctcctct tcgacgtttt tttatacgaa tataggattt    126960
     tgtccatcca atagtagtcc accttctgct tcccttctac taggagagct ataagatcta    127020
     gaggaacctc ttcttctcgt cctctcttcc actcatgcag aatctttagc acttccggat    127080
     ggaataaaac atccgtaatc ataaaaagga taagaataaa acaatataaa gatattggga    127140
     agatacaatg gcaatatgtt ctttctacca aatacttccc atcataccca cagtttcatg    127200
     gggattatat gaaggatacc ctggctcttc cccttcttta gacaagaata agcatccaac    127260
     taaaagcccc tcttcaagtt ccggcccctt taaagccaaa ccgccaagga tgtttttact    127320
     aaacagttgt ccactattct tatgattccc cttctaattg gccaattata gtgaggactc    127380
     ccacatacgc tccaatagca gtgcccttaa tgaatcatat caaccgtatc cgagatatac    127440
     tcatcaacct tgattcacaa agctctcttc atgaagaaac agttgcagaa tgtgcattgg    127500
     tatattatta taatgctgta agtaagtttc tgaatggaat cctcttctat gaggagaagt    127560
     taaatgaagt cttggagtct ttgaacaaca agctcaattc acagagtgaa aagggaatta    127620
     acgcggtcaa agaaactctg gacacacttc gtaggcttaa ggagacaata caacctaaaa    127680
     tcgaatgtcc ttttaaccaa ctttctcatc ctccagaact aacaaatatt gaaatcctcg    127740
     agtacaactt caaaactttt gaagagtact tcaaagcaat cgatagaatg gtttcttcgg    127800
     aaggacagat tccatttgaa gagttcaagg atgcactcag gaatgtcttg ccatatgtcg    127860
     attatccact gacccacagt acaggatccc attctattgt tctcaaaaac gtatttcttc    127920
     aactcttggg ggagtataat gtctctgctg tatttgaaaa tacctgtctc aataagtatt    127980
     atgaaaactt aagaataata ggaagaaaag ttctccagaa gcattttgaa tctctcataa    128040
     aaagtcttgt ctcagaaaac tggaaaaacg aaatagaaaa ggaactaagt gctttggaaa    128100
     gggaggtatc cctggcgtat aaacatcaaa ggaaaagaat agaacaagga atccaagatg    128160
     ctcgagctgt cttaaactcc ctttctcagg atgtaaccga acttcaggat gaatatgaga    128220
     gaatttttgg ccttcttatn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    128280
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc    128340
     aggtctcgga gcttgtcact caccacagat gccttaacaa tatacttgta ggatatgtat    128400
     ttcttcatag aatattggaa tagtatgcat tggaaagggt ggagtagctt gcatctaaga    128460
     ggacatcctc gaagtcctga gtgtagtatt cttgattatt aaatataatt aaaaactatg    128520
     cattggaagt attggaggtt aattatcctt ttttacttga gtgttgcaaa gatatgcgat    128580
     tatcaggact acactatgga tccaacaagg aggcctttcc cttgtatgga ttctgaagaa    128640
     tcccagagag atcattattc ttttttagat tgactttcta agaacctgtt ctgcacttcc    128700
     accacttcag cacttgacgt gcacttggag tactcctcaa gaagatcttc atttaacttg    128760
     tagaattcat ttccataatt aaattcgtta agaatctcat aggcttcctc tttgaagcca    128820
     cagatataca gcgaagcact cagtgcctcg gcacagttca gcttaaaagg cttgccatag    128880
     tttaccgggt ttgctgcaac cataaacgga agaagcctgt tgtgcttcct tggaagcctt    128940
     ttaaagtcca cagagtctaa ctgtgcccat gaacagtcta taagccctat tccaaatctt    129000
     tctatgacgt ctctgtctgc aggagagata gactgatctg catctggaga aagaaccact    129060
     cctttgaagt ttttattctt ttttattggc tcaatcttgt tctgtttgat aagtttcttc    129120
     ccagaacact tttttggatc gcactgctca aactcgtaga ttatcttcct catcccagga    129180
     ctacccaatt ataaagactt tattctatgc agaagagaca gaaaggttct tgctatccct    129240
     ttccatactt tcgtcaggct ccagaatccc ctcaaccatt tttctgaagt tctcgtaccc    129300
     tatcttgtag atatttccct tctcttggta aaaagatggc tctcccccaa cagcaaccac    129360
     ccttgcatcc tcctttctct gtatttcttt gtacacatca aacgaaacat ccttcgtcga    129420
     aaccaccgtt cttatgtcga aactcgaata ttcaaagaaa agaagctcgg caagaatctg    129480
     aggaagagga cgggcagaga caaagtagac tgtctgcttt gttctatgga gcttcacaac    129540
     agagtcgtat agacgtgtta ttcggctttt aagtagccta tctacactgt agaaaagagg    129600
     cgtgcatgta aacttgaacc tttctgagct gttaaatatc ctttcaaacc gatggtattt    129660
     gtccctcttc aagttccgaa gtgtagttgc ttcatggcct tctcctccgt cttcctcacc    129720
     caagctcccg agggtgatga ttctagagca actgttgtcg atgcaaaata gaatgtctct    129780
     gatctcggag attcttcttg atgtctcttc ctttgcctgg catcttagcc ctccaattcc    129840
     aaatatggga tcaagatcaa tcacaaatac acttcggaca ctagtcaacc catccttgat    129900
     ttcgcacacc tctttggtgg ttatttcagg gagctcaatt agaagtgact ttatctcttc    129960
     ttttgtgtcg cttgctttgt tgaattccct cttgatcatc ttgtctcttc ttctgtctgc    130020
     ttcaatctta gatattataa atgagttttc cgtatcttca aacatcttct cgtaattttt    130080
     catgcattgg aagtgcttct tcacatcctc aaatttctcc ctcctaatca ggcccatctt    130140
     atagaggtag taatatgttg agtacacata ttgattgatg ttcttcctgt cctcaatgga    130200
     gggaacgagt tcatctgcag gtgcctctac agcttcaatc aaccttacta tagcagtgtt    130260
     cctttttgtc ccaagtaagc ttcggacttg gtcccttaga ggctgctgga tcatcttcgt    130320
     tcttatctgc tccttgttgt catttacaaa tgctttgtcc ttgcatcttt ccaagagatc    130380
     cgaaatgtcc attccctttt ccattcaaag ggctttgtaa attcctgctt tgttggtgcc    130440
     tcttccctct tcaaccacat cattccttca cttctccaga acaacaaata gactctcctc    130500
     ctcaggccca tggtctagaa ccttgaatcc ggaagatttg cagagctcca ccaaatcctc    130560
     catgccataa agatggtagt atctcttggc atcatccctg agattccatg ttgcaaaata    130620
     gtcctgttca gatcctccga tgatcttcga aaacttcctc tttccactta cagaacttcc    130680
     ccacacatat actagcatct tgcctccatc tctcaggacc cttctcatct cctccatcgc    130740
     cttcttcctc ctacaatcag tactaagatg atggatcacc ccgacactca gcacaagatc    130800
     aaagctacaa tctacaaagg gaagctccaa aacatctcct cggatcagcc catagttctt    130860
     tacagccttc ccgtctctca agagacccca gcagtaatcc aacccgacta ttcccggcac    130920
     cagaaacgat cttccgtttc cacatccagc atcaagcaca atagaatcgg ctgtccagta    130980
     cctgtccagg aaggtttctg tcatcttcca atgcttcctc cttgttgccg aaaactccct    131040
     cgagttttca ttgtagaatt tgtgtacaaa ctctccttca aactcgtttg gatcttccat    131100
     agtataggct cagaagtcaa taaatattta aaagactcaa atacatattc tttactaagt    131160
     tctatgctat ttcaaaaggc ctttggctgc ccttctgatc tcggaatccg aactgtcgca    131220
     tagcctacaa acaatttctt ttatgccctc gtccatttcc tgcgcatcta ttctttccag    131280
     tgtgcacaac ttcacatttt caatcgggtc cgacaacagc ttcttcccaa accccgttcc    131340
     gtgggcctta tcaaaggaga gtgctgcctc caccgaagtt atcctataca gataggactt    131400
     tgatgaggag atggcttcta tctcggggag ccattcaacc gtccagggat atatcgaaac    131460
     taactcccca attaccttgg aagcctctgc ccttacctca tacaccttgt ccttaagata    131520
     gccaagaaga tgccttccca aaaactcctt gagaagcttt tcatcctgct tcgaggcaca    131580
     tgaaatagac tcgaggatct cctttcttgt cctccaatta ggtgtggagt tgagggtgtt    131640
     tataagaggg atgacaatgc ttttgtatgt atccaccctc tggacacaca gaagagcctt    131700
     tttaacttcc caacttgtat ccgtgataac atcctttagc atctcttgaa actcctctct    131760
     gtttcctatc atctggatga tcagggcccg gactccagga ctactgtctt tcagaaacaa    131820
     cggaacaagc ctgtcccaac cttcaacgtg ctccatgttt cctgcaagac atattctaat    131880
     ctcctcctca ggatcctggg acagatgtga atacacagca gctcggtcgc ttacattgag    131940
     cctgcgaatc tccttagcaa ttgcatacct tctcctccag gatttcgatg tgcatatctc    132000
     agatacaaac tttgtctgtc tctttataag gggaatcaca caagaacttg cacactgaat    132060
     ccattccgag taggagccat gcagatcgtt cacaatctct acaagctcgt cgtcatcaaa    132120
     tggaatcgtc ttgtattcct ctagcgataa cgctgctttt ctagctactg ctgcaacagg    132180
     atccttcaag catcttctca aagcctcctt tgcctccttg tactccatgt tcacaatcaa    132240
     ggatggaata gcttgtcttt gtacataaaa tggtgattta agaagcttct tgatgaatct    132300
     gtccacctcg tctggaaaag attcaaatat ccttcgaata acaggtacaa tcctttcggg    132360
     ctcctcaata agaagaagct cacaaatgat tagatgtcct ttgtccggag caagagcagc    132420
     aagatactcg actaacaact cgttgagctt tggatcaacc ccaacaagta actctagctt    132480
     ttctacagat agatgcatcc ggcccctcaa cttttccaca aggttcgaca cttcgttgtc    132540
     aatcatttca aagggttttg aaacaggaga atttcaggtt ggagttatag gacggaatcc    132600
     tattccattt tcttttgtgc catctatcct actccttagt ttggaataat tttatccata    132660
     gcatgaagta caaaataaca tcgaagagac ttgatgagaa gatcctggca gttcatgtga    132720
     acggggctgt ttacacaggc ggaacatcta ggacattggt caaccaggat actggagaag    132780
     tgatgtgccg gtgccggaag tcgataagat caatagcaag ccatggaagg tacatatgct    132840
     gtgcaagcta tgattgcact gcagtgctgt tccacgacgg gaaggttgta gatgtcatcg    132900
     agggcccaga cacagagatc aaatgtgttg gattttccga ggatggacgg tatctagcca    132960
     tggctacacg aggaaagtcg gtgtgggtgg tgaagataga ccccgagata gaaatcgacg    133020
     agattataga ggatcatctt catgatgtaa agggttgtgt gttccataag ggatttctat    133080
     ttacatatgg atacgacaac acaataaaga tctacgaaag gtttgactac gatgactcct    133140
     gggaacttgt gcagtcgatc agtgagaaaa atacagtatg gtgtgttata tttcacgggg    133200
     ataaaatggt atgttccacc gaggaaggga cgatcagctc gtatgtgctg agaaatgggt    133260
     gggagctcga ggcatgcaag aagttgtcga tatttcctat ctattcgatt tgtagtgttg    133320
     ggagggatat ggcatacgtt ttgaacagaa acaacatcgg gattatcgac agtaacctga    133380
     accttaccac gactattgag gatatacatg aagacttcat aaatggaatt gcatatgatg    133440
     aaggacgagg caggataatc agtggaggag acgatgggat tctgaatgtg atcgagatgt    133500
     tttagaatcc ttttttaaaa aggcgataaa attttgcccc taaagaaagg atgcaattga    133560
     caaggaagac taatcaactg gctattcctg atctctcagg aaaggtaact gtgaaggatc    133620
     tactggaggc tttttcgaag tatgaaaagg aaatgtaagt gaagataaag tatccttggt    133680
     tcgtgaaact gagccatgat gagaactttg ggcagatact aacttttaga acaagcgtca    133740
     agcttagcaa gcaaaggaga tcaagagatg aggatctcaa ggttggatat gttgagtttg    133800
     aaacggttga ggatacggaa aaggcctatg gagagggaag catcaaggtt gggggagaga    133860
     tgaaggctct acactatgca aagagaaagg accaaagaat gagagaacgg gttgttgttt    133920
     ctaacaagaa ggtgtatatt tctggaattc ccgaggatac cgacaaggac gagctttctg    133980
     cactcttggg aaattgcagg atatctggag gagacaaggg caaaagctat ctttttgcag    134040
     agtatgacaa cagcgaggaa caggagaagg cactgaacag aatcaataac tcgaagatca    134100
     aaggctctaa gttgtttgca actcaagcat atgaaaaggc aaacattgga agaactggta    134160
     gaaagaggag cgattccaat taaacaggtt ttagttttta cactatgttc taggcagtcc    134220
     gttactcctg gggtttgatt atattttttc agctttctgg ccgtgagatg tcttgctttg    134280
     actccacgct tgtggtggaa acagacgcag tgaaggattt caagcttccc cacacacggc    134340
     agatgattct tgtgaagaat gtgtcttcta tccagagttc cccatttccc aagtatctcc    134400
     atgtgtttgg tagaagctgt atgtcctatc agcttgctcc attcaagttg ctcagaactt    134460
     ttgagtacag cgaagatgtg atggatgcag tggccatccg aggcaagatg gctgttctct    134520
     ctagagactc gatagttgtc tggaacaaag ggaaagagca agttattgca gggaagtttg    134580
     atggaagact ctcagaagta gacgggtgcc tcggagttca ggaacgggcc aagttgtcgg    134640
     tgtattcgtt ggagacgttg gaggtgatga aggtgtacaa ggcaaatgcc cactgttcaa    134700
     taagagacgt gcttgtgaca tctctggata atctggtttc tttgtacttc aaggggggaa    134760
     agatacttga gatttcgatg ccggaggcaa tatgtaagct gtgcaccgac ccactactta    134820
     caaacatata ctgtggaaca ggtagtggaa ccatattctg ctgcaacaca agcaatggag    134880
     agccaagtag tatgaagtac catagaagcc aggttgtggg gctgggcata agtttctgtg    134940
     gaaagtactt gtactctgca gacatggagg gtcttgtgtg catatgggat acaaagttca    135000
     acacggtggt tggaaaagtg tccatggagt cggaaataag gaggatgaaa gtggtatatg    135060
     tctccgagtg gagaaaagct ctggacacgc cagaggatga tctaataatt ccagggggga    135120
     caacaaaata aaaacggtga agagaccaaa ggttttatta tattgatcag atatttaaaa    135180
     agtacaggac atacgtctct agagtagtac agtcagcaac acttactatt aacctttcta    135240
     tttggattcc cgcgagagga aagagggctg tcaatgtccc atttttggcc tagtgcctgc    135300
     ttcttaagga ggatcattgc catgtcttca aagatgttgt ttacattttc tcctgtcttg    135360
     gcacttgtag tgtagtacct tgccttcatt tcatctgcct tctctctgaa cctaccttcc    135420
     attgctttgt acgaagcgct gtccaccttg tcccttttgt ttccaacaag aaacaaggga    135480
     acacctccag tctcttctct tatacgccca aaccatctgt ccacacacga gaatgttctt    135540
     tcgtcactga tgtcaaaaat aaggagtatc ccgtctgcat ttctatagta gctctttgtt    135600
     atagagaaaa acctctcctg cccggcggtg tcccagatgt taagcataat gttcttcccg    135660
     ttcagaacta tactcttgga gactgtgtcc actccaattg ttgtcatcaa agactgcttg    135720
     aagtcgtctt ccttgtactt gtggagaaga catgtcttcc ctacatcgct ttctcctaag    135780
     actattatct tgtagcggta gtctatccgt ggagcagcca ttctgattag gggctttgct    135840
     gttatttgca attgatccta tcctagaaac ctgattcttt gtgattgagg tatttgcagc    135900
     aggcaggcca agatgagtca aaacaaacca atgtgtgatg tgatctcctt aagaacaaat    135960
     aaaagaaaat tgacatcgat ataataggaa gccgagaata agggttatga cggatttgat    136020
     ggggagattt cggcacatat cgaaggaaca gagaagaaga taccctccca acattataag    136080
     gaaccagaag tacaagtggt atacgtttat atttgcggtt cttaggctgc agttcagcca    136140
     cttcttcaat acatttcttt tttttgtgtg catgacgcag ttgaagaaag agtatcttgt    136200
     gtcctctctt gtggcttctg tcgggccctg ggcgatggtt ctcatgtttt cacttttcaa    136260
     agagggagtg gaggactaca agaggtatga gagagacaag gttactaaca atcagttgta    136320
     cgcaaagctc acaagccagg ggtttgtccg ggtgcccagc tctcggatag aagttggaga    136380
     tctgatcctt ctggagaaga atgagcgtgt tcctgcagat atggttctct tgaaggcttc    136440
     agacgtgtct ggaaatgtgt ttgtaagaac agaccagctg gatggagaga cggactggaa    136500
     gttgaagttg tcgattccaa ggatacagtc agcaacattt gacgaggttc ggagattgag    136560
     tatacttgca gagcaaccaa acaaaaacat atactcattt gtagggaaga ttaagatagg    136620
     aagattttca ccggaagagc ttgaggaagt tgaagaagaa gatggagaga aagaaaggtt    136680
     tgcaagctgg ctggaaaggt ttttagagtt tgactttggt agagaggagt cggaagctga    136740
     cgagatggag aagcctagag acgtctcttg ggtctattcc tcgtctaccc agagcagtga    136800
     ggagaatggg tctcgagaga acagtctgaa gacccctagc gaggtaagtg agaattctgt    136860
     ctcttcggag acggcagaag gccttgaagt gggaaacgaa agcaacatag gaagcgaagc    136920
     aggggacatt gatgcaagtt tgagagacca agagggagga gagaacattg ctgaggtgct    136980
     taactgcgag aatatgctat ggatgaatac agttgttgca acatgctcag ttcttgggtg    137040
     tgttgtatac acgggaaagg atgcaaaagc aatgctcaac accactcagc caagaaataa    137100
     gataggaaaa atagaactgg agttgaacgg atatatgaag gtgctaggga ttggatgcat    137160
     ggtgcttgcg ggagtgttta catacatgcg ggggcttgaa tcaagacccg acattatatt    137220
     tatccggttt cttgtgctgt tttcgtcggt gatacctatt tctttgagga tcacagtgga    137280
     ttgggcgaga tactgctatg ggcgatacat aagcagggat gagaagatag aaggagcaat    137340
     gatgcgatca aatggactgc ctgaggagct tgggagagtg tcgtacttcc ttacagacaa    137400
     gacagggaca ctgaccaaga atgagatgga aatgaagaaa atacatcttg ggacgatatg    137460
     ttacacaaag gagctaaaca gggagatcag taagaatctg gccaaggtgc ttaacagcag    137520
     aagcgatgga aaaaaggtgt tttccagagg taagaagaac atcaacgcaa gggtatacga    137580
     cctggtccaa gcacttagtg tttgccataa tgttacacct gttgtttctg agaacgaggt    137640
     aagctatcaa gcgtcaagcc ccgatgaggt tgcaattgtc cagtggacag agtgtgtggg    137700
     aatgaagcta tataaaaggg atcggtcgac gatagttata agagaccctc tgaatgatga    137760
     acaagagtac cgggtgctct atacttttcc attcaccagc gagacaaaga gaatggggat    137820
     tattgtaagg tacaacgagg agataatatt ctttttgaag ggggctgatg tggtgatgaa    137880
     aaagatagta aaaggcaacg attgggttga ggaagaggca gataacatgg cccgggatgg    137940
     gttaagaaca cttgtcatag caaagaaggt tctcagcaag aaggagtttg agacctttga    138000
     ggaaatgtac aacaaagcgt ggatgagtct agtcgatagg gctgaggcaa taaacaaagc    138060
     aatggaaacc attgagaacg acatgagtgt tcttgggata acaggggttg aagacaagct    138120
     tcaggaagat gttaaggtta cactcgagaa tctaaggaat gcagaaatga agatttggat    138180
     gcttacagga gacaagatag agacagccat ttctattgca aggtcctcgc ggatcttcca    138240
     tagaggaacc tcatacctgg tgatcagcaa tgcaagttct gtgggagatg ttaagacaaa    138300
     gcttgacctg ctccgcggct ctggatacaa ctccctagtt atcgacggcc aaagcttgtc    138360
     gtttgtaatt gagagctgca tggacgaatt tattgaggtt gtctcggggt tagaatctgt    138420
     ggtagggtgt cggtacactc ccacacagaa ggcggcagtt gcaagagaat tgaagagaaa    138480
     gaccaagaaa tgtgtgtgct gcatcggaga tggagggaac gacgtctcga tgataacgga    138540
     agcaaatgtg ggaataggaa tagtggggaa ggagggaaac caagcatcgc tggctgcaga    138600
     cttcagtata aataagtttt gccatgtgtc ggaccttctc ttctggcacg ggagaaattc    138660
     gtatcaaaga acagcaaaga tagcccatct gataattcac agagggctta cccttactgt    138720
     gattcaggca attttctgct ctctcatcta ctttgtcccg gtgggtcttt tccgaggaga    138780
     gcttcttatg atgtttataa cagtctacac ctttcttcca atattttcca tcatatgctc    138840
     aagcgatata agcagaagcg ttgtcgtcaa gtttccagag ctctacaagg aactggtgga    138900
     gaacaagctc ctgtcgttta gacatttttc ggtatggatc ctgatatcat tttaccaggg    138960
     aacaatcatg atgataacat tctatcttct gaaacaagag ttctttatta tttcgacact    139020
     gaccttcaca agcctaataa tcaacgagct tctgatggtg atactaacaa ccactcggat    139080
     gacgtccttg gtgtttatat cttctgggat gtcacttgcc atctatgtcg tttactttat    139140
     ccttagaaaa ggtcttctaa gataccagaa gcctttttat ctctttctgt tgaagattgt    139200
     ggttgtaaac gctcttgcaa tactggtcag tgtaatccag aagctctgga ccaagtatat    139260
     gagccctcca acctactcaa aactagaggt tttggtatga gcttctggct tatcaataaa    139320
     tacaggtaat tagaagaagg cactttaaaa ctaagcattc aaggagggct gttttaatct    139380
     gttgaggaga cttgttcccg ttctgtccct gtcttgacaa tttctccaaa gaacagattc    139440
     aggaggaatc ttgcaattga agtatgatat atcctgtaga aaggattaca tctgagatcc    139500
     agcattctca aagagcctat cccctccttc ctaagcttca agagatacca tgggaaaaac    139560
     cttaatctgt tattagatag attgagtacc ttcagattct tcatattttt catcgagcgc    139620
     gggagccttc ttatcctatt gttagaagca tctacctctt caatccactc cagacaccca    139680
     aaatctgagg gtaattcctt cagcttatta tctgaaagat cgagtttcct gatcttcttg    139740
     ttccttttca gggcctccat catttcagga gatatgaact caaggtccat atcatggaga    139800
     tcgcagattt tcaaatcttc taagttttta atgatactta gtgcttcgtt catattgtct    139860
     gagcacaaga catgcatcag aaaaaaaggc aaaatgctga tcctgagttt agtattcatt    139920
     agaagggaga atttttgctt tattttaata aaaatttaat tctactacat aaaagtctaa    139980
     tctaccatct tctaactctt gggtactcct cgtccctcct tcccttcgtt cgcttagaat    140040
     ggttgtggtt tccttgtcca tccaatcttc ttctagacat tccataactt tcatgaggat    140100
     ttccgtttct tatcggcccc tttctcaggt tctctcccga ggctttggcc ccaccatcaa    140160
     accaagtgct ttttgttcct ttctctccat acaatagtcc ctgggattca aacaattcct    140220
     ctgcaagatc ggtagacact cgggcagagt gtatgaaacc acacttctct cccttttcgc    140280
     acttctcctt ctcattgtct gtgcacattc catcgtctat cctgtagcag tttccaagtt    140340
     ctgcagctat tctcctcccg ctgtagtatc tctttccaat ttcttcaaca catcttagtg    140400
     ctgtcttctc ttcttcaaac tcaatgtaga tatttcctag gagctgggaa gagctgttgg    140460
     aagcaataac aagtcttcga atggacccat atcttataga cagctcggaa aaccaatctt    140520
     cgtagaaaag atcaagatgg atctggatgg attccttgct cagtgtggat tctggatcat    140580
     tcttaggata caagtacatt ccttttacaa caacaacctt gcctcttata ggaatccgat    140640
     gggcttttgt gcactcaaga ccatatctgc atgcattggt ttttgagtaa aaaagacatg    140700
     tgtctctccc tgtagccatt tgctctgggg actctcggcc gatgaaattc tgcagagatt    140760
     tgatataaac tcaaatttct tccctataaa ggcattatgg agagcgaagt aaaaatttcc    140820
     attacaacct tggcaaagga aatctattct ggagttcttg gtagatacgc atctgggaaa    140880
     tacgttattc tgaagaatgt ggtccgaagg catccgggat ctactgataa caggagagat    140940
     gtctttgtct atccagtcat gaggtttaag atagaaaata tcggagaaat cggaatcaca    141000
     tggactccaa acagtggtgg aaaggagaat gggcttctgg ttttggaaag cttggggagt    141060
     aaggctagaa ttcttgaggc cgggggagat aaagggatat gttcaaggtc cagtggaagc    141120
     ccggagggtc tggaaggaac cagaggcgaa gtggtggaaa ggattctgga tacgcatagg    141180
     agtcctagga tagagaggtt gtttaggagg cttgacctag actgtatgcc cagcagagca    141240
     acccggcaaa taagatgatt tcgtttggtg aataaacatc tctgctgcag aacattgggc    141300
     tgacttctcc tggagagtcc ctgagatata cccttttatt atgacaaatc atctaattga    141360
     taaagctaag tttaaagaaa ccaagtctat gggtttcaat gtcaacaaca aacagtgatg    141420
     aagaccagaa gaggattctt tacgagtctc tttgcacagt cgaggctgag aacctaagcg    141480
     aggcgtgcac caacgccata gaagggaaac gaacagagac gggaaaaaaa gctcatatca    141540
     taagatttat tggagagatg tgctgctgtg gagacatgtt tgacacagat gcatttataa    141600
     acgagtctgt tttttcagcc atggcatata tagaaaagga catttccggc gtcaaggatg    141660
     tgttcatcag tgccgagtcg gaggaaaact ctaacaactg tgcaaagtta cttgaactga    141720
     atgagaagat agagtattcc tctgtccatc caaaggatgt tgcaatggga ttccgaattt    141780
     atactgagga aaacataaag aacgtaatcc cgcacaatgt tcgaaaaaag gttattgaag    141840
     cgtacaggaa caatgatgag gaaaagaaga aaacaataat ccctcgaatc ccgtttgtga    141900
     taggagattc gaagaggatg tttcttaagt ctctgaaaag cattttcctt gcgatcgagg    141960
     caaacaataa ggacgaggga gctaatgtgg agaagatata caggatattt gggtccctta    142020
     ttataagaag gcctgatggg atgcttgaca cagatggaga aacattgaag atgatactga    142080
     tggacttgat gaaagccgat tttgatgaat tccctgtttc attctactca tgaagggctg    142140
     tcaccttagg atgtttgaac tttataataa atcagcttct atgtctgaaa atgcaaaagg    142200
     acgttccggg tgggactcga acccacgacc tcagctttag gagagccgcg ctctaccaac    142260
     tgagctacag gaactgtacc atggcagggg aggttccatc acgccgactc tgcctggacg    142320
     gggattctaa aggatacatt gtgccaccaa acactatccc caggatggca aagaacagta    142380
     acatagcaat ccatagtcat gtaaagtccc tgggcctaga caatcttggg aggcctctgg    142440
     acgtgccgga tgcggtggtt ggacaggaag atgcacgaga agctgcaggt ctcatagtag    142500
     aaatggttag gacaaagaag atgtctggta gagcagtact tatatccggg cctgcagggt    142560
     gtgggaaaac tgctcttgct gttggaatca gcgaggagct aggccctgga actccattta    142620
     cctcgatgag tggtagcgag atatactcca gcgaagtgaa gaagaccgag gtccttgaag    142680
     aggctctgag aagatcaatt cttgtgcgga tgagagaatt gaaggatgtt tatgagggag    142740
     agatagttga tcttcggatt gtggatgagg aaaatccatt gagtactcat ggtagaagag    142800
     ttaaggagat atttgttact ttaaagacaa gcaaggagtc aaagaaactt aagcttgcac    142860
     catctctcta tgagcagata gataagcaaa ggatagtcaa tggggatgtt gtttacatcg    142920
     aagtcaattc aggagttatc aagaagttag ggaggagcga ggctcacatg aatgactttg    142980
     atcttgaagc cgaagcttat gtccctattc caaagggaga agttctgaag agaaaagagg    143040
     tggtacaatc tgtaacgctt cacgacttgg atatggcaaa tgcccggcct tctggacaag    143100
     acatgctttc gcttgttttc cggatactga gtcccaagaa gacagaaata acagaaagac    143160
     taagaagcga tgtcaacaag atggtgaacg aatatcttga gaaggggaat gccgagattg    143220
     ttcctggagt tctctttatt gacgaggtcc atatgcttga cattgaatgc ttcaccttcc    143280
     tccacaaggt catcgagtct ccgctcagcc caacaatagt atttgcctct aacagaggaa    143340
     tggctccaat taaaggaagt ggagggctcc tcgggccctt tggaattacc aaggacttgc    143400
     ttgatagagt tgtgattatc agtgtaaaga gcaactcaag cgagtcaaac agaaagatta    143460
     tcgagatgag gttgaaggaa gaagggcttg agatggatga cgacggactt gtgtttcttg    143520
     caagcttgag ctcttcaagg gggctgagat attgcataag tcttattcct ctgctgaaaa    143580
     catacggaag gagtgttgga gttagggatg tggaggaggt gagtgaattg ttccatgacg    143640
     gttaactttt ggcgattaaa tagtttaatt atcccccctg tttaggatga ttctgtgctg    143700
     taaatgtgga atacttatcg agccgagact gatgaacatg tgtgacagat gtcttgtaac    143760
     tgaagtcaca atatcttcca aggtaaagag aaatcttgtt gtggaacgct gcagaggctg    143820
     cgagcggtat cttcagcctc caaagagttg ggagggattt tcttggggat cgaaggagct    143880
     tcttcttttt ttgataaaga agaacaaaac actcaacggt ctctgcattg tggactcgaa    143940
     ttttgtgtac acagaaccga attccaaaag gattgtggtg gcactcacag tgtcggagtg    144000
     tggagtggaa cagcctttgg agatcaagta tgtgattaag aacatgcagt gttcggattg    144060
     tgcaaaggtg gaggcaaagc agttctggaa cagcctggtg caagtccggc acagaggaag    144120
     acacaaaagg atgatgatat atctagagca tcttgttctg aagaataatg catatggaga    144180
     taccagcaat ataaaacaaa gaaaagaagg actggacttc tattatatcg atcgaaatgc    144240
     agcgtccaga atggtaagtt ttctgcaaag tgttcttcca gtcaagacca aggtatctga    144300
     aaggctgata agcaaggatg ttcataccag taaatgcaac tacaagttca gctattctgt    144360
     tgagattgca cctctatgca aagatgattt ggttgttgtt gggagaagcc tttcgcagag    144420
     tcttgggatt gggagtctag ttcttgtcca aaagatagcc acaagcattg tcctttttga    144480
     tgtgggattg atgaagagtg ttaggattgc agggtcgttt tactggagta accaagatga    144540
     attcaaagtg ctgatgagtt cgaaagactt cactaaatat tctgttgtga tgagggatga    144600
     aagaagaagg aaaggaggaa taggatacga cctcactgtg acatccgatg gaagtgtgtt    144660
     ttccgaggcc agatttcatc ttgggaatgt agaggaggat gatgagattc tggggtatga    144720
     tcttcggcat ttgaacttaa ctgtggagtg tgaagagaaa cccgaagttg ttcttgtgag    144780
     gaagatgccc cgagacgatg ttgtatggaa aatagatgtt ccacaagaaa gccaaatgga    144840
     gtacaggttg tttgtagagg atgtggagaa tgacaaagag atggttgaag gcctttgttt    144900
     ggttgaagag aaagggggaa tagacaaaaa aatagaggca ttccgagtta gctgaggatc    144960
     tatgggcaaa ttggccatgc cgaattggga tatataatgg atacttccaa aggccttgaa    145020
     atgaaaggag gagaactaga aaaagccttg gacaaaaatg aaaacctaat agtttcgaag    145080
     gagggatgtc cattctgcct agatgcagta gagatattaa atgaatggaa gataaagttt    145140
     gatgaggtga gaaacataga gaatgaagaa ctctcgaagg agatagaaag gaggtatggg    145200
     atctccacat tcccgaagat tttccttaag agacgatttg ttgggggagc aagcgacttg    145260
     aggaagtatg taacaaaaaa agagtttgtt gatgcctttg gttctgaaag aaaataaaat    145320
     ttgcattggt cttatttttg gtgttccaag gaaaaaagga aaattcgtat agccctgaaa    145380
     tggaaaattt aagatttgag gagacaccca ccagtccaaa ggacataaga cctggaaact    145440
     atattaaggt tgaggttaat ggacagatga ggtctgcaca ggttgttgat acctcttctg    145500
     taaagaacgg caagcatgga gcggcaaaga caacgattgc atcaaagatc ctctgcacgg    145560
     gatcgaacca caagggcata tatactgcaa acgattccat cattgtgtgc aggcctgaga    145620
     aggtccagct caagttaatt gatattagcg gatcgacaat aacgttttcc gatagtaacg    145680
     ggtcatttga ctctgtcgac gtttctggga agatgagctc tgaggatatc agcaagattg    145740
     ctcaaagtgt tgaggggtct agcagcgaga gctttgatct ttcccttcga gtgcttccag    145800
     acttctacaa gctagaatcg atcaggaaat caggaggacc gtctggctct actgcaggag    145860
     gatgaatttc caggaggcgg gatttggata atgttctgcc caaatacttt caataaaacc    145920
     ttttctggat ggatttttag ctccaatgat ttatcttttt ctctgtatcc ctgagaatga    145980
     accaagtcag tgagttgcgg aagtttgaga catctataaa ttaccagttg gacaaagata    146040
     gactgagtaa gtttttgctc ttccatgagg aggatggaga attaacctat gtcaatcgga    146100
     tccgagagtc tgaggggtgt gttgagattg acactgagga catagcagta tacgatgaca    146160
     gtggacttgt gagtagaatt gaggggaatg caatgtctta tatgaacctg ttgtacacgg    146220
     tgatagacga gattttgctt gagaatggag aagcttttgg tggagaagag ccggaagatg    146280
     tctttttcca ccacagagtt tcaaggctta aggagagatt tcctgagaag aatgtgatgg    146340
     atgtgtttcc tccgtttcta ttgagaagat actctttggt gttgaagccg cggagaaatt    146400
     ccagggtgta ctctgtccgg gggctgaagt cgatgcatat tggatctcta gtgagggtaa    146460
     gcggggttgt caccaaggct agccaggtga agccaagtat ccgagttgca acatacatct    146520
     gtgagaactg tggtgcagaa acgtaccagc aggtggaggg agatgtgttt gatctattag    146580
     aagaatgtgg aagtgaaaaa tgcaggatta ggaatgttcg gggaactttg gttcttgtta    146640
     caagagggtc gaagtttatt aagcatcaaa cggtatacat ccaagagctt acgggggaca    146700
     ttccacgggg atgtattcca agaaccttgg taatggagtg ttactcttct cttgccgaaa    146760
     agtgcaggcc tggagatgtg gtggtggctg ggggagtctt tatgcccaag ccatatcatg    146820
     gaataaagaa gttgaaggct gggttacttg cagatactta tctccatgca actagtattg    146880
     agagggttgg gacaagtgct ccgaagctca gtggaaaagt gaaaaagtat cctgtggagc    146940
     agatggtaag atctatagcg ccggagatct tcgggatgga ggatataaaa aagatcttac    147000
     ttctgatgct tgtaggagca cctggaaaag ttcgttctga tggaatgaga ataagaggag    147060
     acatcaacgt attacttgtg ggagatcccg gaattgcaaa aagtcagctc ttgaaaacat    147120
     gtgtgaagat aagcagaagg ggagtgtaca caacagggaa gggatcaagt ggagttggtc    147180
     ttacggcaag tgtcactaag gaccagatta ctggagagat ggttcttgaa ggaggagctc    147240
     tagtacttgc agatggaggg atatgctgta ttgatgagct ggacaagatg aacgaggtgg    147300
     atagaatcag catccatgag gttatggaac aacagagtgt atcgatcagt aaggcaggaa    147360
     tcaacacaag cttaaatgcg agatgctgtg tccttggggc agccaaccct gtaagaggaa    147420
     aatacgatat aaggcagagc gttgaatata acattggtct tccatgtgct cttctttcca    147480
     gatttgatgt agttgccatc ctccgagacg aacctgattt ggaaagagat gaaagccttg    147540
     ccaaccatat cacatctctc catctggaag aggaaaccga gtctatttct tacgatgaaa    147600
     tccggcaagt tattgacgag gccaagagaa tagaccctgt ccttccactc cacctttcga    147660
     acaggctaac agatgcatat gtgaaggcca ggaaggaaag tccttatgtg acacccagat    147720
     atctcttgtc attgataaga ttaagcttgg cacactgcag actccgtctt tcaacggaag    147780
     tggaggaaga tgatattaat gaagcattaa gacttatgga agtaacaaaa attcctattc    147840
     caaagaaaaa gagagaagag gtttccagta agagggagat atacaatctt attctctctc    147900
     ttgccattga agaaggaaac aaaagatatg taaagctagc acgtctttgg gaggctacca    147960
     agaacaagta cagtactagc gaagtcgaag atgttatttc tgattttgcc tcgtgtggaa    148020
     tttggataag aaataacgaa gagctagtta ttttcaatta aaggatgcca tgaaaagaaa    148080
     tagtttttaa tagaagtatc caaggattct tcctccaaca ttttctgtca gacattcctt    148140
     gtggtcgagg atacctttgg atgtattgaa caggacatgt ccgaactgtc tagcaggaag    148200
     aagcctctct ctgaagttct caatcccatc tcgcttaacg atgtagttag gagaaatagc    148260
     tccgcatctg ttaagcctgc cgttcaggtc gataatgctc tttccacttc ttttgtcatg    148320
     tatataggaa aaccctgaga tatagccgta cttcagcatc tggagaagaa acatacgcat    148380
     ctcctctgtt gagaacttca ggaggagctg tctctttcct gctctactgg cattgttgat    148440
     agccttgcac atgttggcca attctgcgct catttcaagg ggcaaatttt tctctggata    148500
     atttgctcct attgctaagg caacagtaca agtgacatga ataatccggg tatccaacac    148560
     ccatgatctt cctccttatt ttcactgttg tgctggcaat cttcattaga attgtagcac    148620
     acctcatcac aagaagggga cctagggtga taaagtttgt tggacctcgt ggagcaggaa    148680
     agaccaagac acttaatgca ctgatgggaa ttcatggtag gacagtcccc acccttgaga    148740
     gctacaaggt aatatataaa ggtatggaaa tacatgatgt aattccaaag gatggaagct    148800
     tttttgaaag atatggcatt gatgatccgt cggcaaccta tttcttcttc ttaagaagta    148860
     tggacgattc ttatggaatt ccgggggcaa aaggattgaa tgtaagactt gtatattgtc    148920
     agccatatga tggcaaagag gccttggaga gaggtgtcct tgtgttggac aaggatctta    148980
     cccatataga aaagtatttc tcctagaaat cccaaataaa cttagatgga actatggctt    149040
     tttgtttccc atatcaagga tatcgtggaa cattccgtag aactggagtc ttgagttaac    149100
     accttcagat attctgaggt ttgccaaacc aatcacttta agaagttcgt agttctccat    149160
     gttctttgca gcccggaaaa acgagtttat cagatctagg ggatcaaact tctcatccca    149220
     gatttcatca aacatcttta aggcctcttc agcctcattc cttagaagtc tctcgaggac    149280
     tctttcaatt ctctttggag acggaaggcc tattattttg attatgtagc cttgatctat    149340
     ggtttccgag gaactgatgc acgcctggag gatgtttagt gactgtctca tatctccatc    149400
     actgagttca acaatgaggt ctaaggcctc cttgcttatc ttaatgccct catccttact    149460
     aatttccctt agtctttcca gaatcataga gttttctatt ctgtcgaatc tcagtattgc    149520
     acatctactc tgaataggct cgaatatctt tgttagagta ttacatatta agatgaacct    149580
     gcactccgag ctgtgcacct ccattaccct gcgcatggct tgctgggctg ctgtggtcat    149640
     tgaatccgcc tcgtccaaaa taataacctt aaagctacag tccttaatcc ttctttgagc    149700
     aaagcttttg atggtggtcc ggactgtctc tattcctctt tcatcagatg cgttcagctc    149760
     tagtagtcct tccttgctgg ggagaagttt tctagcgagt atctttgcac aagtcgtttt    149820
     acctgttcca ggaggtcccg caaacagtag gtgtggcatg tctttactgt caatgattaa    149880
     tgaaacaagc tccacagtca tctggtttcc aattacatct tgaacttcat ttggcctgta    149940
     tttgttaaca agtagatcca tcggggcttt ataattgttc ctgataacca ccttgatggt    150000
     agtagacgtt ctctaaaatg gccgctagaa ttacatttaa aacagaatgg agtatgtggc    150060
     agtactcatg gagccattgt tatacttatg aaactattgt ttcggggtct ttgttgataa    150120
     actcgtaaca aatgcattgg atagaatgct ggtcttcttc ttaggcctaa catttgcgaa    150180
     agatgcttgc gtttccgggt ctgcagaatg tgttgcaaac accttgagag tgtgcggaat    150240
     aaagaatcag tggatatacg ttgactgtcc ctccgggacg gagtgtgcag taaaaggcag    150300
     tgagatatct tgtgttccga atggtggaaa gggagaatta gagtcccatg acaagaagaa    150360
     gcctaagaag agggatgaat ctgaggcttc tcaaagcctt gaggaaaagc aagattcagg    150420
     tgatgatctc ggtgaaagcc ctgaagataa tagacaatct gaagacgata agccagaaga    150480
     gcccaatgaa gaacaaaaga agaaggtcca tgggaagaag ggggacgaag atcaagaagg    150540
     gaagaaaaag acaaaaaaag aaaaagacag tgatgagaaa accaaggaca agcatttggg    150600
     cttaggagaa gataaaaaga aaaacacaaa gggaaataag aaaaaggaac ctaaggttgt    150660
     aaccaaaaca gtaagtgtct tgaagaagga gaccactact actgtcactg tattgaagac    150720
     agttgttcaa aagcaacagc ctacagagat aaaattggaa tacacatcaa gtgacattga    150780
     atcgaaagtt aagcctgttg gctcttcatc accaggacaa ggacaagctt tgcagggctc    150840
     aagtagaaat gtttcaaagg cagggcaccc tacttctctc cctggtatcg agagcatggg    150900
     aggagccagt tcaccaggga aagcggggca aggtgcaaca ccggcagcac catcttcgtc    150960
     aggcagtccc tcctcaggaa agggtacatc ggtaggaagt agctcttcgt cagccccttc    151020
     ttcgccaaca agcaacaagt cttcttccgc accttcatct caaggcagca caccagagtc    151080
     acagggaaag gcacaaacag ctggtggagg cactggagga gctacccctt ctacaggttc    151140
     gcagggagga aagggagcag aaagtggtaa atcgtcagga gggtcggcag gaaagactac    151200
     tggtggaact agttcttctg caggttcgca ggagaaaaaa gaaactggag gaagtgctgg    151260
     ggggtctact caagcttcgg gaggatccca agggcagaaa gaatcagaag gtagtaaaca    151320
     accagaggga ggtgcagggg gaactagtcc ttctacagag tcccagggag gaaagaaaac    151380
     agaaagtgga aaatcatctt cttcagaagg aaaaggaggt tcacttctct cggccgataa    151440
     gctgactaag gtaatgacga atttgggata ctctcccaat tcagaatata tcgatgcagt    151500
     cgtccttgga gtgaacgaga gattttcgga ccttaatcag gctgtaatgt tcgtggctca    151560
     atgtgctcat gagtctggag gatatcaata tattgaggaa atagcgtgtg ctggaggaac    151620
     gggatgtgca gggcagtatg gaacaggagc ccccgggaag tcctatcacg gaagaggatt    151680
     catacaactc tcatggcctg aaaactacaa ggctgcagga gaagccctgg gtcggggaga    151740
     tgagctctat aataaccccg agaaagttgt agagaaccca agtcttgcag tagatgtgtc    151800
     gatattctac tgggagtcga gggttgcaga tgctcctgga gtgaaggaaa accattttgg    151860
     agccactaca aaggcaatta atggagcgct ggagtgcacg gggtctaata ttgataagag    151920
     caagaaaagg tatgagatat acactgctct tgttgaagaa tttggcgtta gcaatcctgc    151980
     cgatgaaagc ggatgttaca gttagtagga aagtatatca aattcaaagt cttgttatct    152040
     atatcaaatc tcgatttaaa gaattaaaca atttctttta cattttcggg atggtatagg    152100
     agctttgccg attacgtcat aggtatggct ctcaggatct atgtccagaa gctccaagcc    152160
     atggattgta tcgtttacag agagacctga ctctgcagat atattactta tagacacctc    152220
     ctgtccattt ttgttctgta atgtttccag caccttgttt ctccagtacc ttttgtatag    152280
     agcacgtcct cttccactca gaggtttctc tggggttcct gcttccaaga tatagcttag    152340
     atccaccatc aatgagccgt atcccttggc cctgtacgga ggaagaatta gaagacagga    152400
     tagattatgc tctatgcttt ccttttcctt actaaaaaac cctgtcgctt ttccttcgga    152460
     aaataggaca tagaaaagat atccatccac atcgagatat aaggtcttcc tttttataaa    152520
     ggcttttcca atgatgcaga ttctttggca taagactctc tctttctccc catcaatctc    152580
     aatcacagat atgtcctctt ccctgtcgct atatatacac tttcccggaa tttctaagga    152640
     acagcttctt ctgtggctag caaaggacat cgaatcccaa cattgaagca gacacctatc    152700
     acatatatat attgtgtttt tatccgaaaa cagccagact cggttgggaa agtctaaaag    152760
     gttatctcca aatacagctt gtgttacctc gacgcttctt ccctgaaatt tcataggcgg    152820
     gataggctct gtggactggt tttttctttt tatggtatcg aagtattctc tgaactcggg    152880
     gtctttcttc agcatgtcga tctccccatc gttaaggtcc atgggctcac cggaacacag    152940
     atataaacaa agggaatcca agtcctttta tggaagagca tattacaaga agggcagagg    153000
     ctttgaagat tgctaaaagc attataatga agtcggacaa ccctcccgaa gagttggtga    153060
     ggaagattct gatccaccag gagcttcttt caaatagaga cattatcttg aacgatgact    153120
     tctattcgat actgactagt aaagccaatg tccggccaga gatggttggt cttgcaagaa    153180
     agaaggaaca ggtagagtgt gttagagtgg agaagaaaat gatatgtcct atcagccaaa    153240
     aagaagtaac cgaggcatat gttggagaat gtgggcatgt gctggaggaa aaggaagcca    153300
     taaagtatat ccgaaataac tctcgggcta tctgcccaca gattggatgc aacaagagac    153360
     tcgtccggaa gaaaagataa aggctttact ggtacttggt tgttccgaga acgaattttg    153420
     attaaagttc tttgaccgtt ccccaggagg atgagggaaa agatgtatag agagagaaga    153480
     cagccaaaga accgcaggat gtatggaagg ttggagaaga aaaaagactt ggttaagaga    153540
     ctttcgaaga ttgggaagca gaaggaagag attagaagag ccaaagagga aatcaaaaac    153600
     aagagtggcc aggagtattt ctttggatat tattcagtgg aaaggaatgg ggcgaatatc    153660
     tacaagatcg acaggcccac tcttgaggag cttagaaaga tgaaggccta tgtcgataat    153720
     gaaatccaaa gatccaggat gaagttggaa agatatattc cccgaccgtg tggaacacat    153780
     ataaaatttg aagaggatag ctcttcgaag aatgatacag acattggctt tgagcacaac    153840
     gaagagacta gaaaagaatt tgagaagtat ttagaagatc taattgggaa gagaagggaa    153900
     attcaggaga ggatagacga gctgaagaac caaaagatat agtgtgtgaa caaagattta    153960
     tttcttgaac gggtattaaa aattactttt tccttctatt caataacgtc catggcagat    154020
     tccaggactt ctttacagat cggatgtcca ttagagcggc agaagtcaag gattgtcgga    154080
     ttgatggatg caggataatt cctatgcatc acgtatagca gcttgaggtg tttcagggta    154140
     accatgcggt ttagttcgcc acaaaaatat ctttgaacag gatctataga tatctttttt    154200
     ttcttctcaa gtatgtacct tagaagcacc ggtgtatttt cgtctctctt ctttaccaag    154260
     atgtctatca tgtcatccac atggttcaac gagacctttt tgagtgcact tccaagaact    154320
     tctgcctcct ttctggacaa atctagcctc agaatgttat atatcttact tgtcttggca    154380
     aggcggcaca agtcattcca ctttcccggt ggtagctttg gctttgcagc aaggatgtct    154440
     cggtatatct gaaagtcgga aggtctgtcc atctccttga gtgtatgaat tatcctatct    154500
     gaaagagaca tttggggtgg atgttttaga agccgaaaaa atttatccct attaaggatg    154560
     gaagatcagc aagaattttt cggaaaggtt acacaggtgc ttgggagaac tggaggatct    154620
     gggctactga cccaggtgaa gatggagctt atccataaca agagaatgat ccagagggcg    154680
     atcaaggggc cgataagcga gggggacttt gtcgagatat tagagtgtga gcgtgagcat    154740
     cgaagaacaa ggtagataaa gtatccaata aagatgattt aatgttcttt ggccgtttta    154800
     actgttttta gttgtttttt tgttgataag aatgaaagga gcctgggaag ctagaccccg    154860
     gaatgtgccg ccagaatgag atttacggga agcaaagcga agaggaaggg cacttgaact    154920
     atggggagat tgagaggaag cgcagagaaa gggtcgacga gttggcttat aggctattag    154980
     tagagagaga gaaagcgaac agaagtattg aagaggagct tcaaaggctt tttgagcttg    155040
     aaaaagatcc tgtagacaca gaaactcatt cctcggaaga gcctgcaaag gagatagaga    155100
     catatagtcc tgttattctg gaagaacatg gacttagtga agagttatcc aagaacaatt    155160
     ctggaatgca acccttatgc tcgacaaacg tgccttttac tgacgagctt gtctctagat    155220
     tcattcttaa caaagcctat gtgtctatag aagaaaagat ctggagggaa aggcagacta    155280
     tgccaaagaa catacaaatg caaactaaga ttcaagtcaa taaaagactt acccaggtta    155340
     gcggaaaggc tggacaggtt gacagaatat tcaatgttct tagggaatat tctcattcat    155400
     acgtatttgt agagacattc acggtaaaga ttatagagca gggaagatta caagtgagtt    155460
     cctgtcctga gtcgtataaa gaatttgcag agctcttctg caggttttac tcctctgaat    155520
     tgatggagta ctttcgagtt attttgttta ctagagaggc ttcttccagt actatcaagg    155580
     gagtttacag tatctatttt ggagtactag aaattcaagg gaattctgac gaggcatggt    155640
     ttttcattgc atcgatgctg aactcgaggc agagcgaact gtcctgctat gttgtagaat    155700
     gttttttttc tatacttgga aacttgttat tcagaacatg ccgaggacct ttcttcaaac    155760
     ttatagaata tgtcaagagg tactacttca gggagatgaa caacgagcca tgtaaaataa    155820
     ggatatcttc gatgtttgag agatatgggg catgatgtag acaaggacat gtgtcacatg    155880
     tgtaagtttt tggtaagttc caattttgat gccccgatga aacttataac cgacggagtc    155940
     tggtctcttt caagaacaca tttaagaata cttcggactg cagagcaatg catgaagtca    156000
     cacgtggtta ttccctttga tgtgctgaag accagatcac aaataaaagg caacttcatg    156060
     gagcatgtga tagatctgtg caaactcaag ttcctttctt atgtggagaa tggatacaaa    156120
     ctgacgtact ctggacatga ttgccttgca attaacacac tgaggtcacg cgggcttgaa    156180
     gcaatgggag aaaagatagg gattggaaag gagtctgaca tttatctcgg ggtgtacaag    156240
     ggaaaggatt caatattgaa gctccacagg cttgggcgga gcagttttcg aaatgtgagg    156300
     agaaatcggg aatacgcagg ggagaagaca gattggcttg cattgtcaag aacttcttgt    156360
     agaagagaag ttgagtactt ggaaaagttc aaggacatga atgttcctgc agtacttgac    156420
     catgacagac atgctattgt gcaggagttg ctggattatc tccccttata caagacaaga    156480
     gtggagaatg tgaagacgat tttttatctt atgatagact tcattaagga cctatggaaa    156540
     agaggatatg tgcacggaga cttcaatgaa ttcaatgttc tggtgaaaga cgacataaag    156600
     gtcatagact ttcctcagtg catccagagc aacgatgaga gagcagtaag ctacctgaga    156660
     agagactttg aatgcgtcct aacatatttc aaaaagaaat acagatacga gccggagaat    156720
     ggatgttcta agtttatgag ggaattgggg atagaagact tcctagatga gcctgagact    156780
     tatgggactg attctgagga ttcatccctc tattcgactg atgaagtggg ttcccaaaag    156840
     gagatggagc ttctagagac aaaaatggag aagactttca tttctgatac ccagagtgca    156900
     taaagattat ttatttccaa aggtgttcct taatctacct agtaaagacg ttgcccgaga    156960
     aatgtcattt ttatattcct agagttagag ggaattcact tacctgtaaa atgtcgttgt    157020
     atctatcaag aacttcttcc agagacttct cgaaactatc cattggtagg gtgtctttgg    157080
     atgatttcag gaaataaaaa atttaccctg gaaatgagcg atgaccaagt tctgaaaagg    157140
     tttatgaaga atggacttat gaatgcagag ctgaaggagt tttttgagaa ggcacttgtg    157200
     aatgaaggct ttaatactat ggagcttcgg atgcaggaga ctccgattaa gattatttta    157260
     aaggttgcaa agccacacga ggcaatagga gaaaagaaat acaggctaaa gcaattccag    157320
     cacttagttg cccagaggct tgaggttccc gatgaaaatg tcgagataat tgttgaaaag    157380
     gtccacgaaa agggactctg tgcacttatc caggccaatt ttatcaggga gaagatgctg    157440
     ggaggagtac agtacaggag gtcggttaac atggccctga aggctgtaag acattcggga    157500
     gcacaaggat gccagataat agttagtgga aagctgaaag ggcagcgtgc caaatccgta    157560
     aagttccagg atggagtgtt aattcacagt ggaaacccag tcaaagacta tattgatacg    157620
     ggatatgcca cggttgaaac caagcaggga gtgattggaa ttcaagttag aataatgctg    157680
     ccatacgatc cggaaggagt gcttgggcca agctaccctc ttcctgatag gattaccatt    157740
     cttgagccta acgaaattca ataattaatt aaagctaagt caaagtattt atttcgatgt    157800
     agtctctagg gattcggaaa ctcaagctta ctgtcttcgg agagaagatg gtatatatct    157860
     cttatatcgg tgtccttctc tgcatctatc catacaaacc catttagccc caatgcaatt    157920
     ctaaatctgt atttctttcc tattgtggcc aatgtggtac tcagatagag aagacgtacc    157980
     ttccaaggct ctaatggaag cacaaccccg cttagctttc caaagccctc acccacacat    158040
     gtgagtagtg gctccgtacc tgttctcgca atcttacata aaagatagtc tcccttgttt    158100
     atctccggtt tgtttctttt tgtggcattt gtaaagctga gagaaggaag tgcaccaacc    158160
     acgcctccaa gatctatcct atgcatgtcc tgggatgtga gtatagcctt ccctatcaca    158220
     atgtcgtcga tgcatggatg gtatcgattg gttttcgata ccacaaacag atgattggat    158280
     gttttgcaca gtgttcctac aattgtcgcc ttggttccat ggattccaag agattttgag    158340
     ccattggaag gcacatcgtc tccgggaagt acatttttta tcttagtcag catttgcaga    158400
     ggagaaaaat atcgaagaat tattgggaaa tcccaagggc ccataatgaa tgtaaggcca    158460
     aggaaatctg catcaaaata ctcctttgaa ccgaagattc ctcagaacca agagttattt    158520
     gaggtcgaag agtctaaaga aaagaaggag tttgtacttg gagaccaagg agaatatgct    158580
     ccaaagtcta tggaccaagg ggttgtagag tatccgttta tccttggaaa ggaggacgga    158640
     gttgtcctca ctctcccttc caatgcccta acatcgaaga tcattgtata cgaagatggg    158700
     agctgtggac taaaaattgg agatgagatt cacccgattg ccacaagatt cattggagag    158760
     tctcttgcta tcgagcacaa ggatatggca tataacatag gaagtgctaa gtttcagctg    158820
     actccccaag tccaagacag tttaaaagat aaaagtccat agaataaaac atagcgttta    158880
     gtatccaaat atgttcttga tgatcaagtc atagcaaatc ttcccgtctc catcgggatt    158940
     caaaatgttc aaaagctctt caatctcttc ttgactaaac ttattttctc cagaagaaag    159000
     aatctggaca agccttcctg catcgatgtg cgaggtattt tctgcatcca gtcttcgaaa    159060
     ggacttttgc agttcctcgc gtgttatctc tctttcccgg attttctcgc agatctctac    159120
     aagctggctg aagtcaaaca tctctccagg aactgaggcc atgagctctt ctgcataact    159180
     ttcagatatg atgtatcctg caaacctcaa gatatctccc aacctgtcgg tgggaactct    159240
     ctcagtgggc gactctgcaa atagttggta aaccttttga aggcgttttg tctcctccat    159300
     cccgatgggg tatattcttg gccaagacca aatggctagg aggagtaact gtttttcagg    159360
     catggcggga gtcaagaacc cctagcaaag caatcctgtc tgcttccttt accaatgaag    159420
     atgacttatc caaaaccaaa ttaatcgccg gggaaattac ccaaacaaat cttccgaagc    159480
     gaaaattaga tgaagagatt aagcattgca atggtatccg acttctttta tccggtaatg    159540
     gggggagtgg agacccatat aaggtatttg agcgaggagt tgatttcaat ggggcacaag    159600
     gtcatagtca ttacacacaa aataggggac cttgttggat gcagagctgt gggaaacata    159660
     aaggtttatt ttctcgatat tcctgtttta tgcagaaaca caacattccc aagtctttac    159720
     tccaaccttc ctctgttcaa ggaagtcttc gataacgaaa agatcgagat agttcatggt    159780
     caccagacaa tgtcgaacat gtgtattgag gctttatttc atgcaagaac attgaacctc    159840
     aagacagtga tcacagacca ctcgatattc gaggtgggtc cctttgagaa cattgttgtt    159900
     aactccctgt gcagacttgc actgaagaac atagacagat gcatctgcgt atcctacaca    159960
     tccaaggaaa acactcatat cagaaccatg atcccccttg aaaagatcca cgttatcccc    160020
     aatggaatag tctcggacat cttctatcct agggaaaaaa agcagtccga tgaaagaatt    160080
     gttgtggtag catctagact tatgtttagg aagggaatag atctgctcat tggagcaatc    160140
     ccactaatct gtaagggaga tccagaagtg aggattatta tagtgggaga tgggcctatg    160200
     aaagaaggaa tcgaacaggt tttagacgaa aacgagcttt acgacagagt ggagataatt    160260
     tgtgaggtag atcacggaga ggttggagat ataatgagaa ggggtgatgt ctttctcaat    160320
     acatccttaa cagagacctt ttgcatagcc atagttgagg cagcttcgtg tggcctccat    160380
     gttgtaagta ccaacgtcgg tgggatccat gaagtcttac ctccagacat gataacattc    160440
     agcaaaatta catctgaaga ccttgccgag aaagtactga tggctttgaa aaaaaacaat    160500
     cataatccgc aggattataa caaaagactt agaaacatat atagctggga aagagtagca    160560
     aagatgactg aaaaggtgta tgttgacatc aaagaaactt ctctcagcta cttggacagg    160620
     agaaaggagt ttaagggcgc cacaggcttt atttcgagat tcatgataac catggagtat    160680
     atattcctct ttttccttgg tggaaagagc aggtaagaca gcggtagcat tatttatcca    160740
     ttggacactt tattgaaaac taaaatctgc tggaagctcc ttgatggtgg tgttatagaa    160800
     tctttcgatt gcctttaggt tttttagctc atgttcataa actatgttta tagctattcc    160860
     ttttcttcca tatcttccag accttcctat cctgtggatg taagtgcttt tcctctcgaa    160920
     cgacggcaca tcgagacaga acactacaga gagattctgg atgtcaattc ctcgcgaaag    160980
     caaccctgaa gagatcagac atcttccagt tcccccacgg aatctgttca aagttctttc    161040
     cctctcagcc tgtgttagtt ctgcagatat gagctcacac tcccactcat gcttgatcag    161100
     ccagtcatac actattctag catcctcttt actgttgata aacacaattg attgacccaa    161160
     gcgttgcttg cggaatatat catatagagt tacaagcttt ggaagtagat agtcttctct    161220
     tccctttcgg aatggtggct ccttcttcaa gtcgatgaag tattgcctta ttccttttag    161280
     tgtttgatcg ttgtacctta gatcgattat caccggatta ataaggatct cctcactaac    161340
     gcgaagctcc tcctcatcgt atgtggccga aaacattgct atttgaacct catccttgtt    161400
     tgtgattctt ctgaatattg acttcacctg ctcctggaac cctgccttca gcatctcgtc    161460
     ggcctcgtca atcacaaata atttaatgtt gtccatgttc agctcgttta tgttgatcat    161520
     gtgctcaact cttccaggcg ttccaacaac aatatgaggc ctcttctcaa gtgctatctt    161580
     atctgcagaa ataggactcc ctccagaaag caaggctact cttgctccca taaaacatcc    161640
     aagatcctca aatcttgctg cattctgtgc tgcaatttcc cttgttgatg caagtacgag    161700
     gatctgcgta acatcctggc tcatatcgca tatctgaagt gctgccaccg caaatgctcc    161760
     tgtctttcca gttccacttt gtgcctgtgc ccttatatct ctcccgtcta ttattggctg    161820
     gattgctgcc ttctggataa atgatggcgt ctcaaaccct atcccataaa tccctttcaa    161880
     aaggtcctcc ttcagcccat aatcttccca cgtatcaaac atccgaatct gggacgaatc    161940
     gcttctcaga tcctcaaaat ccctaacttc cacattgcta cttttcaagt cttcaaaatc    162000
     ttcctctcgt tccagcgcct gtttcatagg ggtaaatttt tcttcaaata atttcttttt    162060
     cttcagcaat cttccttggg attactaaga tctatatgct tcccccacaa gaaagccctt    162120
     ccatgagctt gtctctccat gaaagaaagg aaagaatcct caaaagactg gagtttaccc    162180
     ttgaaaacac acattccatc atctgtgaca taaataccag gctagaaaaa atagttgaca    162240
     attcaaaggt ccttgagaga gttgtagatg cctatgaaat atggtcccga aaaaactcct    162300
     tctgagatat gtctaattca tccaaataaa gcttttttcc aaaatctaag catctaacct    162360
     gaaacattcc tagctcaaaa ccatgcctga gagtcgtaaa catggccaca acactggctt    162420
     ctggatatgt gacactcctc aagacatcta taggtagtgg cattctttcc tttccttacc    162480
     tattcaagac ttacggaatc ctcacaggaa ttgccttaac aatggtctca ggctttttct    162540
     cggtactggg cctcatcctc tatgcaattt gtagccagga actaggaaga actgctactc    162600
     tctcaaggct tgccacagag agtatgccat atacaaggat aatagtcgac ctttctgtat    162660
     ttctcaagtg ctttggagtt gcactttcat atctcataat cacaagacag cttctgccag    162720
     tactaataga aacaatcttt ggggcttcaa ttctatctga tccaaacgtt tctctcctag    162780
     catttatatc atgcataggg ccctttgcct acttcaatag actggacaag ctaaagtaca    162840
     catctctatg tggggttatt gcaatagtcg tagtggtgat tgcatcactc tacaggtacg    162900
     aatacacccc agtctctgca acgaattcca tagagtattt tgccccgctt tcctacgcct    162960
     gggccggcgg gttcggaaag tttgtattct ctttcacttg ccaccagaac atattcgcaa    163020
     tccattcaga aatggaggac aactccttcc ccagaatgaa gagacttatc tacatggttg    163080
     cctcctcggc tgccatcata tacatttcct ttggaatcct gaactatctt ctttatggaa    163140
     aagctgtcaa agataatgtc ctagaaaact atccaaacga cgtcttggct tctgtagtta    163200
     gaggtttgta catagtggtc atgggtgtct cctacccact ccaggtaaat ccttgtagaa    163260
     gccatctcat aaacatcatt gccttttcac agagatcaga aaagctcctg agattcgccg    163320
     tcacaacagg catcatcata tcaacatgtc ttcttgcagt ttcggggatg agtcttggta    163380
     tcatatactc agtaatcggc gcaaccgcct ccacatttat gtgtctaata ttccctgctc    163440
     tcttctactt caacatgaac atcactaaac caaagggact tattttccta tcctatacgg    163500
     catttctgtt tggaatcttc gttttcagcg catctctctt cagcatcata cttcgcaaca    163560
     tctagcccac tactcctaca aaaatttatg ttcttttgtt ttgtccagaa acatgaactc    163620
     gaaggaaata gaaagatact tcagaaagaa aagacagtat ctgagtaagg aggagtacag    163680
     gacaatagtt gaggtattaa ggaggctgga aaatgccgaa aaaacctcaa acaagcacct    163740
     tgcagaggag atgaaaaaca aaggaaatga agaatacaat gccggagatt tccaatcggc    163800
     tatagactca tatacccaag ctatcatcta cgacccgact aacgcagtct atctatcaaa    163860
     tagagctgct gcctactcaa agctcggaat ggtagaaagt gcaatcgaag actgtgaaag    163920
     aggactgaaa atcgattgca aatttgtaaa gctatatata aggcttggaa tgctgcatct    163980
     cgacagagat aaggaaaagg catgccagat cttcaaaagg gggctggaga tcgatccaga    164040
     aaacaagaca ctaaaaagac agcttgccct ccttcaggaa aaaactcccg atcagtcttt    164100
     gaaatcttcc aaatccccct ctctggacga catggtcaag aacataaaca tggaagccct    164160
     taaagacagc aagatcgatt tcaactcttt tttcaacaac aagaacatta aagatgtctt    164220
     ggatacagtc atcaaagaca aatctcctaa ggatctgatg gaaatggtca aagatgtgat    164280
     tgaggcaatg ggaggtcagg actgcaaaaa ataaatcttt ctaatggcat gagttttcga    164340
     agaaagaata gaaacattag acaaaaatgt agttccaaaa ctatgagaag cacagaaggg    164400
     ccttcaactc tcgaggaacc ctcatgtccc atgtgtgtaa cgaatggatg gaataaccac    164460
     tattctgact aaacatggga ggcaaaagcc aggggtgatc ggatctacta aattaaacaa    164520
     aatattctaa tttaatgaga ctctgcacac tctcccggac ctttgttcac ttgcctagct    164580
     cttctaacca agtaaaatta gaagaaacat cagtcaagtc aatccagtca tgaatcccag    164640
     tcttccattg gttctatcga tatagcatgt tttctttaaa atcatcctaa tcccttagaa    164700
     catgaagtat tgcttttgca gatgtttcga agagtcaaag aacttggtga agataggcct    164760
     tgttgacagg atattcagaa gagatgccga cgaaaaaaca aaaagcatgt gtcatcttct    164820
     ttgcctaaaa cttacaaaca acggaaacat aaaaagaaat ggaagatggg gattccaacc    164880
     agtcctagga atgactgagt tcttctcagc ccttttttcg ttcatgaacc tcataacaaa    164940
     catcttctgc ttccatagaa tgctgaagaa acaccttcgg gtgacaagat tgggtaagct    165000
     atactacatc caatactaca tatgcaacct ggcattcatc tccagtaccc tctttcacat    165060
     tcatgagacc ccctttacaa gaaattgcga ctatttccta gcatttctaa caattctctt    165120
     cggtttctat atggcgcttg ttagagtcat cctcatggca agcccttcca tggaaagagc    165180
     cataagaaag ccactccagc ttatcttcac tctgttctat gcataccata ttcacagaat    165240
     gtccaatata gaatttgact acgtatacaa taagatatcc tgcaccatca tcatcgcatt    165300
     cacccttttg tcacatctga taacattcct caagtaccga agaatggaac actccaaaaa    165360
     catccttctg ttcacatttt tcttctttct tgcaggagca atagagatcc aggatgtgcc    165420
     tccatatgcc tatctcatcg actcccatgc catttggcat ttgatctctt gcatctcaac    165480
     gccgttctac cttctcttct ggagtggaga cgtctatatg cattgatcct atacaataaa    165540
     cctcattctt atccataata aattgatttc ccttattgtg tttccccttt ctcctattga    165600
     tcacaaaata atatcctatc aactaatata taatctgttt tgatttctgt ttaattatcc    165660
     taatatggaa aagatgttat atataaagta agacccattc taccctacca aatggatttc    165720
     aatcaactta aaagacttac ggagtatgca aagataattg aaggtatcgg cgacaaagaa    165780
     gccgtaaaac acctagaaag tgctattgag tcctttctta aagaagttga aagcctcttg    165840
     gataaagtta ctaatcttgg agggaatttg gaaaaagctg cagaaggagc cgatagtgaa    165900
     gggatttgcc aaaatgcctg ccagaaattg actaatctat ctggtcttct taaaaaagct    165960
     aaggaaagtt gttgtggaaa ggggcctcac aagtgtacta ccttattcaa gagtattgat    166020
     gatgtactca aggaagtcac cgaagaaggt cttgataaca cacttggagg actcaaagat    166080
     ttcctcggaa tctttaaggg ggatgaaaca ttaggagagg atattcgtga agaggtaaaa    166140
     gcaactacaa caactattga gaagtttttg gaatctaaat ttgatgataa attaacggaa    166200
     gaaactctta gttgctttaa gaaatgcttt agtggaacag tatgcgaaga gcaatgcgcc    166260
     tccgattttt cagagggtct tcagggaaaa gtagaccagt taaaaatatt ggttgacgaa    166320
     tgcccaaaag aagaagttaa gggtcaactc actgaacttt ttgaacaagt ttgtgctttg    166380
     tctaataaca ttcaggagat ggccgctgca cctgagaatg tttttaaaca ttcttgtgga    166440
     caacttgcta atttttctca agtaagtgaa gaattccgtt cggaacttag aaaggtgaaa    166500
     ggaaccttga aggatataag cgaaaaactt attgatttag aaaagaaaag tgaagaaatt    166560
     agaaaactta caagaaaggg attttttgaa agacttcaag atttttacca aagactcaag    166620
     gaaaatatac tgtcgataaa cactggaagt ttatatggaa atctatgctt ggcattcttg    166680
     ggaattctgg tcatacagat catcatttgg agctttggaa gggaggatga agagactgat    166740
     ttccaaaaag catggaatac gacagtatac ttcatagctg tagtggtaag tattatatat    166800
     ctccagtggc tggcgaataa gggatataaa agtagcagtg gcattggaga tactctaaag    166860
     aaagagtggc caaccatttt gagcacaatt ccgatgatga taggaattct gaattttggg    166920
     ccaataaaga gcagcattta tgctttgaca atggctgcta ctgctgtcgt gatgctttat    166980
     gcacagaatc ttgtgagaac aaacaatatg tctaaaaagg ggatgctctt agttggggtc    167040
     gggaacttga ttataatttt ggcatacttc actgggcctg agtcgtcttt tatgcctact    167100
     attagtggtc ctaactaccg tgcgtatact gcacttatca tattcgtcat tcttctcctt    167160
     atcatatcat acctggaacg aaacctccca aaggaggagg tattgaaaga aggaacaccg    167220
     ggaacgaagg gacttgccta ttggattagt tacgcattgt tcgcattaac gctgatcacg    167280
     gttacttggg tgtcttacat ggcaggaagt gactaccatc aactttatgg ttccaacaat    167340
     agcactaagc ctttaaacga cgatttcttt aattcatgat taacaataaa ctttattcat    167400
     gattaacaat aataaaaaat ctttttgttt agaataagac cttacttctc cttctcaaga    167460
     aagtgatcaa agtaattaaa atacaattct tttatgagtt gaaagcgtat agaatagaca    167520
     aaacttcttt caagtggaat tctcttccag gctctatatt taataatatg agcacattgg    167580
     atggaatgtt tggagtcctt tcatatcttg tgcctgttct ctatataagg taatccttat    167640
     attagaaatc aaaacaaacc ccaaggatgt ttggaattat gcttggcact gttttttttt    167700
     caggttatgc tatggccgag gcagtccaca tgcaagacag cactctactt gacaatctca    167760
     agattgttcc gagtccgtct atgattggaa tggtaaggga catgaagagc attgtttcgt    167820
     atgtatctga agatgagaag tttgatgggg agggaattaa gataaagcat gatggaagaa    167880
     tgtttgttgt ttcaaaagct gaggatgttg aaggagctgt aaacattctg aagaagtatc    167940
     ctgcaccgac agaggaggtt attaaaacca taaaatcctc tgatggaaaa ggaattgagg    168000
     gaaactttat catatacttc ctggacaatt ctggatacaa ggagaagctt gtagggagta    168060
     gagaagggtt gaatgtgttt gtgtctactg atcctgccct tgcatctctt ttggatgctt    168120
     ctattccagg aatatatgga tataatggaa gggataggct ttcgtacaag ttccccttta    168180
     gtgataagaa tgccacaaaa atcttttcac tgaccaatct tccgatattt ggatttactt    168240
     ctgcagagag catttcgttg tataggtcat tggatggaac cattttctat attttcttta    168300
     atccatccag cagtttggat gtccttaatg ggtactctgg agttttggat gactttaggt    168360
     acgatgttcg agtgatactg attccaagtg tcaaggacgg catcaatctt gaggactacg    168420
     ggctaacgga aaaagatctt ccaggatgca tatctatcag cgaggacgga gggaagtata    168480
     tcctaaggaa tgtgaccaag gaaagcattt cggaatttgt caaggatgtg ttgggaggaa    168540
     aagctgaggc gttttataaa tcccaggagg aaccaaaaga taacggcagt aaaaatgtta    168600
     aggtggttac tagaaacaac tccaagacat accttgggga tgtttccaag gacagactgg    168660
     ttgtatttgg aaccgagaga tgcccgcatt gcatccgaat taagccgaca cttgaaaagt    168720
     taggggagat agtaaagaac aatgcagatg acaaggtgtt tattggatac tgtgatgttg    168780
     atatgaacga catgaatgac gttgagattc gctttgttcc gaccattcta ctttataagg    168840
     ctggagaaaa caagagcatt cagtactctg gtggagaaag aaacctcttg aatttaatta    168900
     cctttatccg ggagtctgga agcctaggtg ttgatctttc gaagtttgcg ggtcaggaag    168960
     atgaatccga gaagaggaag tttgaggctg gcaaggaggc cactgggtct tggggagaag    169020
     atgcaagggc agaactctaa tgaattaaat gtaagtcctt ggaatccttt tttgtatatg    169080
     tcccttctga agatggatat cccaagcatc attcttaggc ttttaacaga tggaattgtg    169140
     gatggagagt atcatgattc tttgagttct ctaaatgagc tcctcaggcc tatacagtat    169200
     gaagccgttg gatggccaga tggatcatgt attgttctaa aggataacca tagttcatat    169260
     cctcctgatt ctagaacaaa agaaatagag gatgtgttca aaaaagttgt acgggggatt    169320
     tctgtttctg gagaagtggt agatatgctt attagagaga gatggatgga aagcacctca    169380
     gaaggatacc gattgagtaa aaggtcatta gtgcagcaca aagactttat tcttggattg    169440
     ggagaaggat acacagtatg tgatgtttgt ggatttctta gatctgagaa tgaagttcat    169500
     aagttctgca aggaactttt agaaagcgaa agaggctttg gaagaaaaaa gaattgatat    169560
     cccattacca ggaaccccag atgactgtgc tggaagtgga atttcccttt agaattggta    169620
     ggagacatcc taagcttaag gtggatgtta caatggaaag aaaagaagat ttggtgtcct    169680
     ttgacatgga atacgatatg gacttggcga tagataatgc agaaccaaaa tcaaaagaaa    169740
     gggctggagg aagatttata cacgtatata agtttgttga tttggatagt gcaatggagt    169800
     ttatggaaag taggaaagcg aaggccttgc cccctaaagg attgctggat gtagagaggg    169860
     tggagaagga gatggactta tttatggaaa gatacgaggc aggggaaaga aaagtcaaga    169920
     agaagaaaaa gacaattgtt gttagcgaag atggattcat gaaatatgca tgagcagcca    169980
     aagccgatcc aagaggtctc caaagaaaga aacctttatt atcaagacaa cagaaacata    170040
     ataaactctt ggatgacaac tattccaaag agataatatg ctcttctcat cctttctgct    170100
     cccttgtcca tcacgcgtct cttcaaactt ctgctaagaa atacaaagaa acttacatac    170160
     agatacattc ctccaatcac ccgcacatac tggattttgt tcaggcggag gagcacggca    170220
     atgacatact tgtatccact gtatgctatt acatcaaggg tgcagagagt tacatcaaca    170280
     aagtaaccag agactctcat aaacaacaca cacatggctt cgaggaaaaa cagcctagta    170340
     aacacaattc ctagcttctc ggggctaaac actccttcaa gcccgaggtg taatgctctc    170400
     accaagacat aggagataaa gctcataact ggaatataaa gctcaggcct tgccattcct    170460
     tcatcgtcac ttgcccattc tttgttattg aatggaaaca ggatgagcac aagcttcttt    170520
     aggacaaatg tattgtctat atcgaaatat gtacggaagg gttttaaaga caccccgcta    170580
     aggcctttgt tagcatattc agtactcctc ttaatcgctt cttttcctat ttctatttcc    170640
     atgggtgttt tgatccaaag cttcatcaaa gcaaaaatat cctaccacgg tcccagagat    170700
     ataatttatt aatcaactca tatttttctt ttaaacttct ttggcatctt ctccgtttct    170760
     ttgatgtcat ttcttgttaa gtcaaagctt actcgcttat catttctttt agacccttcg    170820
     tcacctcctt ttcttctttc tccaaatcga aacacctcct ccttatgctc ttgcctctcc    170880
     gacttcttct tctgcttttt gagttttgag tttttcttgg aatcttcggg ttgcaagtca    170940
     tcctttgtct tcttgtcctt tgatattcca tttatcctat caaacactct ctggattacg    171000
     gtgcttgttc tctccacttc ctcattagtg cgaagagact ggatcttctt atcaataagt    171060
     gatttgagtt ccagtccgta atccggagtc ctatccttcc caaaataatc gatctttgcg    171120
     gcaatagagc attttgttgc aatgtaccta cagatccttc ctttgtcttt gtctcggacc    171180
     ctcgataagt aactggtagt atagataagc ccatactttg gtgtcttcgt ctttgtcttc    171240
     agagacttga acagagactt ctccgctcca agaagttgaa atgtagatgc cggagccttt    171300
     gcaagattta acaatcctcc cccttgcgaa atgagccttg ctgcaagcac atccccaagt    171360
     atggctgcaa gattaggcgc aatagattcc attttgtcct taagatattt agacaggcct    171420
     tttctgattt caatcttatt gttcactatt tctattaact tcttcaagtt aatcatgtcc    171480
     acaggagaaa gtttcatacc catggaattt cttttcagtt ccttgatctt ctcaagcttt    171540
     tcaacatcca cttctatatc tttccattct cctttgtttc cctcggtctc ttcgtctaca    171600
     aaatgcttta cagccttaat gtattcatgg ttgtccttca gtgcaacact caactcggga    171660
     aatacccatc catagatttc tcttatcctc atggaatacg aattgatgtc cttgcccact    171720
     tgttctaata gcatcactgt gtggattaca ataaagtctt ctctctttac gttatattca    171780
     accttctccc tcgaatattc atatgctaga ccaagcacca tctgcttgct atcatattca    171840
     tcaagcctca taagctttct atagtccttt cggacgcctc tcattatatt ctcgctctcc    171900
     ttctgtttga ttccaagtac atcaaggccc tttcttagag tgctgtcgca atgcaagacc    171960
     ttaacattgt taagctcaag aaacttcttt aagtcctcat ggatctctcc ttgcgaaaga    172020
     catttcagat ggtctgacgc ctcgttaaga ctggcaaatc tcattccaga tctcaagttc    172080
     agaacttgag ttagtttggt atagtcttcg tacgtagact tcgacatgtc ttcatattcc    172140
     ttgagttcaa acagtccgta tccccctgca tactcaaaaa gcaagtgttc catggggtct    172200
     tatccttccg tttttctaag ctcagaacat gataaacttg aggaataata atatcagctt    172260
     taatctttat agttcgatga cacggtctgc cgccttctct aacctatcca tgattgcatg    172320
     gccttgttcg tcgcaatcca ttccagcaac taagattata tcgttgacct tgtcgagctt    172380
     tcgaattcct cggaaaaagt tcttgcatat atttttctta tcatctccca tgtcgaagat    172440
     gtcaaccttc acatccgaaa agatcttaag atccattcct gaatgtaaag caacacctac    172500
     tctagcaata ttggagctct cagaaatata tttgagaatt ccatctttaa tatcttcttg    172560
     tcttcctttg aataaaacta acggtgattt tggcgaataa tgcttatgtc ttttctcctt    172620
     tcctccccat tcattcttct ttactatcac ttcgcaatca acaacatctt ttattctttc    172680
     cacagttatt ccccctggcc taagaacctg gagccttcca tccacatact gcacaattgt    172740
     agactctact ccaatcgaag acggacctcc atctatcatt agctttactt cgtcgccaaa    172800
     gtcctcaatc acatgctcaa tcgttgtagg gcttggcctt ccgcttatgt tggctgaggg    172860
     gattacaaga ggtgctccaa gcctctctat tatctttaat agaagcttac ttccgggcat    172920
     tctaacggca atagtattaa gtcctcctct gactataggg ctcacattgt ctttcgactt    172980
     gaagagaaga gttagaggcc caggccagaa gttctctatt aactttttat attgcaaagg    173040
     aatcgggccc tcaacgattt cttcaagcat ttgaactgaa gaaattcctg caattagtgg    173100
     gttatttgca ggccttccct tgagtgcaaa tatcctttcc acagcacgga ggttccaaat    173160
     atttgcagct agcccataga ctgtctctgt gggaacaacc accacatctt caaaaaagtc    173220
     tagaaccgac tcgacatcga gcccttccgc agaaaccacc ctcatttgta ctggggcata    173280
     tgctatggta aaattactgt taaactccaa acattggccc ttgagatggt aaaggcaaca    173340
     aagggatatt tcctaaggac agaacctagt gtaaaggaag tgatattgaa gcttggggag    173400
     acagagaact tcataataga agatataaat gatacatgta tttttatcac tccggaagca    173460
     gcctcagata tcaaggaacg ggtggagctt ataatgaaca atgcaaaaaa cccaggaaag    173520
     taaagaacat cttctctaga agaaagcata ttagatgatt ctgaagagcc cctatgggtg    173580
     ttcggtcgtt gtggaagatt ctcaagccct cgatggagaa gactacgccg tctgggataa    173640
     aacttgctgt ggacacaagc atctggatat gccagtatgg acacttagga agtgatgata    173700
     taatttactt tttttcaaaa aggattatca aacttctgta ccatgggatc caaccagttt    173760
     ttgtttttga tggaaagcct ccggagatca aaaagcatgc cattttggaa agaagaaaaa    173820
     ggagcaatag gagcgggata gaaactgtag ataaaatgct caaatgggat gagaatttag    173880
     atcttccaag tagcaaggct aaggctgtcg agtttggaaa ggatagatat aattgggggg    173940
     acatcttcga ttcggaattg gattcacatc tacttgaata ttcaacaagt tcggatgaag    174000
     aagtctcttc taacgagcga gaagaaaaca gcttggaact agatataagc tttgattttg    174060
     ttgaatccaa agatttgtct agaacacaaa agcttagaag gctggttgac ctaagagggc    174120
     gcagaaagga aataagaaca agatgtaact ttgacgatcc agacactttc tcaatgctac    174180
     agattaagaa cttgaagatt cgaaatctga tctcccataa tataaaagct ctggaaaaaa    174240
     aaggttatag aagagtccat ggggattgta aggccatata taagcttaca aagaagccag    174300
     attatgtacg taacgaggga gaaacaacca acgaattaaa aaaacctaca aagagggttc    174360
     ttcctgcaac tgggcccgat ttggaaaatg atatttctga attggttgat gaaacgtgtg    174420
     taaagaacaa tttgtctgtt caggatttgg catcctatcc tgtccttaaa agtctggtag    174480
     ataagtacaa ggattcggat agaagtctga aaaaggacac agagtgtatc caaggagtag    174540
     agaactacaa agaagagaaa gtggctttgg taagtggtgc gaaagaaagg atgatgggag    174600
     gtttttttgg cctagatggt agtttggact cttgggacac agtccaagag gaatatggta    174660
     gcttttataa aggcagagaa atccccgatg aaactaatca gggaatccgt gatatttgca    174720
     gagtgatgag gcttataaag gatatcctgg aggtgttcaa tatttcatac gtagaagcac    174780
     cttcggaagc tgatgcccaa tgcgggttta tgtgccgcaa taatactgtt gatggtgtga    174840
     taactgaaga caacgatgtt ctactctatg gaggaacagt ttatagaaac ttttttagaa    174900
     gggaccgagg aatagagaaa tacagtctag agagaatcaa aaaggagctc aaccttgata    174960
     ggaagaatct tatagaactt tcatatcttc tgggaagtga ctacacacta ggagtcaagg    175020
     gaatagggcc agtgaaagct cttgaggcgg ttagaaaggg atctgtaagg gaggaagata    175080
     taggtatgct ggtgggatta tacttgaatc ctgttgctat tgatatgaag gatattctaa    175140
     tccctgtagt agacaaagac aaaataagaa tgttctatga aaaaaaagga ctgagtaagg    175200
     aaagaataga tggagttatg tttttccttg aaagaatcaa atttggatga ttctactgtt    175260
     ctttgagact tctggaaaat attatactaa tgtagggaaa aaaaaggata aaattatatc    175320
     catatgaagc tgagaccaag aagaataaag aagagatgtt tagttttact gattattttg    175380
     tttaatctcc tactggttct tcttgtgaag cataaaaaca aaatgaacat aggaaacaag    175440
     gtggatcttg gtcgtttgaa atggtttgga actggtacaa tagtggtgtc ggcgatggaa    175500
     atgttccaag acgtggggtt ttccgatgcc atctcgaaat ctgagttgat ttccacagac    175560
     gttcaaggac aaggagacgt tgtggattcc atactgagcc gtgtaaacgt cgaggttagg    175620
     gagattctac tcatagatac aaggagactt agaggcatga accgtactgt tttcccaagg    175680
     tttgagaaag agagggcaaa ctacagtctt ggaatagact atattgaaga attggccaag    175740
     gaatttatca ggagaataga caatggaaga gttaagtacc catttggtag taacacagca    175800
     agagaatatg taatgaggat aaagtcgttt accaagaggc ataccaaggg agaagacgat    175860
     agcgagatta taaagctagt aaacaaggtg tttccaacca ttgagatatc attctacaca    175920
     tacataatga tggttctact caacattcga gagatgattg ttgaagattt tgattcaatt    175980
     aaggaaatat tgaagacaag aaagatatat agcatcagta acgacaagat aaatcagctt    176040
     ggaggaatga tcatgagagc ccgggctttc aacgacggaa tacccgagtg gaatttatgc    176100
     aatgcatgcg atcaagtctt ttttgaagaa gatcgcgccg atttacaaaa gcttacgtgt    176160
     gatgatgtta tatgtaggag atgtttaaag caatccttcc tgtattctga tgatgagttc    176220
     tgcataaagt gcgggactga atacgacatt ttacctggaa atcgctttaa agatttactt    176280
     gattagatgg ttagatcatg tggatctgga aatcaatatg acccgcccaa ggctacaaaa    176340
     tttagtcgag gctcaaacaa atatgtgatg gaaatgccca tgaaaagcat gacggaggat    176400
     ataaagaaag aaggaaagaa aggtggaaga aatagagaaa aagaatcttg gaagaaagga    176460
     gaattcttag ggaagaagta tgtggaaaga agctctgccg gattgagtaa tattcgaaga    176520
     tccgaggagg aattccaagg aaatggcaaa gatgaagaaa gaaacaattt ggaaggaaag    176580
     acaaatagga aagaaacgag agacacaaag actaattctt tggagctttc cctattgaat    176640
     agaacagcag aaagtgatgg aggtgtgttc ttgtctaaag acgtaagaga aacagagaac    176700
     gtgaaatggg agatatttgg acttaaaccc aaactattga aaagaataca ggatattggg    176760
     tataactttc cttcccctgt tcaagtagcg tccatcccac atgctttgaa aggaagggac    176820
     atgcttgtta gatcgaaaaa cgggactgga aaaacagcat cctacacaat tcctattctt    176880
     aatgcaataa atcctgagga gctgaatatt caagggatta tattggttcc cataagagag    176940
     cttgcattgc agatatcgag aaatgtcaaa aggttatccg aagggatggg agtgatatca    177000
     gcacctattg ttggaggaac aaacatgcag gatgacatca taagggtgtc caatggtgtc    177060
     catgtgatgg taggaacacc tgggagaata gtggatctta tagaaaagaa aattggagta    177120
     ctttcaaaga agatcatctt agtgtttgat gaggctgata aactacttga tgtgacattt    177180
     ggagagacgg tcacaaggct cctggatatc ctgccaagag aaagacatat attattgtac    177240
     tcggcgacat ttccatattt tgttacaggg ttcatcaagc ggtacatgag agatccactg    177300
     tgtctcaatc tgatgaagga gcttgtccct gtaggagtta aacagtttta tacaattgta    177360
     aagccttcag aaaagcttct ttgtttaaga tcgcttcttc tgaaactaaa aatcaatcag    177420
     tgtgtgatat tttgcaacaa tatcaagact gtggagcttc tggctatgaa ggttactgag    177480
     attgggattc cttcctactt tatccattcg aaaatgacac aagaagatag gaacatagta    177540
     ttccataact ttctgaaggg aaagtgcaag attctagttg caacagacct cataacacgt    177600
     ggtgttgatg ttcccaacac aaactatgtg attaactttg atattcctaa gtctcctgaa    177660
     tcctaccttc atagaattgg aagggcaggt aggtttggaa cgccaggtgt tgccataagt    177720
     ctggttacga cagaagaaaa agaaatgcta gcagacatag aagtaaagct ggggaaagaa    177780
     gtatctcctc tctcagacgg aggtctagat cgcttatgaa agtaacatag ataagaatca    177840
     agaataagaa taaatatttt tgagtttcat caatatctta agcatccatt agctttaata    177900
     cgatcgattg tgatgtctaa atccttctat ttttcttcat ctccatcttc ttcttttgga    177960
     ggcacaaagt atggaatctt ccctcggacc cagtcatgaa ggatcatttt agaaacggta    178020
     ttggtattgg gttctccccc cttctgtagt ttaccaaact taattgcgag tctttcaagt    178080
     aggtctgtag aatcaagaaa ttgaattcta tatgtctttg atatagaatc cctagccttt    178140
     tcaactatca tatcaatata gtcttctgga tcctcgatgt tttcaattct tacagcacct    178200
     ctaaggaccg cctgatcata gtcaggaata gggacaattc ccgggcagtc tataaggtaa    178260
     atccctcttg taagtgctat atactgccat accttggttt cccccggaat aggagcaact    178320
     ttgcacactt ccttgtttct taaggtgttt attatactgc tttttcctgt gtttggatat    178380
     ccaacaaatc caacgcttag atgtctcttc ttgtatagtt tgctaagctg cttcaacaga    178440
     tttataagac tggcctttcc atagttgttt gttactgaat ttgagtgata tgctatagta    178500
     ggatgagact ttgagagacg ttttagccac ttggcagtta ccccagtagg aacaagatcc    178560
     actttgttca gtacatacat aagatgttta tgaggcgctt cctccttaat gtaactggct    178620
     attttatcac acatggttcc caaaggatct cttgcatcga gaacatgaac aatcacatcg    178680
     ctgctgtcta gaaccttgta caactcaagc catattcgat ggctctggcc cttcacatgg    178740
     tctttcttga cttctttctt ttcctctttg gcttccttgg ctttctgaga caattcctca    178800
     agactgctgt actgaagatt tggtttcttc cttacagatc tttttccaaa aacctcctca    178860
     aagtctccgc gctttttctt ctttgttcca tcttcaagaa gagagtatgg tacctttcca    178920
     gtgctaagca atacattata tgggctttct atctttgtct ctagtctaaa tgcatctagt    178980
     tcggtggatg atatcgtttt tgacccggta aaccacttcc tacttggctc aattcttcca    179040
     acatcagcct tcgagttttg gaaaggtgca tctttgatta tgtctcctct tgaattcttc    179100
     tttgctttcc cagacctcag catttcaaga tatttcagtt tcttcttgtt gtagtagttt    179160
     tcacgcattc tcggggataa ttttttcatg ccttaacatt ccaatccaaa gctgaagatg    179220
     tctctgcttc cgaaaaaaga ttccaaggaa gactccaaga agtcttcata tccctccaaa    179280
     catacgtcta gcctttgaat taatatttat ctcgaatatt tgatcctctg agctggagaa    179340
     tatcttgtca ttcatctcgg aaaagactgc tccagttatc tgtttatcag gaaatatctt    179400
     gagtctttgg catcttctga agtctctcat atcacaaata gtcagaaacg agaaatgctc    179460
     tgtgaaaaac agcaggtcaa gggaattctt cagagaaaac ttcacgttcc gtactgctcc    179520
     cttatgacta tccttctgct tactctcaaa cttgtgaagc atgcggtcac ttcttatgtc    179580
     ccatatgcat acatatccgt cctgggttcc cactgcaaat gaagaggaca cactgttcca    179640
     cgacacactg aatcccccat cctcggtact cttcagtttt ttaacaagct tgtagttgtc    179700
     gttgtctata gagtacaaaa atacgtcgtt agagtctccc acaataacca aaaacttgtt    179760
     gtccgggctg attccgcagc tgttgacttg tgcaatatgg tttatacaac cgctgctctg    179820
     aagatccatt gtaaatacct ttaaagttct atcattgttg catatgaaga ttctgttgtt    179880
     gtttatacat atattattgt tgatcgatga acttacaacc tgagaaagga cttcgtttgt    179940
     ggaaagattc ttaactttga gatgtcccct ggatcctcct actgccagaa tgtcatcttt    180000
     caagcagatg gatgtaggga agaagtccgt tccttcatac accattttgg ttgcattttt    180060
     atagggatcg aaagacatta cattgcatgc cttgggaaag accaaggatt ctcctttgat    180120
     cttaagcata tccttgagct gccagtgctg tgaagttact ccaaagtcac atatcttatg    180180
     catatcattc accaggttgg aaacttcccg cgcttcctgt gacatttgtt tgtttagttt    180240
     atggataaga ctttcaatga tactcgtttt agcaaaataa cctttagaag gctgagcaat    180300
     tccttaaagt cgatgcagag ttgtactttc tgatgcaaga cttttataca aacgccttat    180360
     acatggttta agaactcctc cagttgaagg atttggatcc cttctagact gtcattgctc    180420
     atcataaatt ctcttattat ttctttagca tcttccggat tcatagaaac ttctctagca    180480
     atctccaact tactgttata atccatcaag gggattggat tcgcttctta tgaagtggga    180540
     aatggagatc cccaatggat tcaaactgga acacaaagga cctttaccta ctggctttgg    180600
     aagtttctca tcttcacaaa attggctatg gagagataat gtccatgaga ctcagaaatg    180660
     gaattcaaat atcctgtact ctagataacg gagaagagat cgggtttggg catttgtgga    180720
     ggtacgaagg agaagaggca gagaccagat tcaaactatg tttggtagaa acacagctga    180780
     aaaattcgac tgagggcgct gtggatcatt tactgatgat tcttcccaac acctcgaaag    180840
     cgaaccagct tacaatattc atgatcttct ataagcttac cacaaaatat aaagtatatg    180900
     ataaaagaat ccttcgcgag tgtaaagcac atttgcatgc cattcactta aggtatccca    180960
     ttctaaagac attggtagca tatactctct ttaaagaaga tcttgtttct gaggaattta    181020
     ctgatgaaga aatcatagaa atgaatctgg tagatcctag aaacttgaat ccagaaaatc    181080
     cagacgcagt aagacttgtg aaaagattgt tttctactat caccaagacc tcctttagat    181140
     actcaagaag aatatttaag catatggacg agaagttctt ttttcatttt cccttagagc    181200
     ttaatggagt aggatactca catcttcggg aactgattgg agagctctcg cctagaaagg    181260
     ctttgtctat tggagaaata atttgcagca gatcagcagt tcggctgttc tttcccttga    181320
     agatagacga cgtggagaga tttttcattc acaaagatgt agaggttaga atagaatcgg    181380
     ttagacatat agataccgta ggattgatga agagatttct tgaagttaac caatttatct    181440
     ataatcgaaa tatggtgaag ttgttgtcta ggtattttcg tatatggctt ggaaagagag    181500
     ttaacgaaga gcatgagttt aaggtgatgt atactgagat tgtatcaccg atgcttcgaa    181560
     gcagaaacac atatagaaga cttctggggg ttcacttgat ggactcactt atagatatag    181620
     gagttgtaga accatcaggg cattcctggt tattatttga tccggactat gagataagaa    181680
     gtatcgtatg caaatacagt gggtggattc ccttaaacat agaagaggcc agaataagaa    181740
     tagaaagtta tcaatcctat gatgtgaatg gatgtgtaga atacatcaag agttgcaggc    181800
     cagaatggct tattagcgat ctgaaggata ttttggatac ctatgcaaag gactttatga    181860
     gtggaaaaaa aggcatagaa gaggttccaa tatatggatt tctcagactg ttttcagagg    181920
     taaagagtta caacataaag atctatgtag acagggttta cgaatactgt tttggaaaac    181980
     tctccaatgt tattcatgaa caagatgacg atggcctagt ggtctattgg aaaaatatga    182040
     aagaatgttg taactattac tgctcattag cactagaagg ggacaagagt tcggcagcca    182100
     aacttgtaag aactcttctc tatatcaatc atctaggtgt tgtattacag gtgtctcaat    182160
     acctaaataa ggtgcttaga agtgtggttt ttccccagga cgaactacta gagatagtag    182220
     atctatcgtt caaaagaatt caaaattgca agatcttttt cagaaaaagc ggaggaatac    182280
     ctttgttact tgtacagatt cttaggaact atccatccat cattaattat gttttagaaa    182340
     gattactcga aatgattgac aaagatgaaa acaatatcaa agttcattgt ttgaacattc    182400
     ttagcaggat tatcggggat ggaagtctca gcccaaaaat acctcttcag acgatcgaat    182460
     tgttcaaaat ttccttcaga tgtagtagat ccagcctttg ggccgtaaga aatataggaa    182520
     tagaaatatt ttctcattta gttcggaagg tgtttgaaag aggacctgaa tttattgttt    182580
     ccatagccca caaagaattt cgaaatctgt tatatgagga gcttagttcc tgtagccaca    182640
     ataaggatga cattctagtg tttcttatac tccatttata tggaagagta aagaagctag    182700
     acgagagaga aatggagttg gttagaagat tttcgagtag aagtgacctg ataggattag    182760
     agtctaagag tatttgcgaa ggaaaggaat gcaggagacc tcagtatcgg gagacgagaa    182820
     taaaatttga tgacaaaatg aacgaaggag aaatacttct aagattgcta atcctcttgg    182880
     actcggagca acctgaggaa agaagaatgg ccgagtctta tatgaaagat gtttacaaat    182940
     tatctctgta ttccgaagag tatttcagac attacatagc aaaaaggata tgcagaattg    183000
     gatacaaaga tgttgcagtt aagaagcttc aggaatatgg gctaggtgtt gaaaaatctc    183060
     agagctgttt ctttaaagat tctccatcca atgaacgctt tgatctggaa tataacatat    183120
     ctctcataga gaagtataaa agtcaaaaat ggtaaataat ttccaagaat tttttaattg    183180
     gatcagatat tatagaatat taactttaaa ttagggctgg caccttgaaa cttttcttgg    183240
     atagagtgtg gcttcgtcaa cattctcata cctcataaga cccatcaaga acctttcaaa    183300
     cccaagaccg tagcctccat gtttacatgg gccaaacctt gccatgtcaa ggtaccaata    183360
     gtatggatca atgttaatgt cctctctctt aaatccctcg attagatctt cataaatgtc    183420
     ttgcctcata gagcccccga gaatttcccc aattcctggg aacaagagat caacactttc    183480
     tgtccaatcc ttgtttcctt tgtcctttct catatagaaa ggcttctgtt ccacaaggaa    183540
     atttgttaga aacacaggac acccatctcc tatggcctca acaatatacc tctctgctgc    183600
     atcgggaata tcatctccaa tttcaaagtc cgttccatct tcttttttat agcctttact    183660
     atttagaaag tctatagcct cagaatactt gatcttctta aacggagttt ttggaatctt    183720
     gtgaaattcg aattttggat ataaactcaa aatatcgtct ttcattcctt catagaactt    183780
     ctccatcgaa tacgaaataa gagactcgat ggatgacata agttcactga aatcgatatc    183840
     tgcaagttct gcctcgacat gagtatactc acttaaatgc cttcttgttc tgctcttctc    183900
     tgctcggtaa gacggcatga tacaatatgc acggtgtgaa accggcacta cagtttcaag    183960
     ataaagttgc gaagattgag tcaggtaagc atcttcacca tagtagtcca gcttaaaaag    184020
     agtgcttcct ccttctactt gtgtttggac cattgtggga ggtgtaatct ccgtatactc    184080
     cttggcaaaa tagaaatccc gtatgatctt cagaagatat cctcgagcct taaggaacag    184140
     ttggcgcttc tttgttcgga gggccaggtg ggcgtttgtg agtatagcgt ttaccgaaga    184200
     ttcctcattc agtgggaaag atggtgctat agcatcgttg tatatttcaa ccttctcaac    184260
     ctgtatttca aactcgtaag catccttttt cccaaagttc tccgccacag taccataaat    184320
     agtcatggaa gtgcacatgg tcaaatgcat ctttttcggg taaacacact ttactgtctt    184380
     atagtgggca tacaaatcaa tgaacgttat tgaggattgt gatcttacat ttgtaaccca    184440
     tccaaaggtt cggatcttct gcccaatatt ttcctttgtc agcttggata gctcaattct    184500
     tttgtattca gaaaaatcca atttggaaat ttcttcttcg atttttccag acattagtag    184560
     gggctcttta attttttaaa aagactatgg gcaatggaaa tagatcaaat aataccaaag    184620
     gacattgatt aacttcaaaa tggcaacata caagataaaa aatttaaggt ctaaagttct    184680
     tgaaaccttc cccatagatg cagaagagga atgtttatgc agttccggat ctcccggtaa    184740
     aggaaataat gcaatacttc aacgagatgg aaataaacat aaaggcaagc gacattctta    184800
     agccaacgcc tcagtcaact caaaggatct atgagatatt actagaggta tattgtggaa    184860
     tcaagacatc cgacctagta tccagaacag agagcacaga agggtttgaa gaatccttgt    184920
     cataccttct tctccagaag cgaatggaag gctttctcag gaaaataggc atggacaact    184980
     ttgggcttcg agacctttct ccagattcaa aaaggcttat tggaattctg agtgttattg    185040
     taaacttctc gatgtttaga gataacaaaa gacatgttta cgagagagta tgccaagcta    185100
     acgacgagaa gctacttttg aagaacgaga tagatgaaag agtttataat gcccgaaaag    185160
     agcttgagaa gtgcgagaaa gatgcaaaaa agagtgttga ggacgcaaag gaagttgaaa    185220
     aagagatttc tctactggaa tctgagctta aagacttcta caagcatcaa agagccctag    185280
     tacaggaaac agaaagaatt aaagcagaga ggaatgagta tagtgacaag ctgagttctt    185340
     taaggctaat gctgcttaac ttcagtcagg aaataacctg tttgaagaca caggttgtaa    185400
     gtgatcccac aaagctcatg gagcttcttg aagagatgag gagcctaatt tccaaggaga    185460
     acgagataat aaggggactg gagacaaaga gaataggtct caaggagaaa accgaattta    185520
     tggaattgat gaaggaagac acaatgaagg ccattacact ggcgatttcc aacagagagg    185580
     ctgggaagac tgttgataga ataaacaggg agatatctga gctagaggtt cagataaaaa    185640
     accttgactc tggcattaat gccttaaaga tccgcctgaa tcacgtgaat aggcagattt    185700
     cccacatcga atcaaaaata tttaaccttc aggataacga caaaagatgc tctgaagaaa    185760
     tatctgcaaa gcttgaaaag cttaaaaaca actacggagt tgtttcgggg gaaagaaaca    185820
     ccataagaaa gaagatcgag gagaatgtaa ggcagactaa gaacatagaa tatgaattag    185880
     taaagaagag aaacgaacat attaacgaca taaccgccat acaatcagca ttatgcaggc    185940
     tcaaggacga catcttcaac tactttgccg aggccaaagg agtgattgat aagaccatgt    186000
     ccagctgaga gttttagaag ttttatctga ggagaatttt aatccctcaa gatggttccg    186060
     gaatctgtca ataaccttta caaagatctt gagtctgtga ttcttcagtt caaatctcca    186120
     gcatttggaa actatttcct caagaaagct aaggaagagt ttgataacat cagcatccaa    186180
     acctcaaagc agaaagatga aggggcgatt gagagatatt tgaaagatca aggagaactc    186240
     ctggatgttc ttcgaagaca aacaaccatt tacaacatgt tctatgacga gtcaagtgga    186300
     atatgacagt ttgggcgact tgattgttgt tgaatacatg ctataggttt gaaatcccgt    186360
     caaagtccta ggaatatcca ttgatatacc cgaggggaaa atgaagagaa ttgaaggaag    186420
     gccatttccg agactctgta gcttcttagc aataaagatc ttatcaagcg attttttgag    186480
     aaggatattt atagagggaa tttctatagc ccatggttct tggtagaata aagaagatgt    186540
     tctcaaatac taagaagaat ttatttggag atttgcattg cggaagaact attcttatga    186600
     atggatgcga agcattagcg tcccaggaag atcttttatt ctcatcaaaa aaaagcaaga    186660
     tgtcattcaa gctgtgtgag attgtgtcaa ttgaacacga taataagacc cttagcttca    186720
     ttcataacca gaaaaagtat ctctttacga gcggggaatc tctagatctt ttctgtaagg    186780
     ctatagtacc ctttataaag aagaccaaga tcctatacaa aaaaagtgcg gtgtactcaa    186840
     gatacaatac aactacgggg agatttgaag aagcttcggg aaacgtagat gtatttattg    186900
     ttgaagatgg gatgtttttg atcaggatag aaacaagaga cgacattata cattttgaag    186960
     agataagaac ggagacacaa tactatatgg atcagaaaaa cataacgttt gtatggtctg    187020
     tgatggaagg gggagttttc cacacgtttt cgttgaagtt tttggacaat cttgattttc    187080
     ttgagtttct cggcaagtac attggatgtc tctataagaa tgttaatcac gaaaacaagg    187140
     aggacaagga agcggagcag tattttgaaa aaatggagat ggagaactat caccctgatg    187200
     aatcctcgga gtcggaagag gaagaggagt atgaaagttg tgatgatgat gagcttgaaa    187260
     accattttgg agaagcagac gaaaagaata agcatcttgt cgtgggagat gaaatggctt    187320
     ttataacaag aggaaagtca ataggggtgt ttgaaaacac agatgacgga cttgagttta    187380
     gggcaaatat caagaacgtt ctgaatgaag atgtaaaaaa gataatcaca catgataatt    187440
     gtgcttcgct catatactta gacaagagtg aaagagacaa gctccataag ctggatgtag    187500
     aaagaggaga ggttattgag acttgggatg tgcaaaggga cgttaatgat tactttgatg    187560
     cgcagaagct aattgatact ggttcgcttg ttgggctctc ggattattcg gtgttcagga    187620
     ttgatccaag aacaaagaat aaggttgttg agtcgaagga ctacaagaca agaaataatt    187680
     tcaactgtgg gatggctaca agcctggggc atgttgttgc agcaggtaag ggaggagact    187740
     tgagacttta cgataagatt gacaaacggg caaagtctct tcttccagga tttggggatg    187800
     aaattaagta tatagacgtt acaagcaatg gaaaacatat tatttgcaca tgcaagaact    187860
     acttgatgct cacaactgtt cccggagact ataagcaacc tattgggaag gataagcctg    187920
     ttccaaaaag acttcagcta aagccagagc atttggcata cattaatgaa gagatagact    187980
     ttactcctgc aaagttcagc acagacactt cggaaagcag cataataaca agtacaggaa    188040
     gttatgttgt taagtggaac ttggatgatg tgcttaatgg aaagctgtac tcgtaccagc    188100
     tagccaaatg caatgatttg gttgttgccg acaacttcga atttggggaa aacaacagtg    188160
     taattgtgac aatgccagac gacataagaa aagtcaacgt ccgaaacctc aagagacctg    188220
     ggcgaaagat atggggatga ttgtgtattt atgctattaa ataaatgtgt ttttgaacat    188280
     ttctatttca aaagaatgat atgcagcccc gagctatgga ctttaatcct gttcgatttg    188340
     aatacaataa gaattacaca aagagtatag caagcatatt tagtagggtt gaaataattt    188400
     ctacagatac agacagctct agccgaaagt ttgtttttcc ttccattgga agcattaagt    188460
     attgcaaagc cagaatagta gagacagaaa gactcgagac ctcctggaga gaggtttatc    188520
     gtataaaatt cgataagaag tttgatttta agcctggaga ttccattgga atattgtgtc    188580
     caaacaatga tgctttggtc gacgaaataa tgaagattct ctgtctcaaa gattttagct    188640
     gccaaatgag tagaacgggc aagaactcct tcaattacac tggaagaatt agagacttct    188700
     ttaagtacta cttcgacttc gggggtcttc caagaaaatc cttattaatc aatctagcta    188760
     gaagttgcac ggaagaaaat caaaaatata ttgaatatct ctgttcaaga gaaggtattg    188820
     cagactatct tggaataggg aaaagatgga ataacattct tgatattata aggaccttta    188880
     aatgcaagcc caccctggag gaaattatag gagaatgtga gattgtaaag cctaggtact    188940
     tttctcttat aaatgaaatt gggaaggaat ccgaaattct tattggaata acaaacaaga    189000
     tctttaatga gtttgtaaga tatggtcatg tctcagactt tataattcaa tcggaggccg    189060
     aagagattga agcatgttta agaacaaatc ttctcttcag aatggattac aatagaaggc    189120
     ggatcctggc aatatgcaca gggacaggaa tagctccttt tctatctttt gtggcaaatc    189180
     ttcaatcaca ccaaagtatt tggatcatat atgggtttag gaacgatgaa gatgatattt    189240
     ctaaattgat gaagtctggg gaaaagataa aaatatccag agttaagtct agcgacggac    189300
     actatgtcac cgattactta gtggagaaga ttgatgagat aaaggaatat attgatgagg    189360
     aatgtgcagt ctatgcatgc gggaagatgg aaatgcagag gaaagtgttt gaaatattca    189420
     aaaatgagca tcccgagatt gtagagtcca agcgattgat cttcgaccaa tggggctaag    189480
     gctttgtgct tattatctgg cgcttgaaag ttcgattatg gagtttattt acttgtgaat    189540
     gggaattcga caggttttag aatcaggcct atgagtattg caaaaatgaa gatagcaata    189600
     ggaagcgtca tatgaaggat attgtatctt ccggacattc tatgtactcc aacaaaacca    189660
     tcaaaagagg agaaataaac cgattcgttc ataaacccta ctcccgttat tggaacattg    189720
     taaacttttt ttctcccact tagaacacat ttgttgaata ggtagatgta accatctgcg    189780
     gttccaacaa ccgtccactg gccttcacac gacattgttg tgatttttgg gatgctgtag    189840
     atcttttcgt gcacctcctg aaagtacagc ttggaatcct ttccctttaa gtaataaaca    189900
     agcatttcat tgttgtgagc tattctccca atctcctttt cataggaata ctttttggaa    189960
     ttgtatacaa aagtgtatcc tccatcttcg taaacaatct tatggactaa tcctctagtt    190020
     atgaaaaatc cttcccagtt gttagctatg tcagactttc cttcctctct cttgaaaata    190080
     atccttctat ccttcctgaa aggtctgtat gtatactctt catgagactc atcattgagc    190140
     aaggatccat ttactttttt tcttttcctt tcaggtttca gcacctcatc taatgaatct    190200
     ggagaactta ccacatcatg gaatccatac agctttttat cactaatgat atataaatcc    190260
     ttggcaaata cttgggaaga tatctttttc tttactcttt tgataagcgt gagattgctg    190320
     ccatcaaata ttaacaagta gaagaattct tcccctaggg cagtaatata aagtttcgaa    190380
     caatcatctt ctgttttgtt ttttgtgtct ttgttatctg gaaccaagtc tttacaacct    190440
     gaattatctt ccgaagagtc cttattgctg gcaccttcta tatcctctga actccgagca    190500
     gaggaagaaa ggcttgcctc atcatattca tcccatgaca tatcatcctc tcctacctga    190560
     agaaattcat ctttggtgtt gcagaccgct atatccacaa taatttcgtc tgttgaataa    190620
     taggccagct ctttgaagcg aaaactctcc agaaccttaa ctccattgga ctttccaaat    190680
     tccttttctc cccctcctcc tcctacaata acaaattctc cctttacttg caatgtgaat    190740
     acaggaaaag aaaccttcat ttaatgggtt acgaaaaggt aaataaaaac cttcgaaata    190800
     tctttaattt cctaccatca gatccctaga atacagcttc tgatcctctc ttttattgag    190860
     ctaaggatgg gcccatctac cttcccattc tgaataggaa tttcaatagc attccagttc    190920
     ctcatataaa tactgcttgt catccctctt tttacaaagc aaaacgtcgg tatagagtta    190980
     aatatctctc ccacatcctt tatattccat ctgcttactt gccacttggt tccatcaaga    191040
     aatatacata caaccttttt ccaatcctca gacgtaaatc ttcctacatc gtccactgca    191100
     acaactccaa atccttcaat cttcagttct accttctcgg cttcactgat gctaatctca    191160
     tcggaacata ttcccttctc aaagaactcc ttaacgttgc ttagatttac gggagaagaa    191220
     accgattgcg gaactatggc atagtaggtc actggtctcc cttcttcctc tttcttgcaa    191280
     atgttattta aatagctata atcccggaat ccaatgtatc ggaagtccgg tccatcaatc    191340
     ttggcttcaa tagatgcttc cttaaagttt tcaatctcct ctacaataat cttttggtcc    191400
     gtataatata tctttcctat tccactttcc ttgcacaacg tcatatacgc cgtgtacttc    191460
     ttgtctttgt tcagtagata gaacaaaacc tgctcaaatg tatactcctt ggtttctgtt    191520
     cctttaaatt tgatggtctg tttaggggaa atctttcttc ccccgatagt tatttcttcg    191580
     ggattcattt ggcatatgct gggatccctg agtgccctct tcagtagatc cattcaaaag    191640
     ggcactttct caaagctttt tatttaagac ctatccttga acattccaag ctgaagtatc    191700
     tccaagttaa agtattttat tgctaggagt ccggaacaaa aggcctggaa agcatcatgc    191760
     cctgtttctt aaacttctgt ttacaaaata atcgtccaga acttccccat caacaacccc    191820
     acgatccttt agttctaaaa cacggctgtg gaacatctct agattaaagg gaggatctat    191880
     aaacagattg ctgagaagcc ttacaaatgt aatggcttcc tttttatcct ggggagtaaa    191940
     tgtaggtaga aaagagaggt caaagctgta tttatggacc ataaagtatc ttataaggtc    192000
     caatgccata aacattaggc cgttctcaat cagcttttct atctcttcct caaccttgcc    192060
     attgtcggct atcttcggcc tttcaaggtt atcaagaata tatggataca gatacccatg    192120
     atcgtctttg actctgttca acatattctt gataccttct acattaattc ttgaatacgt    192180
     tttaaactct ctggccgaag taaaattctt cttgatgaaa tcgacgatat catctcggaa    192240
     ctcatcccga agcttatttt tacttaggaa cttctcggca acttcataaa cattttcatc    192300
     attgttgaat gaaagggtat aatacttgtt ttctagctca acctggaatg tgttgtcgtg    192360
     aggtttgatt ccttctccct taccgagaaa aacccattct ccattaatct cttgatatac    192420
     agatccatca gtcacccgga acttctgtcc atctgatata aactctccat cttttaatgg    192480
     cgcttctttg ctatttctaa tctcttctag aatcctagag gcctcgtcag agatatctga    192540
     agagtacaca tacagccttc catcacttcc cccaacatat actctacctt tccatccaag    192600
     gacagcccag catgatgttg taggcactag tatctcctga actagcttaa gatcttcatt    192660
     aagtattaca acttttccat tctctcctgc acatataatc aggtcactat ctccgtttgt    192720
     acaggaagat atagtataca taaagtcttt tgcagagtaa tgctttaaaa tccttccgtc    192780
     caatgatatc ttgagaatca tcccttcatt gtcgacagaa ataatgcttt tatgtaaaag    192840
     agcaactcct cggacatatg aaaggttata gttaaacgta caagccagag tcccattctt    192900
     aaaaactctt accaacttgt cgctacaacc tgttacaact gtgttttcat tgacaaactt    192960
     agcactccag acaactgcag gatgtggtat cttctgtact atagttacgt tcccgttaag    193020
     tatatgcttt gtagtccaga taatggctga gcaatcccat gaactagaaa caacaagatc    193080
     ccctactgta tctaaacagc acacgttgga ggaatgctcc tttatcaatc tcataggctc    193140
     aaccttctgt tcttctttct gggcccccag ttcatccata gaatacataa ctatacaccc    193200
     gttctggcat ccgacaaata aaaatccgtt tccagtcgtg atacaattga tatatccctg    193260
     cccaggctta atttctgccc aacaaccaag ttcatagcca tagattctta tcactccctc    193320
     ccgtcctcct gttataatca tctcatcgtt tacaaagagc gccttaacat cggagttgct    193380
     aatcttttcg attttctcta ttcctatcat caaccagggt ataaaaaggt atgtttaact    193440
     aaagatcatg cctattccgt aaatggaatc agatttttaa tcctagtctt ttatcccatg    193500
     cttcttttta tgcttttcac tatatttgta atcaaaaaat aactcttcat tcttatctat    193560
     atctctactg gcatagaatc cgattcgcct gatcccattc acaagcagaa caagtgcatt    193620
     taggttagaa tttttcttcg aatgatttat aaatctagac tcgtttccta tgaacctgga    193680
     gtcgatgaca tagagaggaa ctccttccct actgtacaga tcaaacaagt atgaacatcc    193740
     tttcaaatca tagaaagtcc ctcttctttc tgcttcctcg ttacttatta tctctcccac    193800
     atactcaatg ataaactttc ccttggatat cttttccttg gcaaacaggc catatccttc    193860
     tattttgcta gacgacacat atattggcga cttcttaccc aactgtatat ctctgtttcc    193920
     gcactggttg catgaacacg tctgaataca ttctctcatt gcttgtctac atctacattt    193980
     attgtcgcat gccgaagagc atctacatcc tatgaagaag tttttgcatc ccgcacaaag    194040
     acaagacatt tcacagttgg tcttgttaga gatgcataca catccattct ctttagtaca    194100
     gtttccagaa tggtcgcaag gtgtaaaaaa gacattgaaa tcaacattgt tcttgctctt    194160
     gctttctatc aaatacttgt gacgtcctgg cggaatagca caagaatctt ttatttttgt    194220
     acaaggaatg tatttcttat acctaaagta gaaaagcagg gaagctatac attcataccc    194280
     ttgagactcc atacaggcct cataaagggc gttataagca ttaaagtcaa gctcttcctt    194340
     agtggattcc ttgcatgtga ttttcatttt cttgcatata tctccacaga tgtctctagc    194400
     ctctacaaat gcatttgttg gattcttctc aaaacctaca ggctttatgc aaattccttc    194460
     tgtcttggag tgccatctac atccaaaaat aaagcataca ttacaaaaga ttcttctcat    194520
     tattcgaagt ccatcatctt taacacattc ctcacggaaa cttgatctgt cccaaacatc    194580
     caacttctta ggaagtgtcc ctttaacaac ttccttatca tatgaatagc atttctctat    194640
     aaatcccgtg ttcttgaatt ctgtgagatt tataaatcct gaggcacccg ggatatatgg    194700
     aatgaatctt aaaataggat catcctctgt ttttatgctt gtattagtaa aggtaaagaa    194760
     agtacttcga gtttttggtt ctattctagg aatcactatc ttcttaacgg agggatggaa    194820
     gccgttgggt cttagatggt tttcggttgt tggattagtg ttattgctta tcatcttggc    194880
     ctccaaagcc ctttttttct tttcaatcct atatttttaa atcttggtac ctggcttgat    194940
     gatgtcctgc aaggtaattt gtttgtgtta tctccaagac ccatgggaaa caagagacgg    195000
     ccaagctttg aacaggagtt tattgactca tttgtaagtg atgaagttat caactggaaa    195060
     tttgacccaa ttcttctcga tggagagctt aaggctcgtt taagccagga atagatatta    195120
     actgcaaatt ttcctcccca gaatgcaagt atctacttgg ccacttcctc caagattcaa    195180
     gaagaaggaa ccgccaaaaa taccgtcctc atacacaatc tttggtgtag gatataaggt    195240
     agaaaacgga gagcccacaa gcacttcatt ttcttccgta gaattcgata aaagcagact    195300
     caaagatctt cttaaccttt ccttttccac atttgttgag ctgctaacat ttcctctcga    195360
     ccatcaagag cttatagaaa caataggtag catacatctt gaaattaacc agattctcaa    195420
     cggagctaaa aagatggagg ctgtttctga gattagaaga attaagaatg atcatacaag    195480
     aaataaaaac cgaattgccg aggaggttag aaggggaata tccgacttca agatatgagt    195540
     tatggaatct caattcttag gatatcaggc aagacttaac actctaaaga aagaatcttc    195600
     aaaaagaata aacattctgt ttctaattac gcggaagtcc cgtatctttc ccttcttggt    195660
     tgatcttaat attgttgatt gggaagtgaa tccaatatca ttcatcttga acagaattat    195720
     gtcctgtgat tctgtcactg ccactagcat cccatcgtct atctcgaatc cccgcaatag    195780
     ttggccttca aacttaacgc ctcccacaaa ctcggtcctt gatgtgggtt ctacttcccc    195840
     atatcttgga gaaatgatgt cgattctgct ttctccagaa tagaaaacca gaaactctct    195900
     atagaaccga acacattgaa tgggaaattt atggatcctt ggcgataaat aaatgggtgc    195960
     tacacattga aacttgttca aggaggaagg aatcctccaa actcttattg agcagtctgt    196020
     tccaccagac gccagatacc tcaagtcatc acttacatcg atagacaaga catggtctct    196080
     atggcctgtg tagcctccaa agacacagac acactttagt tccgagacgt cccacatctt    196140
     tattgttgta tcttcactac agctcaacag atactcatcc ttatatcttt ttatcgagaa    196200
     aattatccct ccatgggcct gaatatatcc aacaaatgtc cctttcgata gattcaggac    196260
     ttttatgatt ccaagacttc cgccgagtgc taataagaca tcattctgtc ttataagaaa    196320
     ctcactgcat tgaaagttct cgtctggatg ctcatcgaga actctttgga ccatcctgag    196380
     atcgtcggca tatgatataa tcacagaggt tctttttcca accagcgata ctatctcata    196440
     ttcatcgcag atactcataa attcaagata tgcattgggt atttctattg acaaagccat    196500
     agggtattta gaaaaatgta accatcagca ttctgtatca aaaatataaa atccttggag    196560
     atcaatcgat accggtgtcc acccgggaat ctccagatct ttgttcacca ctgttacaag    196620
     atgacctccg catcctgctc ctgttatctt tacttcaact cctatatccc tcatccttct    196680
     caccacctcc ctcatctctc taggacaaac tcccagctca tctaagaggt cctggctttt    196740
     ccttatgagc ttatacaatt cttccaaagt aaattctctt tgaagtagcc aatatgcttc    196800
     ttcagaaatc ttccctattt catcatacaa ttccttctta agttccccca cctggatggc    196860
     agactgggta ttcttaggta ttctgctatt gaagataagt atcttgaatc gggaaagatg    196920
     gcgagtcgag agcttctgca cattaccctg tttaaaagag atcaaacctc ctgtataaca    196980
     agccaagaca tcaacgccag acgcctttcc atgaaacata ttttctattg caagggcctc    197040
     tcttgtcatc ttcgaatctt ggactctccc atatgacagt aggagagaca ctgcagcact    197100
     tgttcctagc ccacatccca gagaagcttc caagaagaga attgcatctg atccaggaat    197160
     gctacatttg tacttttcga ttaggtcaat ataatttccc tcgccatcaa taacaacagc    197220
     cttatccctt ggagagggtt tcatagccag atatccatat atctttatgg aaatagccag    197280
     gcatcttgct cccgacaaaa caccatgctc accaaatagt attactttca aaggagatct    197340
     agccaagtaa gccatcccag gtaggggccc tagaggtttg aataattagg gttagagtca    197400
     ttccttgctt ggaaaggaga ttcctactgg tctagcggtt aggatgtctg cctttcaagc    197460
     aggaggtggg ggttcgattc ccccgtaggg aattcttttt tgtttaagaa aaaaagatca    197520
     agcatatcaa aaaacatata taaatccaat ttatttcgat agagagcttt ttcattccta    197580
     gaagtaaaag agtaactgat tcaaacacat attcactcgt catctaaaga tatgttgaat    197640
     ccaagtggct caaacaaata cccctttccc ctgaagaact tcgagtggaa ttcaacccaa    197700
     ttaagcctta gggcatgaag acacgatcca agaccttcca ttccaatgag aaggacaata    197760
     gtcccaagaa tgtaaacacc agaaagtgca ataggtgcaa taaagccttc ttttcctatt    197820
     gtgaactcat gaaggaccct agtaagttgg gcatgggcaa gagagacagc ccatagccta    197880
     agataggaag aggtatttga gatgagtcca agaccgaact caacgacatg gataaactga    197940
     ttaatccaca aactggaaat ctcttctttc ttcaccttgt ttttggctat catgtataca    198000
     ggtttaccta gaagcatcca aggaatacag agaagcatga gaaagagtag acatagttgg    198060
     actctatgct gatatggata tatttcctct gcaacaacga atggattcgt aaacatgttc    198120
     acaagaaccc caattattga cggatagttc gatgtaacta gccacttgta tattattaaa    198180
     aataccatgt atccaacaaa ggaacagaag acaattgttt gggggataag aaccccatat    198240
     atctccaccg gctcgttaaa gtacatagca ttcaaaaaag aaataactat tcccaagctc    198300
     atgtgaaaga atcctattat tatcgacatt ttcatcttca tcgaattgag aaagatcatt    198360
     tcgtttttcg aatggtgcca catgtggtca acaccaaacg gatagggccg tcctgtgtct    198420
     ttgctcgagg aaaacagagg aatcgtaaga gagccaaagt cagaatacaa aaatccaaag    198480
     aacatggctg caagtgaaaa cacaaatatt atatacttcc cattgacaat catccttaga    198540
     gtctccgagc agttcttgaa tttctttgag ttctttatca tgtatactga taagcaaaga    198600
     agtagcaatc catgaaacac atcgccaaac atgcatccaa aaagcatagg aaatgtaaat    198660
     agagaaaaca ccgcaggatt tatctctcca tacgacggaa ttgcataggt gttggtaaga    198720
     atctgaaagg attctgtaaa ctcattcgtt ctgaagtatg taggaggcat ctcttcgctt    198780
     tctgtgattt caaatgcgaa aaggcttgtt ccatcccctt ttatctcatt gatcctcttt    198840
     aactttccta tctcttctcc aagaatccag gcttcgccga caaggcaatc tcgatcgaaa    198900
     tcaaagctta acttgttaag agtctgatat attttcgttt ccttgtttag atagtacttc    198960
     caggtatttg caaaatgccg gatcttgtct tgttcctttt ctattgcttc gtcattatga    199020
     tcctcgattt gttgcatctg acttattgtt gcacttaact caagtaatcc tcgcttacat    199080
     tctctgaatt ttttgtgatc tagcattctt cctcctaaag atgaaaatat atctctaacc    199140
     ttctctaaag cttcacaacc gtgcgcaagc acaataaata ccgtttttgt tccttcttct    199200
     acatcccttg tccttatgac caggtttctt cttagtgcct gatgaagtac ctttcttatc    199260
     aaaagttttt ttcccctctc aactatccca gtcatgaaat caaactgaac aagatgtact    199320
     tcttctgcaa cagttccaag aaaattctct gtctcctcct gcatatatag gtcctccttt    199380
     aaccttccct ggtttgcatt ggtctctttc tttatcgact tcagctgggt caatctagag    199440
     aaaaatttgt taacctgctc ctccacctga tctatatcgc tatgcttgat tccctcgtca    199500
     atttctccga cgtcccctgt caagtattgc aatctcgaaa tgagcttttc catatgtgct    199560
     atctccctgg tgtacagtag attctccgct ttaatgctct tattaagatc tttgaagtga    199620
     agaagtccat tcttcccaat ctcggttatc gtctgctttg cagtatcctt gctaaaatac    199680
     atcgatacca aacacatctt ttcactcctc aacatgacta ttttgtttgc ttgtcctggt    199740
     gaaatcaggg aagaactttt atttactttg tttcaaattt gaaaatcttt gcttctcgga    199800
     aaaatcgaac aaatgaggat agtcatattt tcctttccgt ttttggtaga ggggcagaat    199860
     agggaggatt tccgtcttag agatggtatg caagaataat cttcttatgc aaacccatcc    199920
     atacctacta aagtatataa gatggataga aaaccttcag taaagtggga ggagccagaa    199980
     agtgatcgaa agactgtccc aaaaaagata gaaaggccaa gcgtctcaac attggacttt    200040
     tggaaccggg agcttgaaaa tccgctggat tcagataagg atcaagacga atctaccgat    200100
     atggatgcgt ttttcacttc tacaggctgt ttggagaatg aaaaggaaag ggaatttctg    200160
     gtgtattcga aatttactgt acgggaaatc aaaagatcga ctgattccgt ggtgttagta    200220
     ggtgacaagg ttgaatgcca tctttcagga gaatggtgcg agacagagta tagagtaaac    200280
     gaccggatca ctgttcttca ctgcatctgt tgcaatgagc aggatgaaac atctgatatt    200340
     gattacctgg atgagatctt cgagtctgaa tgtggagatc actctatgat tgaagaaaaa    200400
     gaaaattcag gccaaagtat cttgagaaat cgaatctttg ttacaaatac ggaaaactac    200460
     ctcctcattg aggatgatcc catctccatc acaacactgt gtgagtcctt gtcatgcaaa    200520
     aataagcgct atatcaacac caagattgcc tctataaggt tttcttatac cgacctaaga    200580
     gttcttattg gagtagtggt tcattctgtg atggaaaagg ctctagttga aaggaacttc    200640
     tcttttgact tcttaacaag gcaaacgaag gcaaagattt ctaaaaatgt tgctctgatg    200700
     catagatgtg gtattgatga aaggacagct cttaatgaat cactgaagtt aataaagaac    200760
     atatacctgt tccgggatca caggtttgag gttgttgaga cggaaaaaaa gctcatgtca    200820
     ctcttgttta acatcaaagg gaatgcagat gcaattgggg aagactcggt cctcgagata    200880
     aagagcacca agtctcaaag agcagaacat cgtgcacaag taatcttgta tgctctcatg    200940
     cttagggaaa aaacaggaag agacttttct ccgtgtttgt actatattcc tacaagagag    201000
     atggttgaag ttaagctaaa gcatcaagaa attcgaagtc tgttaaacct tagaaataag    201060
     attgctgtta caagtgaacc gtgtgaatgt acatgcgacg attttagttg caatgctctg    201120
     cttaagataa aatctctcga cgagacacat tttctaagaa gtcagctaga cgcaatagat    201180
     tcagaagaag gaaggacagc agagtcattt attccagtta tacttcgtta tcaaaataat    201240
     actttagtta ggctggatat tcaaggagtt ttttctccca acaacatata tctgagtttg    201300
     ttcagctctg actttgtaag aatctcaaag gggattgttg aggagattaa tggaaataga    201360
     ctattggtaa gactaaacga agaaatactt ttcaaagata gagaaaagct ttatgtgtct    201420
     tttggagtct cagacatatt cttcaggttt atgaggtttt cacttgttca tattgcctat    201480
     ccaagatact gcacaccaga ggtgatagga ggattcaccc tccctatgga aaagatgggc    201540
     cttggtttgg aaaacggttt tgatgagcca aactcgggag acggagattc tcttttgact    201600
     gaagaattgg aggagtgtct taaaagtgat aaagaggttt tggaaaatga caaggaaaaa    201660
     atcaaagcgg atgggaatgg tggagataaa acctcttcta acatatcaga aatacatacg    201720
     agttatgagt tggacgatca caaaatcaca atacccgaag tttatcggga ggagttctta    201780
     aagctcaacg atgatcaacg ctctgcatta tttttgtccc tgaactgtaa gaactacaga    201840
     attatacatg gaatgccggg gacgggaaaa agtaccctaa tatgcctctt aattaagatt    201900
     cttgtttatc tcaaaaagaa agttcttctg atatgctaca cgaatcttgc actggcaaat    201960
     attacaaaga agttaagcgg aattagagtg tacactgccg gaaaggaggg ctttttcttc    202020
     aaaacaaccg aagaggccaa gttgttcttt gataatattg aactggtagt aggaacatgt    202080
     ttttcgtttt ccgatcctat ctatttaaat agacggtttg acttctgtgt agttgatgag    202140
     ggttctcaaa tgcacctact tctaaccttg atacctataa gcatttcttc gaagtttgtg    202200
     atagtagggg atcatctcca actaaaacct ctttctagat gttctaagga cctgagtatt    202260
     tcactttttg agtatttact tggaaaagat tactccaaac ttaggacaca atacaggatg    202320
     ggaaatgaga ttatgaggct gtcaaacacc cttttctaca gtaaccaact tcttggggag    202380
     aagaggccat cgaaggttga gtttatagac accgatatca tagatttcat ggcattagta    202440
     ccttcttttg aaaaatgcac tatcctctgc tatttcaatg cacaggtaga tactataaga    202500
     gaaatgacta gatgtattgt agaaacggtg gataggtttc aagggagtga aagtgacaag    202560
     gttgttgttg tctttgatcc tatttccaag tgtgaagtga tggagagcag cgaaaggctt    202620
     aacgtggcat tgacaagggc caagaagcac cttgttcttg cagggagcag gacaaaaatg    202680
     atggaaatag acatattgaa gagacttata agtatcttgt aagaatatcc aagatagttg    202740
     gtcaatcttc atttcatttt tgagtctgag tagtttatgc cccaacacca gatgttgttc    202800
     tatgagtttt tcaaatccaa cataggaaaa cggatttttg tgatgttgaa agctggagtg    202860
     tatgtgtctg gagtgctaaa cagcatagat ccatacctca acttgaatct cgaggaagtg    202920
     gagatcctta gcgaccaccc tggattgagt gggacttctc tgtgctcaat acgagggtcg    202980
     tctataaaat atatccttgc agatagagat gcaggattac ttcaaggagt gaatgctgga    203040
     agcaggctta gaatgatact tgacaaatgt tattgacgtc tgttaattga ataggaaata    203100
     aactactggc ttaaggatta ttactattac tatttgttac tctctttcaa ccccatttat    203160
     ttgagcttaa tgaaaggtta taagcgacaa tcgagggaat cgactattgt gaagaaattt    203220
     ctgaaagaac atctgaacga aggaactaca aagtctacat gcgaaaagat atatcagctt    203280
     tcacagcgtg tggctaaagc tagaatgagc aaaagactcc tttcggagat cataaaggta    203340
     tctaaagttt ttgtagatga ttatgcagaa aaaacccggg gaatgagctc aaaagataca    203400
     ggaagatgtc tttactcgtt tgattgtctt tggagtagaa gcatgaatct ctttgggaaa    203460
     gtgttctgtc caattatacg aactagaagg aagtttatag accgtttatc ttcaaagtta    203520
     tttatgcaat ttgtgaagaa catcgaggat aagatagtaa aatttataat agacaatata    203580
     agagaggaaa tacagaaagt agaaactaat aggagaacaa gtaaacctga atccagtagt    203640
     ttggaatcct cttctaacaa aaagcagaag ctaagccaag acgagcctgg aaaattgggg    203700
     gagcttaagg aaagggactt tggtgtattt gaatcgcttt ccagaaagga gaaaatttca    203760
     actttaatcg gcatacttca aggtagggga tgcttcgatc tgtttctaga aagagttgtt    203820
     gggagcttaa cttcggtcct tgatgaaaag atagataggg aaggtcttgg gattttagca    203880
     ataaagagac ttattgacga gcagagaaaa gccgggtata tgaaggacta cttctatgca    203940
     gttgaatcga atctgatgag aaaaatagtt ataaaatata ctaatgagga gattttcaaa    204000
     atgctggaca aagaggatga aatgagatta tgtatgggat ttttttgtgc ctccaacgag    204060
     gagaaaaggc ttatggaggc tttggatgtg tatttcagga aaataatggg aaatccttct    204120
     attgatgact ttattggaaa atactactgg atctacctca agtttagaga actagaaaat    204180
     agcaaggatg gaggatacga aaggattata gaaggaatta gaaactgtaa gaaagacatt    204240
     ctaaagttag atgcagagtg tgttgttgag tgcgtatgca gatggacgga ttcgtttcta    204300
     agaggaaaaa taatcatcca ggagaacacc attgaaggga tggaaagtcc aatttttatt    204360
     ccagggagcg aaaggaagga agtgataaat gtagaaagag ttttaaagaa aatagggata    204420
     gactctcttc ttgaaggtaa tggatggaga gagtatcttg tattgaatat tttcgatatg    204480
     attggagaaa tgtttcgttt ctgcgattac aaggagatgt ttgaaacgac attacaaggc    204540
     agattgggaa gtagacttgt ctctggatcg tctatatcaa tggactggga gattcgacta    204600
     attgataaga ttgattccgg tagaagcacc atagacaaga tgagatgcat gataaaagac    204660
     tttatggaaa cagaacaatt catgggccat gatattctgc ttcttcgggg atgtaagtgg    204720
     cctagatatg aagagactat ccttaggatc ccagatgttg aggaagtcaa gaaaaggtac    204780
     aatcacgtgg taaaaaacaa aagaaagata atcagatgga acgatctgtt atcatcctgt    204840
     gaaattgagt ttttgggacg tatggtgaga gttacattgc ctcaatacct aatgatgaag    204900
     cttttggttg aaaaggatag gacggctgag gatttgaaga tttgcaaatc ctgggacaag    204960
     aatcttgaag tattggttaa gaaagggttg gtgaaggtgg aaggaaaaag acattttttg    205020
     aacatggatt attggaaagg ggactttccc atggactcga tgattcctga tatgttcccg    205080
     ttgctaggac cgcagaaaat cataaagatg tttgatgaat ctgagtctta taaggatctt    205140
     ttagattgta aaataataaa ggaaatgaaa gctaataaga cactgagcaa aagtggtctc    205200
     aaagaactgc taaataagac gtatccacag gaaattctcg atgaaagaat agacagcttg    205260
     gcaaaccgag agtttttgag tgttgaggga gagaatataa agtatgttcc atgattccca    205320
     agtgttctcc atttccattc tgcaaagcgt ttattggatc cctatttttt tgtaaaatcc    205380
     aattaaggtc tttgaaattc cgaaaatccc cctggaaact atttcataaa aatgtttctc    205440
     ccttggagtg caatgaattc agaagctcgg attaaaaaga taatggagga gacaggatgt    205500
     tcactagagg ttgcaaaaaa agcggagcaa gaatcccaag gtaacttgaa tgcggctata    205560
     gaaatggcta agaaaaaagg aaatgttttg tattcagggg gaaacagtgg gctatatgtt    205620
     gaggaaaacc catcgcgaaa gtcaataact caatacaaaa atggaatcct ggtggaggat    205680
     aagttctatg atttttccgt agataataat atcagactca aggacatgct ggaaaaagga    205740
     acttttgatg catcacttct tgttttggag ggagatacag ccgaagtcat ctacagtgaa    205800
     aggttggatg aggaatacaa agaaaaaaag ccccaggaac cttctaaggt aacagcctcg    205860
     tttgtagggg aaggaaggca gattgggaac tccagcagag atattccttg taataatatt    205920
     gaagacacgt tagaaatagt ccatgatggt gatacagtat tcaaagttat gatagggagc    205980
     aaaagagtca cggtgaaaat gcacaagttt caaacagttg gcgatttctt cgattatatg    206040
     gagagatatt atgacttcgg gcttgttttg tctaccaatg gaaaagagat tccccctagc    206100
     catagtgttg aagaaatatc aaacaaactt gttctcctta gcagaagata ggtttaataa    206160
     aaatgattaa atttattaag tggtggccaa ttttattttt tctggtgttt atcacttcta    206220
     tatgttcaca atgctatgca ggtttattat tttgtttcgg gaggccgaaa actctcacag    206280
     gcatttctaa gtctgataac attgtcttta ctgaaagaaa agctgagaaa accaaacatt    206340
     tcgcagggaa aatacaaact tgcatacact aactctattt ctttatacgg ttctctacct    206400
     agaataagta tcttgtccat cctctccaca gaaagtttcc atagcttatt aatacatggg    206460
     acaatacagt cttccccact gtaaacgaaa atctcttctc ccttatctcc ttcagtagct    206520
     tctggagtat ctctcgcaac tttaatgagt cctttttctt ggagtagagc aagtaccccg    206580
     tacatcctaa ggtacagact tgggaaatgg aagttgtagt ctagaacttc aaacaactct    206640
     gactcataat taaaaatgtt tttcttattg gatcccggga gcctttttat aagagtatct    206700
     atattgccat ggagatcctc acacttagaa gcaactatta ctatcgcata tatgacatcc    206760
     ctcatttctt ttttgcctct aagcatttta ccaatggccc tatcgaatat ttgtatagat    206820
     gtactcctta ccgtaacagg taagtctaat tttatgcatg cctctataat ctcccatctg    206880
     tatcctatga tcctctctac agagttttcc attcaagggt gcggacaagt ctttatatta    206940
     gtgtgttcct gcatgaaatt cgtttgtatc atacatctcc aatcttaaat tacagagaag    207000
     aatttacaaa tcgattctgg aaacgttgca agcttggact gtgtaaacaa ataagattgc    207060
     ctatgaaaag tagattctat tctgatgaat aaggcccttt attatttcag aagctttcgg    207120
     agatcggaat tcagatctcc agctttcttc agtaccttat ggactgccat ttcaaagtcc    207180
     tcttgtgtta catggactct tctttctctc agagcataca ttccagcttc tgtgcataca    207240
     gccttaacct ctgctccaga gcatccgacc atcttgcttg ctattgtctc aagatcgata    207300
     cctttggtaa gattcatctt tcttgagtga atcttcagga tctcaagcct tgcggattct    207360
     ttcggctggg gaaactcaat cttcctatca atccttccag tcctcagtag agcaggatca    207420
     agaatatcaa ttctgttagt tgccattata actttgatgt tattatggga ctcgaatcca    207480
     tcgagctggt tgagcaattc aagcatggtc ctctgaactt cactatcact tcccttgttt    207540
     gaatctcctc ttgtagatcc aatagagtcg atctcatcca taaatattat ggacggggca    207600
     tgctctctag ccataacaaa aagttccctc accaatctag atccttctcc aatgtatttc    207660
     tgaacaagct ccgacccaga aactcttatg aacttgcatt gggtgtgatg agctacagct    207720
     cttgccaaca gggttttgcc tgttccggga ggaccgtaca gaagaactcc ttttggctgg    207780
     gcaatcccaa gattctcaaa tagctcagga tgttttattg gaagctcaat gacttcccga    207840
     atttccttaa tttgttcatc aaggcctcct atcatttgat atgtagaatc aggaactttt    207900
     tcaaccatca taagagatac aagcggatct acttttgtag gaagtattct atgaacatca    207960
     tatgagtcac tgcggagagc aactcttacc ccgggcttga gatcatcata atttactcca    208020
     ggctctactt ttgctaagta ctttccatct ggatttgttt taactaagac ttgcattttt    208080
     cccatttttt ctacaatcac tccaacatta gagctgggtt cctgcacaat agatatttcc    208140
     tccctaagaa atctgaccct tctgttcaac tctgccctct tctgttccaa aacccgaagg    208200
     actttactct tcttggctat aagcacctca agatggtcca gtttgttgct atagaagttt    208260
     ttgcaaaatc cctccaccat ctcaagggat tgtattagga ttagattttc attcaacaaa    208320
     caaacaactt ttcgggcaca ggaagactta gtaaattcaa ggcatattca ttatggaaga    208380
     gatcaagaag tcctctttgg catagatgtc tcgtccagta aagttggaag tgtggctgaa    208440
     gtttacatcc tggacatata tcggctggat tagcttagtg gtagagcatg gcgttgtggc    208500
     cgccaagatg cgggttcgat tcccgcattc agcacttttg cttgggacac tttttctttc    208560
     tagttttcct ccttccttcc aattttaatt tcaggaagaa caagtaaagg acctccaact    208620
     cctcttcttt tcaattccca atattccaat actttcaaaa gatctgggaa gtttccttcc    208680
     ttttgggtat atgctttaat ctttgaaaga atggatggtg tggcaaccgg ctgtagattg    208740
     cagagctttc tgaatagcgt aacctgaggg catgccattg gagccttttt tcggattatt    208800
     ggaggatttc gtaacttttc atatccaaaa taccttattt tggtcacttt tctgtagcct    208860
     aattcatatg gacttctttt caaaggacta tggtcgatac aataagatat tctattttcc    208920
     aaatcaaagt aacatttgtc tagagcacat gacacatggt atttcctaga acacataaaa    208980
     tacgagcagc atatcacagt tccaacagtt ttttcacaga aagaacatcc ggattctttg    209040
     gtataggagc taacatcaat ggggtctttt gataatggat ggccaaacga gagagatctg    209100
     ttgaacatag cacacaaaac atggccccat ctgttgtcgg atgtctgctt gaagatgccg    209160
     tctgaagaag ggcagaaaga acactctttt aggtcctttc catatataca tcccttgcac    209220
     aaccaaaaat cactcagatc ttgtattcca tagcagtttt catgcacaca tattccacat    209280
     ccttggcata caaaaagagt tccggtgcgt tccgatgcat gccttgtaca gatatcacag    209340
     aaggaagtgg gttctatagg ttttacgtgc ctggatacta aatcctgcac gaataggaac    209400
     cattcctttt ctaatctgtc gataactaac tcaaaaacat ctttggagat atcaattccc    209460
     gatctctcca aataaagttg atcatagctg tctagtttat acacgataga ctcaaagaag    209520
     tttccttttt gattccttct agttgttttc ttgctatccg attcactttc tgatgcatag    209580
     gtgctttttg aaataatctg atgcattttc tcgatctcca gattatgata tatcgatctg    209640
     taatcacgtt cctccctcgg aacgcctcca aggcatttgg aagtagacat ttttgggtag    209700
     taagattccc cataaggaat ggaaaatttt ttttctcggc acataaccat agccgagaca    209760
     ggaggagaca cttggattta cagtaaagga tacacggcta gaaaaaatat catctacaat    209820
     gagtctggcg aaagtatata tgagattcca tttgtcccaa aacacttcca tgttttagca    209880
     tttgaatact tcttagtcga tgaactaaac gctatatatc tggttaacaa aaatacattg    209940
     gaaatattgg agattggaag agtgaaagat gaagtggttg ctctcagtgt atcaagagat    210000
     gaaaaatggt gtgttattgc ctctactacg gagattcttc tctttgattc atatattgac    210060
     ttcaagaagt cgatcaaatt cgaatttaat gaagtaattc agattgaatg gacggactac    210120
     gaggtttttg gtgtactaac tagtaacatg atattctttt atgatatcga acttaatttg    210180
     gtaggaaaaa gcaaagaaag ggaatattca agtatttctt ggagaagcaa atataacgta    210240
     tttggatgct caacgggcaa ggaaatctgc ttcgttgaac caaatggact tgaacatgga    210300
     gatccattag aggtacgatg taacaaattg acttttcttg aaaatgaaga tttgctggct    210360
     actattgaaa ataatgacga aggttctctg ctcaaagtgt tttacacaaa gaattttcat    210420
     tggtatttga aacttttgaa gcaagtacct ggaggattcc tatgtagtga aaaaaatgcc    210480
     gtgctgttca aagataaaga gaggatagca aaggtttttt tgtttgagga gaagacgcat    210540
     agcggcccag aatattacgt gattgatgga aattgcatac tttacacaga cttttcgaag    210600
     aaaatcgttc caccaccttt cttctctgta aaaattgagt ttgatagtaa tgttatagat    210660
     atctttccat cagcaaagaa gggagcagtt ctcctgagag acaaagtgat tattttcaaa    210720
     tggaacggag ataattttat tagcgaagaa gctttttttt tgggaaggga atttgactct    210780
     gtcgttcagt ttaaaagttt tctccttcta aagagtaaag atgaatttct tataaagaaa    210840
     atgaatggcg gtgaggaaat acgtatcaac agaagtgtaa gaattcaaga agcaacaaga    210900
     agaaacatta tgaatgaaga aaacattaat gtcgttacta gccagctctg tgaaatattg    210960
     aacagttcgg ttgatgttgt tagatgttac aactttgaag aaaagctcta cttactgtta    211020
     gaagatggtt ctgttattca taatggtaga atagtgcatt caggaattga cctagagaaa    211080
     agatttgaaa tagtcatagg agaagatatc tttgttcata atggaacgaa gctttttaaa    211140
     aatggtaacg ttacagagaa tataacttca tttctgattg gagagcatgg aataattact    211200
     gtatctgaag gaacaggtag atttttctta ggccttaaag aaagcacttg ccaggttgat    211260
     cataggttgg agcttctgtg tgctctggac tttagggttg ttggattgac taggcatgga    211320
     acactcgaga catacacgcc taagatttac acgctaactt ttataaggaa gcttttactt    211380
     gatgggaagt ataaagatgc catagaagga tgccaaagat atataattcc ttttggagta    211440
     tttttggatt ataacattga actttgcaag ttcatagaag catgcaaaga tactcatctt    211500
     atatccttct tcaacgaagc cctacagacg tttggagatt tcgattttat tcttgaaagt    211560
     gaaaaggtaa aaagattcag aagggttttt aattttccta tggtcttgga gcctggaaag    211620
     ggaaaagaat attttgaagt gttaatagct aacgacgaat caataagtga tggctctctt    211680
     gaacatctaa tggaatatag aaatggaaag agccaagaag actcaaaatt gggtaactcc    211740
     agatactcaa gagaccttcc tagagacggg aagaaactat gtgggagaaa cacaaaagat    211800
     ttctttaacg agcttttcca gtcattggat ctggaaagaa atttcaagtt tgccattttc    211860
     gcactagtga aagtaaaaag aatggatctc gcgctccaag tagctaagca tgatatgaag    211920
     gggggaattg gatatatgct ttctataact aatatgagta acattatcaa ttctgcattg    211980
     gaaacttgtg aagaagattt ggtgcatgag gtgatgaaaa tttgccagaa ggactcatct    212040
     gactttcttt ttctgatacg taactgtgag aaagacctac gagggtttaa gattaatgac    212100
     ttccttaaga acagaataga tgcactttat cacataagca gaaccggaat ggtggatttg    212160
     gaaagagaat atatccagaa gcacgatctt gttgaagagg cattgatgta tgaggcttgt    212220
     ggtttgagta ttagaaagga aggatattat ttcaacctat gtgcagagct tcttccgcca    212280
     gaaaaggcat tgattctttt caagagagcc caaaacatag aaaaggcatt agaaacagct    212340
     atagaaaatc tctattggag agaagcatta ggcatgtgtg tcaaagaaag acaagaagaa    212400
     ctcggtaagt cactggctag taggcttatt gattcaggga agaattatga agcaggacag    212460
     ttatttgagg agttcttggg agatacagaa aaggccttca ttgaatatgt aaaggcaaaa    212520
     agtatgggaa atgctcttag actgtgttct gatggagaac ttctcatgaa ggaagcacgt    212580
     gaaattctca aggaaaagct tctggtactt gatgatataa agaaatcgtt tataaaatac    212640
     agagacagac tgaaaactct tgaggaaaga gaagatgatt gtatgagtga gacatcgttt    212700
     agttacaccg aaaacagaag aggtagtaag agtacaaaag taaagaatag gccaggagga    212760
     ggatatgaaa aagagtttgt actcggaaag attagagata ttggcttgaa tttgatgagg    212820
     tggagggatg aaaccgagga tcttttgaag gtatttgaga aatttgagat gaaagagtgc    212880
     atcgatgcac ataatacctc atttagcgca gtaggtgaag ttttaaagat ggaaatagac    212940
     aatgtattcg gaacagaaaa aagacatctt tatgaatcaa ataggccgat tgttgagaag    213000
     ccagatctca gcaaatggct ttaagttcgt atgttgaata gtcttgagac tggaagagaa    213060
     ttaattcaat aaatatttat tctctagctg gtgcttcagg agtatcagaa agaggtgtac    213120
     aatggttaat tcgggccaca gtacttttgc aaaaaataca gatgttcccg ttgcaacttg    213180
     gcgtaccatg aaattactca gtctctttgc gtctcctgtt cttataagta tatcgacttt    213240
     actgtcgaat tttattcctc tattgatttc atcttccgag gaatacgcaa agaaaatatt    213300
     cacaactata tctgtattgt tctcagtttc cttttctact tctataagct tgtttctgac    213360
     atccgaatca aggagatcca atcttccata aactaaaaac tttggcttga tacttgtctt    213420
     tttaggattt tttatcttct ttcggataat attcattatc ccgttcactt cttcaggagt    213480
     tcttctaagg ttgcttaagg cgaaacagaa aaaagaaact tccttaagac cataaaagta    213540
     cccgaaatta atgaattcgt atattttctg gaggcctgga tctcttgtaa acttgtcttt    213600
     ctgcccaatc ttcttcatat atcttctatt tccatcgcag atgaatgcaa ccctcatgcc    213660
     ttggaatatc ttaatcctgc ttcttcgaaa ggcgccatcc gaatgattgg agtatggtat    213720
     tccattccac acatccaagc ccatcgatgt caaggaagag gcctttcgaa aaatccctac    213780
     tatgaaaaga atcaactcca taatatactt attattaact ccattttcaa ccgcttccac    213840
     cacacatacc agaaccttcc ttgctagatt ttccagcatt caacaatcaa tggattccat    213900
     aaaaactttt taatagctta agcttagaat cctaataatt aattattaaa acacagaaat    213960
     gctgtaaatc gttttcattc acctctaaat aaagtctatg gtgtttctgt caagtctctc    214020
     tgtctccaac tctaatctat ttcggagagc gctctcctta ttcctttcat tcaataattc    214080
     attgttcctg attttcagaa tattatacat cctctctaac tcttctatat tctttttgat    214140
     ttcttgagtc ctcgtctcgt ctagctggag ttctctgttg cctatatcat actcctcatc    214200
     atatttcttg attctgtccg agaatatttt ctcttcatcc tctagaagcg ccagcttaga    214260
     cctctggtca tccatcatct tcgaaagttt taaaagctca tttctagata gtcttataag    214320
     ggccaatgtc cttcctcttt ggatctcaac ttcctttatg ttagtttgta agtttcttag    214380
     atggttcttc tttgtatgaa tcctcgacat catattatcc ttcattttct gcgtatcctg    214440
     tatcttctca gtaagctggt ctatgtcctg aagaagcttg tcaatgctat tttgcagcat    214500
     gttttctttt tgcttgctct gtgccatctt tagaacaata aatgacttct ttgctcccag    214560
     ttcgtctgat tgattagtgt tttcgcccat tccaaacccc atcccatctc ccaagggaga    214620
     tctagtatat ctagggacct ccatgaagga atccccactc tctctaaacg acaatggtat    214680
     gtatttgctc tgctcaggcc tatatcccga caaaatatct tttgggagat aaccctgtgt    214740
     tccagaccca cttccattaa acatctgttg attacctcgg ttaaataggc ttctaatgtg    214800
     caatgggttg agtaatgaac tttcttggta actcattccc aactctgggg tcgtatcttc    214860
     atccatcgag cttggtgttg accttcccat gtactcaggc ttggaggagt tcaattgtag    214920
     gcgattttcc tcgtcgtctt tcttacttaa gctatccttt ccctttccaa atagtttatc    214980
     ttcgcctcgg tttccttcat catatttaga aggtatgttc tcattgtctc caacaactct    215040
     ttttatcccc ttggtgttag aaagcagcac accatctctg ctgtttttta tagttcctcc    215100
     aagagcattt atcacttttc tggccatgtc tgggtctttg ttcggtctgt cagtgactcc    215160
     aagatcgtct acaacaacta ttttggatag acatacctga atcaaaacta ttattgctat    215220
     catctttgtt tattccctgt agcgtcttgt tgtttttaat tgctgtgttt cacaccaaga    215280
     tccaagtttc caggactcgg atgggtaaaa gagtctagac ttatgtgcgt gagtaaatgg    215340
     agatgtactg aaaagccctc aaaatgagaa agacagacct agaagatatt cgaagagttt    215400
     atgaaaagta tggggaggtt cttgacgtag ataaaataaa gaacggagca aaacatattt    215460
     tcaaatatgt tatggatatt cctggatctt tgcttgacta tccaaaagta aggcatcttc    215520
     gtttcttggc aaaagaaaag atcagccaga ttgtaagcga gataagaagt cagcataatg    215580
     aaggagacat agattcaaaa agaacattgg agtggatttc agccattaaa aatattagaa    215640
     aggtccactc tgcaattgta ggatatgagt ctgctcgtat agcatactgg agaaagatca    215700
     gcgtgatatg tgctagagaa ttgaaaagag ggctttccaa gacatccaga accaatccta    215760
     tacttaagtc aaagaaaata tacaaagaac tatttggaca cataaagaaa accgaaagaa    215820
     gcatgaagga caagtcgaag agagcagaga aggaggaaat ggaaaggaag aagaaggaga    215880
     tggaagaaaa agaggaactt cggcagaaaa gaaagtttga gtatctcctg agccagacag    215940
     aacttttttc tcatttcata ttgaagaaga gtaaatgcga tgtttcaaat acagaaggag    216000
     aagggactga agaatataat agcatgaagg gatacaaggc agccatgctt caaaaggaaa    216060
     aggtaaaaga gtttgaaatg ggcaagcaag gaaagaaatt caagagcgga gaagaagttg    216120
     gagaagtagc atctcgatat gtatctcagc caagtatctt aaagtgtgtt ctgaaggagt    216180
     atcaattgaa aggattaaac tggcttgtta gtctgtacga taaaggaatc aatggaatcc    216240
     ttgcagatga tatgggcctt ggaaaaacag tccaatcgat ttcgctgtta gcttatcttt    216300
     atgagacaga ggagatcccg gggccattcc ttgttgtaac catttcttca acactcgaca    216360
     actgggctca ggaattttca agattccttc ctagctttaa ggtatgccgt ttttcaggat    216420
     ctccaagtga aagaaaggag ctgaagaagc aattcaagaa ttcggacgtt gttattacta    216480
     cataccaaac agcagttagc gatgagaaga tgttgaaaaa gatcaaatgg cagtatatga    216540
     ttcttgacga agcacaagcc atcaaaagta gtatgtcgag gaggtggaaa actcttctga    216600
     gtttcaaggc aaggaatagg cttcttttga caggaacacc gatacaaaac tctatgcaag    216660
     agttatgggc tcttctccat tttataatgc ctactttgtt tgactctctt agtgagttca    216720
     gtgactggtt tagcaaggag atagaaactt cggcaactat gaaaaagact gttgatgaaa    216780
     agtctttaca aagacttcat actattctaa agccatttat gctccgaaga cacaaatccg    216840
     atgttattca tgaactaggg caaaagacgc aaattgatct atattgcaac ctgagctata    216900
     ggcaaagagt actatataag gaaataacta aatcttgctc aagtatggag atggagaatc    216960
     tgcttatgca attgaagaag gtttgcaacc atccagatct gttcaagaaa ttggagccga    217020
     cttgtggatt gagccttgaa attagtgatg gagtaggcga tactatttcg tttggtagaa    217080
     gtaagctaga cataaaaatt cccagtctta tcgcaaagga tgcacttgag gtgttccata    217140
     gaagggaaca ggaattaatt gaaagaatca atgcactgga gaagattgct tatggaaggg    217200
     gattctgggg atggtattta gagaacagct tagacttcaa atataagggc cgtattttta    217260
     gaagtgttaa agaggttggt aaatctatat tgaggaattt cgagaattta gattccaaca    217320
     agttattaga gagcctgaaa agattaatga atgaggaaat gtactgctta aaaagatatg    217380
     cttgctgcat aagtccggtt gttgctacag tacctaggtt gatttctaat gaagtggagc    217440
     tcccgggtat atatttggaa gatgtgcaca ttccacttaa cacaaccatc cacgtccctc    217500
     cactcaatac tttcattagc gacagcggaa aaatgataat tttggatgaa ttattaccga    217560
     gacttaaagc tgagggccat agattattga tatacttcca aatgacacgg atgatagacc    217620
     ttatagaaga ttatcttgtg aagaagggat acacatacct gagactggat gggagtctga    217680
     aagcttcggc ccgggcggac gtgatccgag attggcaaac aaatgacaaa tttatttttc    217740
     tattaagtac ccgtgctgga ggactaggta ttaatttaac tgctgcagat acagttattt    217800
     tctacgacag cgattggaat cccactgctg atcaacaagc aatggataga gcacatagac    217860
     tggggcaaac aagagatgta acggtgtata ggcttattac aaggggaacg gttgaggaaa    217920
     aggttctaga aagtgccaac agaaaagacg agatacagaa aatggttatt catggaaaca    217980
     tatttgaagg agagaacttt tgaaataaat agtatattgt gaatgcagta tcgattctat    218040
     tcatttgttc tttttgagcc aattgcattt atgactctat ttgaataggt ggcatccaat    218100
     ggaagtaact cttttgtaag caggctcctt tttatagaaa caaaataata tatcagtgaa    218160
     tatgaaaaag acaacctgaa tggaattctt ggacaggtta attcttggat ccagaactcc    218220
     aagatatgca gacgaagctc tttttccttc aaggacttac aaaaaaccta tgtgtaatag    218280
     aaaacattgc aatacctcat gtacttctag agtgctcgaa gaatttgaat tctgggctta    218340
     ttttctttct gaaaaggagc ctaacagaag agaggtaaga aagaaaattc atacgatgag    218400
     caaagacttg agattttcaa tttggatcaa atgtgttgga tctcgggaaa agtttataag    218460
     gatgaaggag ataggacttt ctaatacgaa ggaagcccga gatgttgaaa gcaaagaaga    218520
     tgggaatagg aagttggacg ataagggttt ggtaaagttc atattggaca tgtgtagaga    218580
     tgcggaagga aataaccaag aagctatatt caatattcta aagaatttag aaagagactt    218640
     ttcttcaata tctaataaaa agctccttgc attgaccata atgcacattc tggagcttcc    218700
     atatgcctcc ccacaaacta catatcgctt tattcattcc ttaatggaat ctcacaactt    218760
     ctgtagtgta ttctcaggat tcaatgagtc tgaactagat aatggaatgg atcaagatga    218820
     tgagaatagc gtccattcgg cattttggaa gttcatcatt tctgagaatg ctttggtgtt    218880
     tgacagaata atagatctct tagtttgtta tgagggtgcg aatatagcgt ctgttcccac    218940
     atttcttaag aagcagaccg gagataatga tgttcagaag tgggttgaat tcatttctgt    219000
     gagatccaat ctcgacaagc taggaagtgt tttcgacagt gagaggttag aaggtcctac    219060
     tgaggtggaa gacagagaag agacatactt tgacttttta gtcatccaga acgagacgat    219120
     aaaggcccaa gaaatgatga aaatagaaac caatgaaaag ttgaattctc ttaaagaaga    219180
     gagagatgag ctttatgcac aaaaggtcaa tcttatggaa gcatgttctt ccttggagtc    219240
     ggatctcaag gaatatcaaa aagaatacgt taagaaagta gaagagatgc tccatagtgt    219300
     tgaagataag tgcgagaagt atgaaaaaga aaatatggag cttaaggcaa aagtggatga    219360
     aaaagaacaa gtgaaagatt tgtaacaatt aaatagatat tttattttgg tccgtaactg    219420
     tttagactgt tagaaatgat ccccttgagt cttatgcata tcaagcaaat aaggttgaaa    219480
     aacttcaaaa gcttcaagga tgagactctg gtagaattta cagagaatgt caatataatt    219540
     gtggggcgga atggaagtgg aaagagtagc attgtctcag ctatccgttt tgttctgtgt    219600
     ggagagaaat acaactgtga atctaggatg gagcttattc acgaaggaag tagggctagc    219660
     gaagaagagg caagcgttga gattgtattt gatagtggat ctccggagtc cctggggaag    219720
     ggatttagta ttaagagggt tgtagatgcc aagaaagatg aatatatgct ggataacaag    219780
     actatatctc gagatgagtt gggaggtctg cttcaaggtc atgggtttgc cacaagtagt    219840
     ccatatttta ttgttttaca ggaagaaata tcggagcttg cagttcttag cgacagaaga    219900
     aggtatgaat tgataaaaga tgttgcggga gtgtctgaat acgaaaagga tagggaaaat    219960
     agcatgcaga cgcttgaaga aactaaacag agtgaaaaca aaattgagct gttattagaa    220020
     aggatcgaag aaaagttaag aggatttgaa aacgataaaa aagaggcaga gttgtgcttg    220080
     gagctagaaa aagagaaaag aaggcttgaa tatggatata ttgagagaga agttggagag    220140
     atcaatgaag agatatgtaa aattgaaaat cttggatcta ataatcttga agagagctcc    220200
     gaagaaaatg aagattatgg atgcgagatc agagaagtag agagcaaact agaaaggctt    220260
     ggtagacgaa ggaaagagct ccatgtagac gaaaagtaca aagataagga atctgagatt    220320
     gaaaatgaga tcaaaaatat tgagaagaaa aggaatgatc ttttaggatc ccttgagatt    220380
     gaaaaaaaga ctctaaagag tcttaaaagg aatgaaatgg aaacctttgt aaggtcgggt    220440
     tatataaaat atctaatagt gtttttagaa actctgggaa atagagaagt gagttctgaa    220500
     gaaatagaga tatccaagag agctttgaag gaaaagatcg agaagttaaa ggattttaat    220560
     aatctggatc attcggggaa gtttgaagaa aaaagaaata ttgaggagtt aattgaaagg    220620
     agaaagcatc tatggagaga agaaagaagg ttgaagcttt ccgaagaatc aataggggga    220680
     attgttaagt cccaggaagg aagattaatt gcgatgggaa acatcggttt ggatgtatac    220740
     aagcagatta agaatgaaaa gggggtattg ggatatgtgt acgatttgat aagcatacct    220800
     aatgagttag ccaatgcgtt tgaagccgtt gtgggaaatg ctctcttcaa tatagttgtg    220860
     gagagtgaag atgtggcatc taatgtgttg aaaaagatga aggacttaag gtttagagta    220920
     acatttatgc cgcttaatag aattgaatat aaggaggaaa atgagataga agattcgaat    220980
     gttatttcgt tgacatcaca attgaaatgc aaccagcaat ataagcctct cctcagatat    221040
     atcactaaaa atttctatct ttgtccagac ttgaaacaag cacttcatct gtccaagaag    221100
     tatggaatca atgttgttac tctctcaggg gaagtggtgg ccagggaagg aactattaca    221160
     ggaggatatg agagaagaaa catggttttc caggaatata agaggatatg caaagaatca    221220
     agaaagataa aaggtgaaat gattaaagtg cagcatgaac ttgggaaaat taataaggag    221280
     attgaagagg taaaaatgca caaggagtgt ggaagcgatg aatccagata ctacgaaagt    221340
     ttgaaatcct ccgttctatt tcttcaagag aaaataaaga tactagaaga agttgttaaa    221400
     gagaagcttg atggaaacgg tatcaacgga aagcttcgaa aattaagaga agaggaaaaa    221460
     gacctaaagc ttaaagggat ttggattgga ggagaaatta aaaaagttgg aatgagaata    221520
     gaagaagctg agataggagt taggaattta aatgaaggtg taggacgtct tcgagaagaa    221580
     ttaagtaaat ctagcatgta tagagaggca aaagagattg aaaaagagat cttggagttg    221640
     aaggataaga aaagagctgt aaaggagatg atgtttaatg aggaaaacat gggactgttt    221700
     gcaaaaccta aaaagataaa tgttgaagtg gaaaatctag tgaggagaaa gcacatgctg    221760
     ataaacaaaa gaaatgaact ctgcgaaagg atagggattt ccgacttcag aaacctagaa    221820
     aggctatttc ccgacaaaaa gaaagaggat ataatgaatg aaatagttag aataaatgag    221880
     agaattcggg ggctttcggt ggttaaccgg gtagcagtgt cccaatggga aagttatata    221940
     gagcagaaga attctataag aaaaagactt gaggaattga aggatgataa acggcacata    222000
     agtgaattta tagccgagct ggattctcga aaagaaggcg caatgggaaa ggccatgtct    222060
     gtagtagaag aaggattttc cgaattctat tcaagactca cggaaggagg taaagctgag    222120
     ctttactcat atgaatcaag tataggaatt aaagttggaa aggatgttgg aacaagccta    222180
     cttagtggag ggcaaaaggc tgtagtagca ctgtctctta tatttagtat gcaaagagta    222240
     aatccctccc ctttgtatgt atttgacgag attgatgcca atctggatgc ccagagtaga    222300
     caaaaggttt caatgttgat aaaagaaatg agcgaaagaa atggaagcca gtttataata    222360
     acgactttta gaaaggagtt actcaactgc ggagataagt atcttaatgt tgagttccgg    222420
     gaaaaaagaa gcaatattaa ggatatcgat gcaggagtag cccataagtt cctcgatgaa    222480
     gacctagggg aaagataaag gtcttgcacc tacagggctt gtacttttct aaagcgagtc    222540
     gattccccta attaaatggg tgaaaataag gactttattt ctccgcttga tttagcaaaa    222600
     agattgagat ctaacgtata tgatccagtt aaaacacttt tatcgattca atgcttaagt    222660
     cgtccacttt ccgtggacag aagccaagta agagcaataa gaaggctttc aaagtttctt    222720
     tttagtcttt ccctagataa agaggtgctt gtttccttgg cgttcaatcc cgaagcagtt    222780
     gatacattta tggattttgg taagatagtt atgcatcggg agtataacaa aatttattac    222840
     tgcattgata ttaagccatg aacaattgta gtaaatatct ccaagtttct ttttttgtgt    222900
     aaaggttttt tcataaaatc aaccaaaccc taatgctgaa agagcttatt gatgaagatg    222960
     acttctgcag aaagctgagg acatctaagg aggaagactc aaaaactggt ttctataggc    223020
     ttttttatgt tttattggac gatccgtctc tgcaagtgtt ggaaagcctt ctttctaatt    223080
     acacattgca ggatgttgta aacggcctca aacacctcat taagttcaaa ttcgatagac    223140
     taactaagga ggtctatgcg aacatacttc ttgtggtccg aatgatgctg gactatgaag    223200
     aaaacataga cacgcttatc ataaatcttt tgcggcacca tctagtggag gaagtgtatt    223260
     cgatgtacaa agacaagcca aagtatttca acaaccatcc aaactgtcta tcattcttgg    223320
     cgttcttttg tgctcagagt agcactagaa gagatgcttt cgaagccaat cttagcacac    223380
     gggacttctt gtttatgacc ataaaggaga tgatgtcagg ctcccacttt gaagatcaga    223440
     aaaaaaaaaa gataaagaaa gaatccatcc atggaagttc tgagtatcca atctttccat    223500
     ttacgtctta tttttcttca aagaaactct tgccggctct gtttatgcca acatctttaa    223560
     atatcctatc ttcccagctt tctgtggact tggagatgaa tattatgttt atcttggagc    223620
     atgaccaaaa ctttgacttt catttagagc tcctcttcaa gaatcatata agaaacttgg    223680
     atgacgcatg cagggtccta agatttgtag ttaacattcc atatccgcag aatattggaa    223740
     ggctagttaa ctcacttcta gacaagtatc cgtcatcgta tattgcagta atatatgata    223800
     tgctgttctg gaatcaaaag gaaaggttaa atgggaacct ggtggagtat ctcaaaggaa    223860
     atagtaacaa gattgcagaa aaaataactt ctcttcagga agaatggaaa ccattgaagc    223920
     tagcaatgga aagtattaaa aaaaggcaag aatgcacagt agaaagcata actaagatga    223980
     ttcatggtct caactttcaa aagtattttg ggcttgtcaa ggaaatggaa aaatggggta    224040
     ctcctatagt tccaaaagaa atgtatgata gaattatatt agaatcgtct gaatgggatg    224100
     ggtatgctca ggtttatcta tggaaaataa tagggtttca gaaaatttat ttaggactgg    224160
     atgttgacac accaaagaga atagaaagtc ttgagggaat agagggtttt gaaattatta    224220
     agagtctctc aaatattaaa aagagaactt gaaacatgtt ttttatctat aaaattgatt    224280
     tcctttttag aattgtatcc agatcatcct tatgtttttt tatctcaatt atgtgctttt    224340
     tcaaagaaag tgcgtcatca atcctcaaat gtcttaaaca aatcagatat ctcaagttta    224400
     tagcattcaa ctgttcatca ataagatcca tcattgactt tattcgtact acagtccatt    224460
     cgtttactgt gcttgctcga atcttcaact ttatgctgtt aagtataagt atctcctcat    224520
     ggcttagtcc cgtgggctcc aaagtaagaa tttttccaat taggtcttgc agaggacacc    224580
     ttgaagagat gcctaggagc ttaaggcact catcttcgtt tttagagaga agttttgatt    224640
     tcccaaggct ttttgctctt ataatttgaa atatcttggc atattcaaca gcaatagaaa    224700
     ttttgaagtc tgctggaaaa ggatgtagtc tacaaaaaca tgccctacac acaatgtcct    224760
     taataggcat cctcctgctg cacagagagc agctcgtaga ttttggctgc ttactaagat    224820
     attcgaaaat tagttttttc tggaatagac gttcttccat ctttatattc ctcagaacct    224880
     taaatgcatc cgtccagctg attatcatga ttcttttaaa tggctgtttg agcgtttgat    224940
     ttattattta gatagaaacc tgtttcaggg gagaaactgc cattccagga ttggaagaat    225000
     tttattgaaa tgctttaatc ggttttctta ttgctttcaa ttacatcttt tttgctcaat    225060
     tcactttcgg caacagtttt gacggcgtcg gttgcttttc tcaccgcatt ttcaattcca    225120
     cactcttctc tgtaccagct ctctggaatg cgtgctagta tgttatcata aatgattatt    225180
     cccccatgga atctaagagg acctgcccat agaaggaaaa agaactttat agtgtaccat    225240
     aagggaataa gactgataac tgtggtggag taagcatcta aggatgttag gattccaaag    225300
     accatccaaa acactagcat atgctttccc tcttcctttt ttgggttgac ctgcctcaat    225360
     ataacaaggg tttcttgaag aggaacaatt atcccgatgg tggatgttac taatggacca    225420
     agagatgttg tcatgataat taccaaacag agaaagctta ttccaagcag agcatactcc    225480
     ttcctgatgt tcatacgctt ctcaaaggca tccagaatag gaatcttctc agcttgtttt    225540
     cgcaaacaat ccattttcag ggcctatttt taaacaaaca tataggaaat tttggatttt    225600
     attgaccctt ggatttagaa tttcttattt tcatagcctg aaatggcgct ttcttcttcg    225660
     agacatagtt tctttatgga catggcctta gatcaagccg aaaaagcatt tgatcagctg    225720
     gaagttccag tgggttgtgt tgttgttaga gatggaattg tagtatcaaa atcccataat    225780
     atgacaaatg ctaacaaatc tccacttgat catgccgaag ttatctctat tagaagtaca    225840
     gactgttcca atagtacatt ttatgtaact tgtgagccat gtatcatgtg tatgggcata    225900
     ctagggaggt tgaagggagt tagggtgtac tatggatgta agaatgaaat ctttggaagt    225960
     gaaaccatat gcggggttgg gatagaaagt acgtatcttc cggatgatcg atgctttaag    226020
     atactgcaga aattctattc tagagaaaat gcatttgctc ctgatgaaaa gagaaagttg    226080
     aagaaccgct aatgagaaga ggatcgttga tatcgcctat cttattgatt tcagaataga    226140
     cagtaagctt tctgatggca agtatctggg gcatatgaaa gcgtgagaag agacccccgt    226200
     gtacgaggga agagttacag ttggatcaga gataaatttg tcattcctgt tgtcatttcc    226260
     aaaaaagtat gaagcctctg catcgagttt agatacaatt tcatttatct ggagacaatt    226320
     caaaatagag cattcgtcca aaatcaggtc tgccgtcgct cgagactcaa caagattgat    226380
     aagccttatt atagctgtag tatgagatag gttaaacatc ccctccagat agtttatgct    226440
     cctgcagaac ttatctattt cgtttatgtt gtagtttatc tggacgcctc tattgaaaga    226500
     caggaaattc tttttaacaa ggatctcgtt gaaaacagaa atattgatgg tcttcaaaag    226560
     ataattgatg gactccatga tatatgggtc tggaatgtaa tagtaggaca tctggtggta    226620
     gaaatattcc aagagatgta tgagtttgga gatgtgagga ggtttgaata gttttttgaa    226680
     atatccctcg ctacacttga atttggacag ctgctggtgt tctaggacag catgtggcag    226740
     gacttcaaga agaaagcttc tttgaagctc gcaaagatgt ttgaacagaa tggatataag    226800
     gctcttaact tcttccacat tgttaacacc gtatccacga agtatgtttt catattcaat    226860
     gagatttgat agtataaaag aaaccttatg tatgtttctt tcaaacatat gtagttgaag    226920
     attgatctca ttcatcatac aagcagtact ttccactata ttcttcccaa gcttgtttac    226980
     ggcatagaat gcagaatgag caagccctag aatttcaggt tttggcactt cctcattaga    227040
     aaatgtaggg acaaattcca gataaagctg taccaagcaa ttgaacacat tgtaggcatt    227100
     ggtaaatgat acactcatgt gggagtcgtc atcctcctct ttttcggaaa ggcgtttttc    227160
     caggtcctca acctttgcct tgtatttctc aagttccagt tcaatcatat tttttttctt    227220
     taaagcttca ctttgaaatc tatacttcag ttcaagagat ttacaattcc tacaaggagc    227280
     ttcgcagaac tttttatact tttctatctt taactccaaa tcccgtatga tttctttgta    227340
     gcttctctgt tttctattat cttcctgtgc attgcaggga tctgtagtat tatatccttt    227400
     atctatcata agctctacag aattgctttc aatcgaaaca gagctttctg cgaccacagg    227460
     ctcatttaca aacatgattc tttgcttttt atcacagtta tggttattca aatagctcct    227520
     caatgcattc tttatatttc taaaacattc ttcataaaat agagatctac gaatctctaa    227580
     aatccttagg ctctcattac tcatgaagta tctgctcttc ccttttttca ccgtcaccat    227640
     ttcaaatgtg gtggatccaa ggacttcgta acgggtttca aactcgttct tttgtatctc    227700
     ctgagggaaa cattgcttac ttattcttat tgtttctagg acaccacact cggcaagttg    227760
     ctttgctatc aatggcctgt caaatagctt tggtttcttc tgtgcattcg gccttataca    227820
     tttaatatac tttgtctgtg tttcgtttat agaatgaagc agattgttca tggaatcttt    227880
     aaagtactta accaaatctt ccttattttc ttcatgaata ataaggggat tttcgaaaat    227940
     tttcaggttt cctctttctc tgttcttgtc tagaaaagat cttaagtcgt attctacatc    228000
     tccagcatag tgagacacaa ctatcttgtc gtcggccttg gttctaatat ttccttttag    228060
     ataatttttt atcttcatac ttaggttctg aacatttccc caggcattaa aactctcctc    228120
     acttattaaa tccataagtc cacaaggctt ctcaaagtct aggatacatt gattgttgtc    228180
     aaagaactca acatctctcc attcaattcc ctctttcttg tacatttctt gttttcctcg    228240
     gaaaaccttc ctaataaaat cattctgtat cttttcgttc gtccagttta tgcaaagctg    228300
     atcaagcccg ttcttttcaa aaatctcaaa tccgaatata tctaggacag atataaaaag    228360
     ctctccattc ccgctcaggc agttatttat agacgatgta atataattga atatattgga    228420
     atacaacaac cgagccatcg agtttcttat tgtaactgct tgtttcaaag tgttgaagac    228480
     ttcaatggtt tctcccttaa cttgaataga aaacttgaca agagattctt caaatgcatc    228540
     ctcttgaata tcatgaagct tacagaattc tttaaaacat tcgttcctca caaccttcaa    228600
     aatcccatct cctccaaatt gaatggatcc taaatataaa attcctaaaa gacaatcttc    228660
     aatcttgttt atgcaagcca cccccacact ttccattgcc gaacgtgttg ccgcgtattc    228720
     ttttgacaaa cgcatagaat attccttatt tcctacaaga cttgaagtgt caataaagtc    228780
     gttcttaaga tttaaacctt tagatgcaca gaattggtag aatatatgaa agtttttttc    228840
     tccaatttca tggtgcgtta ctctactttt ttcgaggaga tatgtttcaa atttggctcc    228900
     tgttattttt ccattgaaca ttaccttaat tctctttcca aacctcgaac tattgtcatt    228960
     aagaattgtc tgggcatttc caaatgcctc taaaatagca tttgctgctg ctatgttcct    229020
     ttcgatcgag gcactacttg cagttctctc tatcaagtac tttataatca gctttgcgtt    229080
     ttcggttttt cccgaacctg attccccact aatcacaata gtttggtttc catggataaa    229140
     caaatcctga tatgcagact ctgccactcc ataaatatgt ggatagctat aagcataatc    229200
     agcaggcgac tgcatgattt cttttataga aggattgagg ttttcgtacg gattaagagc    229260
     tagaaatacc agccctgatc ttgtatagat cttcccagat gcatatctct tctcaagtat    229320
     gtcggaaata acatttccat ccagatctcc tagttcgcat aggtcgtcgt tttccatctt    229380
     aggacataag gacctcttct tttgttttct aaaggaccaa taacctctaa aagcgctgat    229440
     tgaaagagat ttaaacagtt ccagaaccaa tgaaataaaa tctaacggtg aaccatttaa    229500
     tagaactgat agcagcaacg ccaaacaaat catctgatgc tctatttgtc tttaagacgt    229560
     tctaggtaca tgtttaacta ctacatctaa tttcttttca aagtataaaa ggctgcacaa    229620
     gagatcgtca tcattttcaa atattacaag cgaatccttg tccttaataa agagggaaaa    229680
     ttcattgtaa tggtctaaac tcacaaaatc aagactctga gatgggagaa aatggcttcc    229740
     aatcttcttg attacgcttt tcttaaagtc tgagaaacac atacttgcaa gaggaactag    229800
     aaatttcaaa tcagcaaatt ccacaagtgc caagcccatt atgtcattct gactcataat    229860
     tcccccaagc tttttggcct tgaatatacg aaagattttt cttttatcat ccgatgcaca    229920
     tggtatcttt atccacactc cgtttctcag gccgaacttc aaaccttctc tatttttttc    229980
     aactctcaaa atgttttcat aagaaacttc ccccactttt cgatctttat agagaatcgt    230040
     aaatctatcg gggtaaaagg atgtggaata atcaagggtc ttggatctaa atttatatct    230100
     gccctgtatg gttgctaata tgctgctatt attttcggag ttcatagttt tcccggtttc    230160
     tgttgttttc aatagtaatt acaaaaccat tagtttcaac ttaatcagaa ataaaacaaa    230220
     ataagaccga agatccttat ggaatatacc gccaaatatc ggaaattccc tccaaggata    230280
     gatataattc acggaactca aaggggataa tgatagataa aataagatca tttcttccat    230340
     ctcctaggtc gctggagcca ttagagccct tgaaaaagag agttaaaagg aaggaacgac    230400
     cttcaaaatg cattctctca agatcaatct acgaggaaac agacctttca agactcacac    230460
     ccaggcagag attgcttcat caaaagtatc aggaaaacaa aaataatgta tcaagctttt    230520
     ttcttctttc aaacaatatc ccaatagaaa gacatattga tatcaaacca aaaaaattga    230580
     atgaagaagc tcctagtaaa tctacggata aatccataga acttgattgc gaagccaatt    230640
     ggaaggttag agatggcaat agcctacagg aagaaaagaa ctttttaatt ttaactagtg    230700
     acctgtataa tagctcgtac aaagatattg aagaggagca aagctcatca gaaagtaacg    230760
     atgaggtgat agaggcagca gaaatagaat ctccctttcg tagtaggata cccgaaaatg    230820
     ctagtgataa agatcatcat atctgcaaag attgtttcaa agatgccgtg gaaatatatt    230880
     acatccttga gaggataagt gatgtacata agtgtaggct caaaaacttt atattacttc    230940
     ataagtacaa aatacggcaa aacttcaaaa aaaagctatg tttcagtaca atcagaagag    231000
     aggaaaccgc atttataaaa acattggaga aggttgaatg ttgtatggag aaacctaggt    231060
     tttaagagct actgaaattt tgatattaag taaaaccgtt tatttatttg cctatttcct    231120
     tttcttcaaa ctcaataaca ctttcaattt cttgaactat aggtccttca tcttctagtc    231180
     gcgtgattct tgttatctca aaattctttt catatctgtc cgaggaatta tcaaataatt    231240
     gatcccttat gggacagaac atagatatca gaagcatatc aagtattaat ctggctccca    231300
     agcttaaact ttgctggatt tgatggtgta agtctgtcat ttcaaatggg attgccactg    231360
     tgttaatagt ataagtaaga aacccgtgga acatgaggca gaagcttaat agattcgtac    231420
     tgtcaagaga cttgtactca gatagaaaac tgtgttttgt tcggagaatc agaagcaatg    231480
     ccacagaaag atatacctca ttcccaagga gaaatgattc tataaaaact gcagtcttct    231540
     cccccatcag tcttgatctg ctatagtaat aatacaaaag agccggggct cttaagattg    231600
     catatatctt agaaaatgta acaacagacg tgttaaacat ggacttggcc acaaaggttc    231660
     tagtcccagt cgagctggac ttaaatatat caaaaggcct atctcctcca ttgaataccg    231720
     agtatgcaca aggcccccaa agcccaatca aaagaaatac cgaagacatc ctcaagattc    231780
     tggacccgat aagggaaata ttcaaaagat acacaagatc ggctttgaaa tccttgtatc    231840
     ttactggata gtttgcatca agccatccaa caagctctat gtttgctttg tctatttcaa    231900
     gtttagtgct gagatacgta acaatgcata tgtaaattcc agataaaaat atagaggaca    231960
     gcgcaaaaat ggagccaaga cttcgtaatt ttcctctaaa tatattgtaa ctgggcatag    232020
     tactccttgt agatctccaa accgcaaaga caagaagtag tagggaaaac actgcttcat    232080
     ttgtgtacga aagaatcttc gtgttgtcta aaaaaccatc gtcctccatt tatttacatt    232140
     aagagctctg ctttataact cccgtgtttc aagttaaaac atgtattaaa tgtcgaaata    232200
     tatatgcatt tctgaaaggg atttttccat atctttgttt cctgtatatt agtcttgtac    232260
     ggcagttcat tccagcaatt aatcaaagaa tagagagtat gcaaatctct tctttctctg    232320
     aatgctatgg aaggaaaatt catatcaact tgtactttgt agagtcatct tattatttct    232380
     ttattgagtc cttcttatag cccacttcaa gaggttctta atgcatttct ttaaggcgca    232440
     taatatcgaa gatttcttat atttattaaa gattgtttcc tataatatta aatttataaa    232500
     gttttcgaga aggaactagt taaagatatt agaggttccc ttcagatagg gtaatgacct    232560
     gaaataaaag ataaaatgta aaagattgta ttttatcaag actcttgttt attcaagtag    232620
     gaaaattcaa agaatttttt taacagcaag agagaagaga tttttggtaa tgaagaggaa    232680
     gaaaagaagt gatatgaata gataaactac ggtaagaacg gtgaaaataa gaacaaagag    232740
     gatttgtctc cagggagtag tctcaatatt ctttggaggg gaatatttga acctgagaaa    232800
     cttgaatagg gtaaagagaa agaggaaaag gtggaagaga aggagatggt ttcttttaag    232860
     gaaaaaaatt aaaagaagcg aaaaaccagc tagggcatcg atagcagagc cagagaattg    232920
     aatggtgctg ggaataggag ataaagaggt aaagaagaag taggtaattg acagaaggaa    232980
     caatgaagag gaagaaagaa ctttgatgtt ctctggtttg agaagaggaa acataaaaat    233040
     taaaagaaag gggaggatgg agaatagaat gaggagaaac ttgagaactg aatggaggat    233100
     tgaatggaat atagacatcg tgttggagtt attgatggta gaaaataagc agaagtttag    233160
     aaaagttaac tgaagcagtg gaatagcaaa aaataggaat ctgataaagg aattgtcctt    233220
     aagggtattc tccccaaaga ttagaaacat gagtagagga attaagatgg atatagaggt    233280
     accgaggtgg ctgtatagat ctggagacca ataggattcc cgtttagagt tctcatgata    233340
     ggtgtacata ggtgtagaag ccaactcagt aatgaaaatt gaactcatat tcatatg       233397
//

If you have problems or comments...

PBIL Back to PBIL home page