(data stored in ACNUC8465 zone)

HOGENOMDNA: ENINT1_6

ID   ENINT1_6; SV 1; linear; genomic DNA; STD; FUN; 196642 BP.
XX
AC   CP001946;
XX
PR   Project:42703;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Encephalitozoon intestinalis ATCC 50506 chromosome V, complete sequence.
XX
KW   .
XX
OS   Encephalitozoon intestinalis ATCC 50506
OC   Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-196642
RA   Corradi N., Pombert J.F., Farinelli L., Didier E.S., Keeling P.J.;
RT   "The complete sequence of the smallest known nuclear genome from the
RT   microsporidian Encephalitozoon intestinalis";
RL   Nat Commun 1(6):10-10(2010).
XX
RN   [2]
RP   1-196642
RA   Corradi N., Pombert J.-F., Farinelli L., Didier E., Keeling P.J.;
RT   ;
RL   Submitted (22-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Botany, University of British Columbia, 3529-6270 University Boulevard,
RL   Vancouver, British Columbia V6T 1Z4, Canada
XX
DR   StrainInfo; 819376; 0.
XX
CC   Linear chromosome is missing portions of the telomeric regions.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..196642
FT                   /organism="Encephalitozoon intestinalis ATCC 50506"
FT                   /chromosome="V"
FT                   /host="Homo sapiens"
FT                   /strain="ATCC 50506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="host nasal tissue"
FT                   /db_xref="taxon:876142"
FT                   /culture_collection="ATCC:50506"
FT   gene            complement(36..2475)
FT                   /locus_tag="Eint_050010"
FT   rRNA            complement(36..2475)
FT                   /locus_tag="Eint_050010"
FT                   /product="5.8S-23S ribosomal RNA"
FT                   /note="similar to ECU01_0023"
FT   gene            complement(2516..3808)
FT                   /locus_tag="Eint_050020"
FT   rRNA            complement(2516..3808)
FT                   /locus_tag="Eint_050020"
FT                   /product="16S ribosomal RNA"
FT                   /note="similar to ECU01_0025"
FT   gene            complement(<4024..>5604)
FT                   /locus_tag="Eint_050030"
FT   mRNA            complement(<4024..>5604)
FT                   /locus_tag="Eint_050030"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(4024..5604)
FT                   /codon_start=1
FT                   /gene_family="HOG000215104" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU02_1540,ECU11_2090"
FT                   /db_xref="InterPro:IPR011667"
FT                   /db_xref="InterPro:IPR022115"
FT                   /db_xref="UniProtKB/TrEMBL:E0S724"
FT                   /protein_id="ADM11452.1"
FT                   /translation="MIWICGVEVLGMMNVVWGASPERAVANTEIGIEKKMNDEKIRRRI
FT                   KKVLYNSPDIFNYRKMILYPFVIHNDSFLVFPTTKYNEIESGKREYVKKIMREITKVAL
FT                   KCMGVLNTSIYYEWIKSLIEAFATAKIQSGYFDSVYLSYEKNGTFRDLTKRIVKECKKT
FT                   LDELGEILTSKASEEIKKIEALPDPDSEENKKRKEKLKEIEIHGKVIRTIQEQDQIVKG
FT                   MNMVCDECLNLWKREEDIKSFILKLGLRRLHAKELRIKPKNSYYQYKSDILSLIGYLDH
FT                   NLLINTNKEHGREVAAELVKEAFLEYKDDYENEINRIVLEVEERKKRNTDEKEMKEKEA
FT                   NQNAEELMREEEEEKRRSKGKGKGKVVENSRKRKIVTKDKKEEIEDKKSEKGAVGGKKE
FT                   EKTKKKNYEIHGRVFQWKKEPEVIKNILDEGTEQKWRGRSIEEIKEQKKFHDIVEAVGL
FT                   LRHEDADDFFDLTRSYEERGVKRERKVALAMLETKESGKEIGIVEVGIFRDGGNDVVYH
FT                   GFGGQGSML"
FT   gene            complement(<6324..>8756)
FT                   /locus_tag="Eint_050040"
FT   mRNA            complement(<6324..>8756)
FT                   /locus_tag="Eint_050040"
FT                   /product="kinesin-like protein"
FT   CDS_pept        complement(6324..8756)
FT                   /codon_start=1
FT                   /gene_family="HOG000149464" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050040"
FT                   /product="kinesin-like protein"
FT                   /note="similar to ECU05_0060"
FT                   /db_xref="GOA:E0S725"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniProtKB/TrEMBL:E0S725"
FT                   /protein_id="ADM11453.1"
FT                   /translation="MEDKKNTIQVEVRINPRLDNVIESTPSALTVGTKTYTFSKVHLTT
FT                   SQVQIYDRSVRHLTESFLEGYNCTVMAYGQTGSGKTYTMGMTHEDMTGIVPQSLKHIFK
FT                   ITQEVNCIFIEVYNEEVIDLFSKHKMPLSLREVNGEVTIAGASEVTLKSYEDGIEALKK
FT                   GSLERTTKSTNMNSKSSRSHAIFTLFHRKEVNGSFITSKFSFVDLAGSERLKRTMCAGD
FT                   RAKEGISINSGLLALGNVISALFKKSSHIPFRDSKLTRILQSCLNGYVLMVACISSSHA
FT                   DIGETHNTLKYASRAASIETTTKMNIQVDSSKFTTLLLKKEIQKLKAENQILKEKFRRE
FT                   SKVNIEELILENRSLKSKLETLDFEKNDRREDIVQEILKHPFVQNLINENQKLKDTIQR
FT                   MPREPENRGLITDEYKGLESFKRKASENRINSPENSSRKKRDEEKLKIVAELDEPEAST
FT                   NNPGDNEYKRQIENQSQREYNKIDTIRKYVDSLEISDTCEIIEDQMTHAASSKTHKRIV
FT                   SFDLERNTKKYALFTPRKEKITMNTTIVEKLSGYLPTTLALFDSCLVFGSIDNKIRKWS
FT                   DRTETLFTEEGVRCMEGLETLLYTTRGILKRFDHRSGTRPVYGFRSEVSALLSRDNYIF
FT                   TGHEDGTLSILDQRNCKLAFAEKAHSGTVFCIERMGQDTYTGSRDHTVKRYNDGFITLS
FT                   PPHLDSVQGLLCYKNELISFGRDCSLRRWKDGTIVKTVPYAHDSWIKCGASMEDSFVTG
FT                   SKDGMLRFWDFLDSSMFCVGKMKIVGAINSVIWDGKLIYVGTQSKEILAIRCKYESN"
FT   gene            <8850..>11567
FT                   /locus_tag="Eint_050050"
FT   mRNA            <8850..>11567
FT                   /locus_tag="Eint_050050"
FT                   /product="patatin-like phospholipase domain containing
FT                   protein 6"
FT   CDS_pept        8850..11567
FT                   /codon_start=1
FT                   /gene_family="HOG000113869" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050050"
FT                   /product="patatin-like phospholipase domain containing
FT                   protein 6"
FT                   /note="similar to ECU05_0070"
FT                   /db_xref="GOA:E0S726"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001423"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E0S726"
FT                   /protein_id="ADM11454.1"
FT                   /translation="MMLLVFLIVIMIMTGLLAGFKHYGSSKYRTIPFKIKSRAPEKIAS
FT                   TRLLGMTIEDAMKRHPLFNFYPRQSIKEILESWDRVKYKNGDIITTPGFILQGCVEIWY
FT                   GNSLTCIKEKGSFLNGSMELLGYTTRGIKKAKGFVEVLLVDASLARTDVWYILFSMVRK
FT                   SCIEVACKYFELEGKLVEKETMKIGGDGMSHLDLFLDFLNRKFLQGLDDGKEALKKSIE
FT                   TRFVGKGEVLKDSGEPMDYIVYVVSGEIQVLAGENAFSFGNGSLFGYFSLFFDSYSSIK
FT                   ILAKGDSSILICNSSVLFKLGLDEKRFDHSMLLDIDECLHVIDESVEWIRLSPGDMIVQ
FT                   KGGTSKEIFYIAAGSIKSASKEFSSGMAIGDRECIFGENWGESFVATKITDIVRIPSLL
FT                   VDYFFENDKTFFKKYTKRLFENGSRKNGKIVSIIPIGQYRDIESFSRRLRAAIGASSLL
FT                   LNRKDVVDILARRSFDTTEELGFMDYLTKMSKRYEIILIYVENEYSRLLRYLLNFSDIL
FT                   LTVGTTFADIPEYNVYCRIEFVKIYEERKALNERSMRKREKTAPSRTGNANEKETPRQY
FT                   DRIHHVLFPSKTILFCSKDFQRLARSLLGKRIGLVLGGGGARGLAHIGVIQALEEEGIP
FT                   IDCVGGTSMGAFIGALYARECNNYYVFKQAKRFSRKMSNIWLLLLDLTYPICSMFSGHG
FT                   FNRSLHSVFGDSLIQDLWLEYFCITTNISNYEEEVHRNGMIWRYVRASMGLCGYLPPIC
FT                   DNKKLLVDGGYLNNVPADVMMSMQVEKIITVDVGTVLENDYFDYGDTLSGFTILFNRFF
FT                   GNKKFVTMEEIQYRLAYISTERKTKELQANGNIVMLKPDLGKYRTMDFKKFDEIVACGY
FT                   QSTKDAISEWKRKGIFDTLFLNLKKQTPKRRYSV"
FT   gene            <11710..>13680
FT                   /locus_tag="Eint_050060"
FT   mRNA            <11710..>13680
FT                   /locus_tag="Eint_050060"
FT                   /product="hypothetical protein"
FT   CDS_pept        11710..13680
FT                   /codon_start=1
FT                   /gene_family="HOG000150213" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050060"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0080"
FT                   /db_xref="GOA:E0S727"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S727"
FT                   /protein_id="ADM11455.1"
FT                   /translation="MIGRFSFLKREVRKSPMNQDLTFKDDPFRIIDYSKDEKAQFLRNL
FT                   RDRITCNEREKSLLFETGFTKDRNFNGSVEESAISLEVLALLATSKNQDIRQGVKACSS
FT                   QVFEFIKLQPLPPSSIHISMFRSFRIIISEVDQDSFCDKYLPFFLSVIEMEHQSLCLNS
FT                   IKNEIIELFYQMLKIDKKIKFKLKGRRFIKILCSPNLNGIKLLNELMNEDVGKHIKMKH
FT                   LLERVNSSNINNKLEVLSCCAKLYKLNHSGDTRVMERILYELNELVEYKKESLVLVGSM
FT                   VQDNIQGQLFCRDIGLVSKIADQFHEGHPNLLTPELLFCLHSLTAGLEENRKIIAKSKI
FT                   IPSVFGAFKQRVNRKQIDLVFVMIVLLLKSMTKSITFLRSDLLDYPVIDLLIAVLDHKF
FT                   PDTVDGIDRMIAEEDLNSGFVEENILNVLVNLVMEYGDYKNKFIASNGVEKVLNYTSKF
FT                   PLVVLQIFKNFLYDTGFNSKEVFIKATDRRFFSKFLDMYEESRNTEILEGCFNLMRNLL
FT                   CDDTLDYIVQSYEGMIDSIFLYLDRFANETTVSENSREENVLLQILYTVVNLSANSDKF
FT                   KSLVLNKKHLDNMKKVSTTRNLSIAFIWIIINLSWKEDGSENRVQILCDNGIKEWLIKI
FT                   QAKDSVLADKIGTALENLRLT"
FT   gene            <13811..>14173
FT                   /locus_tag="Eint_050070"
FT   mRNA            <13811..>14173
FT                   /locus_tag="Eint_050070"
FT                   /product="hypothetical protein"
FT   CDS_pept        13811..14173
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050070"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S728"
FT                   /protein_id="ADM11456.1"
FT                   /translation="MKQTSIYKPSCVFLFNSGMNVGLRSLYFIFISMAFMLMKCRCIHH
FT                   SHSYGHSMHNRRWHHRDLRGWRHPVVERNAYAYRRRTPAYNGREMITLEELRKPNVPII
FT                   VPYEVTPKQVLTLLRH"
FT   gene            complement(<14602..>15267)
FT                   /locus_tag="Eint_050080"
FT   mRNA            complement(<14602..>15267)
FT                   /locus_tag="Eint_050080"
FT                   /product="GTP-binding protein Sar1"
FT   CDS_pept        complement(14602..15267)
FT                   /codon_start=1
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050080"
FT                   /product="GTP-binding protein Sar1"
FT                   /note="similar to ECU05_0090"
FT                   /db_xref="GOA:E0S729"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:E0S729"
FT                   /protein_id="ADM11457.1"
FT                   /translation="MFSNIQGYLELVKFKLTEFYEKVFQNFIKSLFGKPSSILFLGIDN
FT                   AGKTTLVNKLKSDSTDVYMPTHHPSTSYIEIGNLKAQVIDLGGHTAARLAWRDYFYDCH
FT                   GIVFIVDVHDVERFLEVKEAYETVRALEKKAPIVVLMNKIDLEGHTPETAEADYQWKSW
FT                   LAQETGIEDQEDPEKGQVVKIFYVTITSGSANSITGPLARAFKWLEAMISYNNKKESL"
FT   gene            complement(<15404..>15865)
FT                   /locus_tag="Eint_050090"
FT   mRNA            complement(<15404..>15865)
FT                   /locus_tag="Eint_050090"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(15404..15865)
FT                   /codon_start=1
FT                   /gene_family="HOG000150212" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050090"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0100"
FT                   /db_xref="UniProtKB/TrEMBL:E0S730"
FT                   /protein_id="ADM11458.1"
FT                   /translation="MEGILHKINSLLKNPRLEDVLTVFEIDGYIRLNRVYISPFSLRQL
FT                   LIKLAGLDLVSWHMTPNGLFFQFRGFYLKFYGSVNIVVRQKVFCIEIDFDPSIDGGAGV
FT                   PVLKELERYLKGCDALFFMTYFMDIDKEILHNPLSESLDFLYKKNSVRK"
FT   gene            <16045..>17016
FT                   /locus_tag="Eint_050100"
FT   mRNA            <16045..>17016
FT                   /locus_tag="Eint_050100"
FT                   /product="hypothetical protein"
FT   CDS_pept        16045..17016
FT                   /codon_start=1
FT                   /gene_family="HOG000150211" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0110"
FT                   /db_xref="UniProtKB/TrEMBL:E0S731"
FT                   /protein_id="ADM11459.1"
FT                   /translation="MKPFLIILSLINITSTETKSRAHSLRHKRYNNNHLSQNHLHRNHD
FT                   FSHSTHNKPLSGIGISGIRRISPVYLPGYTSPLVADVGGDSGESGVILAPSASNGSIKE
FT                   NVGIYVSPSPNGQDTNTKERLVSLHHLIHHAQGEALKAKAMSSAAKLEASQLIALKQEL
FT                   NAKIMANKAEMLREEEERLVSQRSADPLVLVKDTVPIANVANNNLSFEHHNELLSQKLN
FT                   MIKKDQDDAVKKAEKLARLHKARTEILPDSLVSSDPDQFKEFVAAGPVQDLTFEIPVDP
FT                   SVGNYYISGNPEGSLSSEGMNLTQGDLPYFVAHQEGSAYSSS"
FT   gene            <17574..>19511
FT                   /locus_tag="Eint_050110"
FT   mRNA            <17574..>19511
FT                   /locus_tag="Eint_050110"
FT                   /product="hypothetical protein"
FT   CDS_pept        17574..19511
FT                   /codon_start=1
FT                   /gene_family="HOG000150210" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050110"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0120"
FT                   /db_xref="UniProtKB/TrEMBL:E0S732"
FT                   /protein_id="ADM11460.1"
FT                   /translation="MDRTKGILKVENVEITMEGQVICRNQKIEAVGVYGISGLYNALRD
FT                   ALMASLTIPVISDTSLRFYGNISFDGSPISYKELRKMMNLFTMFYSCESVQSSLEFVNF
FT                   SKVKDVMSAFELEAINSCELSKLGISESRRWEAAVNVASGSKVVVLRNFHSPYKNVRKY
FT                   LSFLVEHARNNGSVIFVEDDFPLEHGLNGCVIIKKDGFECVNFSIEKEFYRYKRVLLEI
FT                   FLKELEVKQNDEKDAKESNSSASINESSDGSWDMAGPLGKPVGFSAFRGNALNSDKYIE
FT                   DSEIDFHGNFTDPRIVIFDDAVVYKLKDPQLSSNSEQKISDVSKTYDRGNSCCWIRRIE
FT                   ELFTKWFFSVDIRLSLLLTRRKCFLEEKKTKDFRKFIVSFLMQVYLAIILKFKGSIFND
FT                   TTIFSMLSTFLNPLEVSKRWETSVEDLIKRILSTPISTMVRCFVDFPGVCFSLMGSTFR
FT                   NTGKFIGQIRSYNWDLVDYKIISTGVYFLVFTRGGTMVNEERFQNYSRRNRIYSPGTYF
FT                   FHIFIYLFLKAWIPVLLISYILNFNFVPVFLVTATFTCALLNLVLNLKLKYMLMCIALA
FT                   FNLLYPLDGEHFQKSFFLRSSESFNLLVACRQFPLASSPREKLILLGCLLRGFLFIYFF
FT                   FCYIFAKINT"
FT   gene            <19793..>20770
FT                   /locus_tag="Eint_050120"
FT   mRNA            <19793..>20770
FT                   /locus_tag="Eint_050120"
FT                   /product="hypothetical protein"
FT   CDS_pept        19793..20770
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050120"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0140"
FT                   /db_xref="UniProtKB/TrEMBL:E0S733"
FT                   /protein_id="ADM11461.1"
FT                   /translation="MNKKSFLRIFIITILALGITLLAFFLLREKPLGYLTEEDVQSLSS
FT                   ELQFRFKDSGKNEDGNEVTDVKFFVCLNSILKLFNSVEISLINTFLSYGEKSSKGEKKE
FT                   EEDYNHKGLYVKSALQEARNIMFLSPTSKEAIVEILQKENEKKKESELLDTVRKAFSEV
FT                   QLSPEEDDDSSRQKKEELNKVLANLFIWFWLKGTPPADKRINTFKGAYESNQDIKKYLL
FT                   EYLDEENKEVANATISVSGENEVIPVIDHILLSIFNASIYMGLGISPTDIPAATAILAA
FT                   GGILEKEGEQIKKGFFQGLQDFFFGSPKQEQSLQQSEKLEKNDG"
FT   gene            <21104..>21847
FT                   /locus_tag="Eint_050130"
FT   mRNA            <21104..>21847
FT                   /locus_tag="Eint_050130"
FT                   /product="hypothetical protein"
FT   CDS_pept        21104..21847
FT                   /codon_start=1
FT                   /gene_family="HOG000150209" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0150"
FT                   /db_xref="UniProtKB/TrEMBL:E0S734"
FT                   /protein_id="ADM11462.1"
FT                   /translation="MKSKKLGFLTLISLVVVGFVTWYVLYNLYYLFMSDEIANSIFDKS
FT                   KLRGKFEDSGKVIEGTVFFSFLYKFLTTLDEKVIGDSCIEDVYDKSILSGKEDYLRNGL
FT                   EMVTRALFKNRNVEKDLKEILESSISDIVAPIKRHEVQYAEEEGKNNGEEDQKYNEDVT
FT                   LMVSKAFVYILLRERLDHSMYKKYLDKVKDDFNENTKDHLKKIGISERIYIFEGESNVG
FT                   MEIYDYIRVVMFATSKLIPDSLTKN"
FT   gene            <21874..>23151
FT                   /locus_tag="Eint_050140"
FT   mRNA            <21874..>23151
FT                   /locus_tag="Eint_050140"
FT                   /product="putative aminoacid transporter"
FT   CDS_pept        21874..23151
FT                   /codon_start=1
FT                   /gene_family="HOG000149463" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050140"
FT                   /product="putative aminoacid transporter"
FT                   /note="similar to ECU05_0160"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:E0S735"
FT                   /protein_id="ADM11463.1"
FT                   /translation="MFDHLINVYFSLILREMSKVLTERSAAMTMVASMLGASIYFTPIA
FT                   FRFVGYIYGWIIIFIIASLTSFSLYCISYSAIKIGKGQTYSSLGVYISPRLKHVLDGFV
FT                   IVNSLSANVCLYRYLSELVVAAFPELLLTSFSYETTRKGIVAVLLIPFFALSSHKNLSS
FT                   LRYVSLAMVVSIGYFIFLLISYNLFLYPKYTSYEETSFPLSNGFSFSIPIFITAMACQS
FT                   NMVKVLDEMASDSMRKVKLVSVWSGVGGGLIYGLIGHLGYSLFGNTLNGDLLRILADKG
FT                   SSINIQLASTVDKYLISSRVAVYGCILIFIGSFPIQLNPLITTLFNILPEERRTNTTRM
FT                   FLMAALIMLCFFLVLVEDLSAGLVISIGGATVTNFISFLFPFIFFISVRKRFSLSTFLA
FT                   LVCIAACVSSSVYMLANIVTGRNKIM"
FT   gene            complement(<23214..>24692)
FT                   /locus_tag="Eint_050150"
FT   mRNA            complement(<23214..>24692)
FT                   /locus_tag="Eint_050150"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(23214..24692)
FT                   /codon_start=1
FT                   /gene_family="HOG000150208" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050150"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0180"
FT                   /db_xref="GOA:E0S736"
FT                   /db_xref="InterPro:IPR006564"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:E0S736"
FT                   /protein_id="ADM11464.1"
FT                   /translation="MKGLSVNDILSTREEAEKALIDHAVRNNLNYDLEETPKSISVLCK
FT                   GREEFGCDARIVAQLRKKDGVFVVKRIRLSHKCPVVTSKYGSPDEMVRMEVQKAIGDRY
FT                   ARIGEILSVLADMNIKMGYFSVWKAMRQNDKTEKENMEMICGEEGGKDELFGRALKEFS
FT                   QEFLELNPCAVAHQKKKMFFFSFPEYLDVLVPIVEIRIYKRTEGFAMLGVLRDPTWSPI
FT                   VYSCAVSDTGSRESTFEYFIDSMPKLFFLVDFDCELINILRRKERDFFVKTRDICKFYY
FT                   NKNKSIDGVEDIWNKCNTSKEWSTPELNFMERKHYLKSCCETEMLGMQNTSECDAEFIG
FT                   LGIFNLPFFDCVCAILKLSSDNLSQRKKASFGEGKGKGLFGNNVIRRIEKNTSVETADT
FT                   FYDVDLQNQTCTCGKFQEFLIPCPHACKKILDSGEDPYLYVSDLYSKTRLQDLKDIIPV
FT                   ADLPVKCQSDRNLLKRGPGRPKKILVREPSAVRS"
FT   gene            <25129..>27312
FT                   /locus_tag="Eint_050160"
FT   mRNA            <25129..>27312
FT                   /locus_tag="Eint_050160"
FT                   /product="WD40 domain-containing periodic tryptophan
FT                   protein 2-like protein"
FT   CDS_pept        25129..27312
FT                   /codon_start=1
FT                   /gene_family="HOG000149462" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050160"
FT                   /product="WD40 domain-containing periodic tryptophan
FT                   protein 2-like protein"
FT                   /note="similar to ECU05_0190"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S737"
FT                   /protein_id="ADM11465.1"
FT                   /translation="MREYRLKSVIPTESESRGLYYDGEVYFSSNNHLFKASRGRYTKIC
FT                   DVGGTIIDFSISEKFFIVTEERMYMNNENRMVGSLKRRFSCMAINKNLMAAGYSNVLEI
FT                   WNVPKEFKLPLFDLHSRHLGHFLEITSVKFLSDNLVLTTSRDCTVRIFDILENKSSRLC
FT                   NTMSVPIAAYTMGGENKELIVICEDGTLLYFEIDGENIISKGIVHHNSKVLASSSSLGF
FT                   VAISLDKESGENLLIYNGQEMVYSASVEHKILSIYLHEDSIAVKGPKFVGIYSLSLNLF
FT                   VFELDLPRIMTMDVKKDMIAVGCSDKKVRIYDGERCIHTFFDSNATHAVFGVHILQNSV
FT                   LCLYLDGKVSIWDIKNGICYRSFEIPVRISASEVSDDNLLLFIADFNNYSVRVIDLQRG
FT                   KEIDTLQGHEGPIFRMKWDGDSLYTLSYDNTIKKWNVYSQTVTELQSRKMATGFSVRNG
FT                   KLCVATVDELSIYDSGFNYERGIKVSLKARKRNEIFISEKPVESLDFTFDNRFIISGGE
FT                   ANTMQMISTETGDVAQVLRVSDNREWENYKEVLGKESSKSFDKTKIIEVLKIMHSSTQR
FT                   EFYVLTREGVSIYEPSLVKFIPLRLDVSLTPESIKEYLDHGEYLKAAIGSLKINEYEIV
FT                   KEVLLSCPYNRIEGVVKHLDAVLAENLRLVVSKMLDSPIHHSTAIKWLKSIVFYFGSSK
FT                   TQGTELHKLRREIDLTLKIGKLNKSMLLNIIEK"
FT   gene            <27423..>27788
FT                   /locus_tag="Eint_050170"
FT   mRNA            <27423..>27788
FT                   /locus_tag="Eint_050170"
FT                   /product="hypothetical protein"
FT   CDS_pept        27423..27788
FT                   /codon_start=1
FT                   /gene_family="HOG000150207" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050170"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0200"
FT                   /db_xref="UniProtKB/TrEMBL:E0S738"
FT                   /protein_id="ADM11466.1"
FT                   /translation="MCCGNFYCFTFGCISIPEKIDVPEGYPEPAKKFLCPYCGCLTDSV
FT                   YRKDKYFFSICFIPCIPCKESSPYLSCTSCKRNLGSIGDYRCKKCGVATTFESNNCPNC
FT                   GGEKTQSSGGYRRLDMV"
FT   gene            complement(<27862..>29139)
FT                   /locus_tag="Eint_050180"
FT   mRNA            complement(<27862..>29139)
FT                   /locus_tag="Eint_050180"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(27862..29139)
FT                   /codon_start=1
FT                   /gene_family="HOG000150206" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050180"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0210"
FT                   /db_xref="UniProtKB/TrEMBL:E0S739"
FT                   /protein_id="ADM11467.1"
FT                   /translation="MFFLLLFSPNKHMEEPRNRLCSTLGQSYKIIGTSPIIPVFLSLTY
FT                   FTKGVKTEYYTYGIIASGILMGLSLYIVEYIGKKRSEEKLKSLGDISRGFCGPLSKTVD
FT                   VFSAVLKYTTLLITVDVFFNVLFIYFPFLDEIRKSMAIYKILFGLGLALVGLTLYVFST
FT                   FSRKIFLIISASASILFIVAIIAGYFLGINSALPKPSYSQGSLLPSFFWVTTIAFYTAE
FT                   FISGGVKIIGESMHRESAKYVAITSSLSVSGMYLVLLHLARWIRSSYNSLDILNLMFLR
FT                   SSKLNTYLRTSTIDKYCITTKVMCILIPIVCISLFVIQFDSFVESFKNLVNAEGDTRLW
FT                   LLSLLVLSIVFIQVLFNEIIGPFHFYVVLFVIGMTPLLVYHPFICYIFASKKIKFFTAV
FT                   CILAMIFTSAALVGTIRTLIDILQKN"
FT   gene            complement(<29242..>31584)
FT                   /locus_tag="Eint_050190"
FT   mRNA            complement(<29242..>31584)
FT                   /locus_tag="Eint_050190"
FT                   /product="putative WD40 domain-containing protein"
FT   CDS_pept        complement(29242..31584)
FT                   /codon_start=1
FT                   /gene_family="HOG000150205" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050190"
FT                   /product="putative WD40 domain-containing protein"
FT                   /note="similar to ECU05_0220"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S740"
FT                   /protein_id="ADM11468.1"
FT                   /translation="MKVHFNLKKQMKPILTTGVPKRQGDILYTQFNDLIVETDVKTFQI
FT                   LREIPFDSLKCFDVRDGYIVACSKGIVIYNLAKGVVEDVVQFSKIEVCSMVVDELVVSD
FT                   EGFSAFSVVVGRVDGSVSKIDLVSKAPLWSYRMDSMIRKLERFGNMVCSADANEVWIYK
FT                   GGEELLKYHEPEVVGIGYNGRHVCAVTREGVLKILEKSKKVALDTKCDFMVGDGQFLYI
FT                   WKGLIVHVYDYDGKIQYKRDILAEREGSSQSMLRFRKEDGSFEDESEENGFPNGKERCE
FT                   IYGENSDDCYEDESGTDDGYKKRKHVSDMRNTVVEEEIKVDDEVIVEGMSQGVIVTSEQ
FT                   EIFLVDESLRVTSVIIGNNDEITDMKKWNDVLFVATNSGRLRYTFVDGGEGSYAFNGDI
FT                   VPAHSEAIMSLSINGNFLMTTSRDKKAILWKIVLKDTENREEKSVVLKRIKTLENGLGG
FT                   LNGCVLGASIFVLVGSDQILQIWDYKDNVFMERIHDKEINSVEINEERRLIATCSQDKK
FT                   AKVFNFEGRILQVLSGHTKGVWSVSFGKNLMATCSADTTVRIWDIETFECVGVLTAHRS
FT                   AVLKGQFYRNDERFISGCATGEMKVWNVKKRTCEMNIDVHRDRVWAFISGSLLITSGNG
FT                   LIAFFQDDSQEVLNRTIAKKNEKEMQTIELERCLRNNLNVKAVEILSRTDDYKQLFRMI
FT                   VRCHRERSNEIFTIFEDKHKMFFDLILKQGTFKNCVVIQWLIEESLRRGWKMSSEVLDK
FT                   VYKVTEKYSDSIDGIYSTLLGFTIFER"
FT   gene            complement(<31657..>32019)
FT                   /locus_tag="Eint_050200"
FT   mRNA            complement(<31657..>32019)
FT                   /locus_tag="Eint_050200"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(31657..32019)
FT                   /codon_start=1
FT                   /gene_family="HOG000150204" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050200"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0230"
FT                   /db_xref="UniProtKB/TrEMBL:E0S741"
FT                   /protein_id="ADM11469.1"
FT                   /translation="MKPVDIYEYYVERVVEILKLKEIRMQMEDIKRMGVTIAVFDFCGK
FT                   IPLVHKLFVGVKKEVFVVYDVSKCREEIYEAFKGHDLIYVLEDIQSAESNIFYKYNNAI
FT                   FLLFDRFRFIRCMKEG"
FT   gene            <32084..>33610
FT                   /locus_tag="Eint_050210"
FT   mRNA            <32084..>33610
FT                   /locus_tag="Eint_050210"
FT                   /product="NADPH cytochrome P450 reductase"
FT   CDS_pept        32084..33610
FT                   /codon_start=1
FT                   /gene_family="HOG000149461" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050210"
FT                   /product="NADPH cytochrome P450 reductase"
FT                   /note="similar to ECU05_0240"
FT                   /db_xref="GOA:E0S742"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniProtKB/TrEMBL:E0S742"
FT                   /protein_id="ADM11470.1"
FT                   /translation="MIPILYGSQTGTSIYVSNLIERALLYGYDPKTIYNLDCFFNSRDQ
FT                   ENLSSVMEMDLFDIEKILDIDFIIFVCSTHGDGTEPFNMTKFWSFLSNSDLPGNLLSHL
FT                   NFAVFGLGDSSYEKFNYCSKKLFNRLRMLGAKPVVRRGDGNAQDKEGFLSDLRPWLLEL
FT                   MAHFDPLKIKHIDILSLKPEKYTSRLVGKRLLTPEGHFQKIIELVFEIPEYKEFSPGDC
FT                   LSFCPENYNYKEFMKYNGMEEDVDGISSSLMMKHSIDFNSQPHQPFFFALRYFLDRKGG
FT                   IEDEVLLKIEEIAQDYDLYYEYIVKPKRTIFEVLQELRVKVDARFLKKFVPTIYPRFFS
FT                   VTKKKGLYHVTVAVVNYKTILSQPRRGVCSEYLMGLSLNDKVPIGIGRSNLYFGSNKLL
FT                   FICTGTGITLPRACINEFKDKEIVVFYGFRYRDRDFLYSDEWNCKNVRMLTAASRDDKM
FT                   YVQDVFNRNPIEDIDEYLIFVSGNSRLNKEVRKLFQKLYGRTIAFQSETW"
FT   gene            <33680..>34435
FT                   /locus_tag="Eint_050220"
FT   mRNA            join(<33680..33682,33719..>34435)
FT                   /locus_tag="Eint_050220"
FT                   /product="440S ribosomal protein S3A"
FT                   /note="S1 in yeast"
FT   CDS_pept        join(33680..33682,33719..34435)
FT                   /codon_start=1
FT                   /gene_family="HOG000149459" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050220"
FT                   /product="40S ribosomal protein S3A"
FT                   /note="S1 in yeast; similar to ECU05_0250"
FT                   /db_xref="GOA:E0S743"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="UniProtKB/TrEMBL:E0S743"
FT                   /protein_id="ADM11471.1"
FT                   /translation="MAIQPPGSYPQGNKKGKAKKKAGQNTFERKEWYNLRSPSIFPCNI
FT                   SGKTFVAKSTSKNTNLKLIGRRYDVNHADLTKNNDFTHRKFIFKVGDVKGADCIGFFDG
FT                   MELTSDKHKAMIKKWHTLIEAQKDIVAKDRSVFRVFVMAVTRRPQGYTKKTCYVKHSEE
FT                   KKIRKIMFDVIEQELGGRSVDEIMNKLSNETVGKRIEELGSEIFPLQNCCVRKVKTIKS
FT                   YQGVSIGQEEEVGAIAN"
FT   exon            <33680..33682
FT                   /locus_tag="Eint_050220"
FT                   /number=1
FT   exon            33719..>34435
FT                   /locus_tag="Eint_050220"
FT                   /number=2
FT   gene            complement(<34514..>35284)
FT                   /locus_tag="Eint_050230"
FT   mRNA            complement(<34514..>35284)
FT                   /locus_tag="Eint_050230"
FT                   /product="phosphomannomutase"
FT   CDS_pept        complement(34514..35284)
FT                   /codon_start=1
FT                   /gene_family="HOG000181843" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050230"
FT                   /product="phosphomannomutase"
FT                   /note="similar to ECU05_0260"
FT                   /db_xref="GOA:E0S744"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="UniProtKB/TrEMBL:E0S744"
FT                   /protein_id="ADM11472.1"
FT                   /translation="MAKDEKTIFLFDVDGTLSESRAQMTEKMKKMVRKLKKKVCLGFVG
FT                   GSDLEKQKEQIGDDLLELFDYGFPENGLSFYKKGALESQEKIIDVLGEKFYKEFVNFVL
FT                   EYLSKLEIPIKRGNFIEYRNSMINISPIGRNCSREERKEFFEIDKKEKFREKMVAAMRE
FT                   KFKGSCMVFSIGGQISIDCFPKGWDKTYCLRHIKKEGIENVYFFGDMTQEGGNDYEIYI
FT                   HKDVHGITVKNPDDTYEKVRQKLKDLGLGDIDED"
FT   gene            complement(<35453..>36490)
FT                   /locus_tag="Eint_050240"
FT   mRNA            complement(<35453..>36490)
FT                   /locus_tag="Eint_050240"
FT                   /product="glycerol 3-phosphate dehydrogenase"
FT   CDS_pept        complement(35453..36490)
FT                   /codon_start=1
FT                   /gene_family="HOG000246855" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050240"
FT                   /product="glycerol 3-phosphate dehydrogenase"
FT                   /note="similar to ECU05_0270"
FT                   /db_xref="GOA:E0S745"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S745"
FT                   /protein_id="ADM11473.1"
FT                   /translation="MSKKVSIIGNGNWGTAIGRLLASNTMESSIFEKDVRMWGYREEFE
FT                   GRILSDIINSERNNPKYLPGIHLPENLKAVEDICTLSDSDVLVFALPHQYIKAIEPLKG
FT                   LVKSNCIGVSLTKGFIGAEDGDIDLVSRSIHRILNINVSVVMGANIADQVARDMISEGT
FT                   LGYTDEDAADIVYKLFNSYTYRITKIKDVYGVEISGALKNIVSMGYGFAEGLGYCCNTK
FT                   VAIFRNGFAEMRKFFKFFYPMATIESLFQSSGVGDLLVSCISGRNFKCAKLMAEKRMSL
FT                   KEAEDTMCFTKLQGPNTALIVYNYLKRQKRTDEFPLISTVYRICYEDKGYDSILECISS
FT                   ESIEQ"
FT   gene            <36627..>36917
FT                   /locus_tag="Eint_050250"
FT   mRNA            <36627..>36917
FT                   /locus_tag="Eint_050250"
FT                   /product="DNA-directed RNA polymerase II"
FT   CDS_pept        36627..36917
FT                   /codon_start=1
FT                   /gene_family="HOG000149458" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050250"
FT                   /product="DNA-directed RNA polymerase II"
FT                   /note="similar to ECU05_0275"
FT                   /db_xref="GOA:E0S746"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="UniProtKB/TrEMBL:E0S746"
FT                   /protein_id="ADM11474.1"
FT                   /translation="MASTRKVEVNYVGNTRNTIELKIDGETHTLGSLLSEELLEDKRCL
FT                   FSAYRVEHPTDNHVFLRITADKDCQVKDLLLETLKRIEEDTVLLISQLKGF"
FT   gene            complement(<36992..>37357)
FT                   /locus_tag="Eint_050260"
FT   mRNA            complement(<36992..>37357)
FT                   /locus_tag="Eint_050260"
FT                   /product="deoxyuridine 5'triphosphate nucleotidohydrolase"
FT   CDS_pept        complement(36992..37357)
FT                   /codon_start=1
FT                   /gene_family="HOG000149457" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050260"
FT                   /product="deoxyuridine 5'triphosphate nucleotidohydrolase"
FT                   /note="similar to ECU05_0280"
FT                   /db_xref="GOA:E0S747"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="UniProtKB/TrEMBL:E0S747"
FT                   /protein_id="ADM11475.1"
FT                   /translation="MEEEGFSVKVLDGAKVPELINGVYKLYSNCSGKVDPRCGAKIPAG
FT                   FMMKIPKRYFGKIQSTRIKKLGGVVDSDYRGEVCVIVYNDSDEEFVYEKGDEIGEMAVC
FT                   EIITPNIREAGDYDPSL"
FT   gene            complement(<37428..>38135)
FT                   /locus_tag="Eint_050270"
FT   mRNA            complement(<37428..>38135)
FT                   /locus_tag="Eint_050270"
FT                   /product="proteasome type-4 subunit beta"
FT   CDS_pept        complement(37428..38135)
FT                   /codon_start=1
FT                   /gene_family="HOG000181719" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050270"
FT                   /product="proteasome type-4 subunit beta"
FT                   /note="similar to ECU05_0290"
FT                   /db_xref="GOA:E0S748"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S748"
FT                   /protein_id="ADM11476.1"
FT                   /translation="MKFLRNAPEMRDFVTGTSVVSFRYKDGIIMGADAKASYGRLTKFN
FT                   GVQRMFKFGSRTLVGISGEVSDMQYLIKTLNILTEEDNREIDPKGYHKMVQRILYSARS
FT                   RISPLNLSVCVGGVKTVRNSEEEFETNEKTLGCVDRLGNFYFSDVICTGIGSYLALPFL
FT                   RSKVEGREQEITREEAIRLVEEAMEILCYRDCNASNEVQIGYADSQGVHISDPYLIKTN
FT                   WDVGVREDEIVIE"
FT   gene            <38230..>39924
FT                   /locus_tag="Eint_050280"
FT   mRNA            <38230..>39924
FT                   /locus_tag="Eint_050280"
FT                   /product="DNA mismatch repair protein MutL"
FT   CDS_pept        38230..39924
FT                   /codon_start=1
FT                   /gene_family="HOG000149456" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050280"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="similar to ECU05_0300"
FT                   /db_xref="GOA:E0S749"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0S749"
FT                   /protein_id="ADM11477.1"
FT                   /translation="MEIKRLPNDVISRISAGEVITRPYNILKEVIENSLDANSTHIAIK
FT                   IGIDGLSLTIEDNGDGIHEEDFELLCKQYCTSKLTKEEDLFSLSSYGFRGEALSSISRC
FT                   SRIRVRSKRRENEIGHEAVYRDTEIVAIKGIGMKDGSVVEIKDIFYNNKAREKHFSKKR
FT                   DEIREMMWLVGIYSVFNEDVSFDLFYGGKLQEIPKSKMYSGKDGSSNEDRVKMKIKMLD
FT                   ELYKVDGELLFLFDEGHLAIFSTPQFSLKKGVFILFVNGRLVVSQEMKEALFKVYRGLI
FT                   SDERQPFIYLELNIEKSMVDVNIHPSKREVLFTNEESVIQRLYECIENKLNKMNYEQKT
FT                   LRPLPRESSFQSPIKVYSDPASQSIGECLEKEKTERREFSLFSLKKLRTEIVELDSSFF
FT                   KALNYVGAKDRDTILVQHGSSLLNCRTALLLKEYLYQTLISDFGNFEKKKTLIPIESDI
FT                   EDNMRALLNDYFSIEIVERNIVSVPIISTICIDLPTLWAGLDVKKDSEYETLKNIINTI
FT                   STLYSSAEMSPKLFNVIKRKIVGTEKALECFGLVVTLKELYKNFERC"
FT   gene            <40030..>41928
FT                   /locus_tag="Eint_050290"
FT   mRNA            <40030..>41928
FT                   /locus_tag="Eint_050290"
FT                   /product="acetylcoenzyme A synthetase"
FT   CDS_pept        40030..41928
FT                   /codon_start=1
FT                   /gene_family="HOG000229981" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050290"
FT                   /product="acetylcoenzyme A synthetase"
FT                   /note="similar to ECU05_0310"
FT                   /db_xref="GOA:E0S750"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:E0S750"
FT                   /protein_id="ADM11478.1"
FT                   /translation="MNKGEYEALYKRSIEDKESFWEEQAKAFLKWDKMFDKVYNNNFES
FT                   SRWFEGGMLNACYNCVDRHAACNPDKVAIIYDRNDGESICYTFKEVLDEVIRISAVLKA
FT                   EGLKKGDTVALYMAMSPYAVFSALACARLGLVHNAIFGGFSASSVALRLDDSNAKFLMV
FT                   QDVVERHSSTINFLGNVREALKGRSIPVLVFNTLQDEKKILDELNGVEGKILIWSKVMK
FT                   RENEFIPCVPVGAEDSLFYLYTSGSTGIPKGIVHTVGGYLVYAALTSKTCFDLRKEDVF
FT                   ACTADIGWITGHTYVIYGPLLNGVTTVVFGGTPFYPSYFRLFKMVEKHKITQLYTAPTV
FT                   IRTLRKYFSTNPLDHGCDLSSLRILGSVGEPINKNAYLWFKENFNKCSIVDTYWQTESG
FT                   GILIAPIPYVVDGKPECACLPFLGQEVVIAGKDSKEDHVIEAKPYELGRVLLRRSWPGI
FT                   ARGILGDLERFKRVYFFYKGFYFTGDEGYKDADGHVWIRGRADDVINVSGHRISTAEVE
FT                   SAACMDPYIAEAAAVAENDEITGQALCFFVVLKDKETPQDKVKASLKETLRNKVGKFVN
FT                   PKDVYFCEGIPKTATGKIMRRVLKNILAGDSLGDMSTCTNVDVIEGLKDLVSPKAN"
FT   gene            <41992..>43158
FT                   /locus_tag="Eint_050300"
FT   mRNA            <41992..>43158
FT                   /locus_tag="Eint_050300"
FT                   /product="phosphoglycerate kinase"
FT   CDS_pept        41992..43158
FT                   /codon_start=1
FT                   /gene_family="HOG000227108" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050300"
FT                   /product="phosphoglycerate kinase"
FT                   /note="similar to ECU05_0320"
FT                   /db_xref="GOA:E0S751"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="UniProtKB/TrEMBL:E0S751"
FT                   /protein_id="ADM11479.1"
FT                   /translation="MKTINDVDIEGKSVFLRADLNVPLSNSTVLNNFKIVSVLPTIRLL
FT                   YSKNPKRVIIGSHFGRPRGKYSRDLSLQPVYRALKELLSKELGIDLIFCDLWDVGSIED
FT                   AWVLVENLRFYYGEEESDDQNTVRCYRNVFVNNMDIAVIDAFGCLHRKCGSIQRTGLPS
FT                   YSGLLVQKELVSAREIMRENIDLMILGGKKASDKIKLLKSLGERTRSLFITGGLAFPFI
FT                   KYIFGREVGKSICSDVSEEEVKSIYEICRKYGTNIVLPIDFVVLSGGKICITNGIPSEG
FT                   NAMDIGPGTVELLRKEVSKARVVFWNGPPGVFEEKDFSEGTKALVSILESLKKEEKKSF
FT                   CGGGETVGAIKLFGNYDNFTYVSTGGGALMKLLSGENLPGLDFLSNQP"
FT   gene            complement(<43181..>44371)
FT                   /locus_tag="Eint_050310"
FT   mRNA            complement(<43181..>44371)
FT                   /locus_tag="Eint_050310"
FT                   /product="putative DNA polymerase alpha/epsilon subunit B"
FT   CDS_pept        complement(43181..44371)
FT                   /codon_start=1
FT                   /gene_family="HOG000150203" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050310"
FT                   /product="putative DNA polymerase alpha/epsilon subunit B"
FT                   /note="similar to ECU05_0330"
FT                   /db_xref="GOA:E0S752"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniProtKB/TrEMBL:E0S752"
FT                   /protein_id="ADM11480.1"
FT                   /translation="MRESIYKEFTCKKGIMLSSETLEYLEHNIKNDSMLENISIEYKRR
FT                   SGPKLADLGLIREIIESLDTRKDVYNVLSQNFKEKNDLLKYRHLLQKIERVVTPIYLLD
FT                   EDHATIFGCYYKDRNGREVLEDDGDIIPIDTSECHEDVFLCDNIFVAMEGRKTGDRFVM
FT                   SRVHLPSIEKTSKKAKEERRDLKVLFFSDFHMNEANGTTLRKILNKIPTGVVVLMGKLC
FT                   SGKSSGISYTSFMNGLRPNNALGSIPDIILCPDADDVYPSFLPKEIEVPEEYSKIIKAA
FT                   SNPFKLETDNFSIGVIRDDLFRYKEKGTFIGKNYVDSFARVVLSQYSFNPFGISNLDID
FT                   TIPDVFVVGQDLYPFVVPVEGTLFISCPSFRDEMSFVSYDLSQNDAWIINSKNVLG"
FT   gene            complement(<44420..>45019)
FT                   /locus_tag="Eint_050320"
FT   mRNA            complement(<44420..>45019)
FT                   /locus_tag="Eint_050320"
FT                   /product="B-cell receptor-associated protein 31-like
FT                   protein"
FT   CDS_pept        complement(44420..45019)
FT                   /codon_start=1
FT                   /gene_family="HOG000150198" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050320"
FT                   /product="B-cell receptor-associated protein 31-like
FT                   protein"
FT                   /note="similar to ECU05_0340"
FT                   /db_xref="GOA:E0S753"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="UniProtKB/TrEMBL:E0S753"
FT                   /protein_id="ADM11481.1"
FT                   /translation="MGITTQLVQSILFGEMCMFTFMLLPISKNLKKRMIRLFPTSKLYR
FT                   GFLHIIYVLFAMILIMFVDSAYKIYTGEDHINPFVLYQAERNMYLTGFTLFLGIIFRMF
FT                   TRTMCLLFKEEESAHLLRKQSMNQKKYVEKILEENTKKSEKIEELEAEIGDLKKKILSG
FT                   DILIKQLKNNQNEYFSLLDKYNGLREQMQMESKKSK"
FT   gene            complement(<45090..>46292)
FT                   /locus_tag="Eint_050330"
FT   mRNA            complement(<45090..>46292)
FT                   /locus_tag="Eint_050330"
FT                   /product="RSC chromatin remodeling complex subunit RSC8"
FT   CDS_pept        complement(45090..46292)
FT                   /codon_start=1
FT                   /gene_family="HOG000149455" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050330"
FT                   /product="RSC chromatin remodeling complex subunit RSC8"
FT                   /note="similar to ECU05_0350"
FT                   /db_xref="GOA:E0S754"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniProtKB/TrEMBL:E0S754"
FT                   /protein_id="ADM11482.1"
FT                   /translation="MENIFPLQESVEIEEIYGRKRPNANPPKTSKAFGMKSGVLDFVDT
FT                   ETYQMKHPDWFRKGEVSQLELPSMDEVIRAVGKEKYVESRDRIIDSYENGCRPMTVGKA
FT                   LTLVDIDLYWMLKIFSFSERWGLINCRSMIVKEIKNLESFKIEDGISVQETSKEGDTEE
FT                   IVDIKRHLEGSMCNCGEKASFFTRSLVFRCSECIDNGVYPATILRSDFLPITESLVKNM
FT                   WSKKEEFLLLEGINKFGDEWNLVSQHVETKTKEQCIFHFLRLPILENTFSKADLSVGRL
FT                   FETAENPIMCIIAFICGIVHPKVASECARIAIKDIGQCSQDVVVQRILDAGKEKAREQK
FT                   DLETKKIERLRNVICEALLNKIKMKIGAYKDLYLSTQRVRNELIALRRGLIEDMNLTGD
FT                   E"
FT   gene            complement(<46369..>47529)
FT                   /locus_tag="Eint_050340"
FT   mRNA            complement(<46369..>47529)
FT                   /locus_tag="Eint_050340"
FT                   /product="peptide chain release factor subunit 1"
FT   CDS_pept        complement(46369..47529)
FT                   /codon_start=1
FT                   /gene_family="HOG000224681" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050340"
FT                   /product="peptide chain release factor subunit 1"
FT                   /note="similar to ECU05_0360"
FT                   /db_xref="GOA:E0S755"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniProtKB/TrEMBL:E0S755"
FT                   /protein_id="ADM11483.1"
FT                   /translation="MLDEVEMWRMKKLLKNLRDSRGNGTSMISIIIPPRDQISRVSKML
FT                   TDEYGTASNIKSRVNRLSVLGAITSAQSKLKQYNKTPPNGLGIFVGTVLMDQNKEKKVS
FT                   VGIEPIKPVNTSLYMCDSKFHVDDLLALFEDEAKYGFIVMDGHSTVFATLQGNVKTILQ
FT                   QIHVDLPKKHGRGGQSSVRFARLRVEKRNAYVKKVAEIAGNLFLTNCIMNVEGLVLAGQ
FT                   SDLKHELSQALDNRIKVIKTVDTNYGGEGGLNQAIELCEDILKDVKLSKEKKVLQKFFD
FT                   EINTESGKFCFTMKETMQCLEMGAVETLIVYENLTNVKDEELFVDWIAENYKSFGCTLM
FT                   FVSDKSAEGTQFAEGFGGIGGILRYRIDMEDHMDDDYSSVDDSEIF"
FT   gene            complement(<47593..>48336)
FT                   /locus_tag="Eint_050350"
FT   mRNA            complement(<47593..>48336)
FT                   /locus_tag="Eint_050350"
FT                   /product="putative histone-binding protein N1/N2"
FT   CDS_pept        complement(47593..48336)
FT                   /codon_start=1
FT                   /gene_family="HOG000149454" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050350"
FT                   /product="putative histone-binding protein N1/N2"
FT                   /note="similar to ECU05_0370"
FT                   /db_xref="GOA:E0S756"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S756"
FT                   /protein_id="ADM11484.1"
FT                   /translation="MEDLAEAFPLLSEARASIAQGEFEHGIGIYSEILEGVNPDDEKVP
FT                   YLYIEYADALIKSSDMFFIEEISKISGRKGLNLEERKGAEDDLEIAWNLLEICKNAFNI
FT                   LKDYSMLARTRFLQGEICLLNNEFRDALHELVECVAVMDKIYEKDCFKYADVYLSLANC
FT                   YEFLQDFERSKEYYDKTIGIYRAEQEQKESEEEKNEISDVITGLLQKATELKYKKEKLE
FT                   NVDLPDEPESDDVFIDINACKRNKK"
FT   gene            complement(<48362..>48940)
FT                   /locus_tag="Eint_050360"
FT   mRNA            complement(<48362..>48940)
FT                   /locus_tag="Eint_050360"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(48362..48940)
FT                   /codon_start=1
FT                   /gene_family="HOG000150197" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050360"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0380"
FT                   /db_xref="UniProtKB/TrEMBL:E0S757"
FT                   /protein_id="ADM11485.1"
FT                   /translation="MARKITASSFLMNNNEALVGEFVRMLIENHRKSVPTRKQSVRAQL
FT                   KVGIKEVIVLIEASKEYLRKLGLELVGISKVEIVDPMDAEKYFIRRLEPSNDVDPHPTE
FT                   EFRRLILVLTFVVLEQKSVEISRLWFLLQKTEVFESEDDFSEFLRWAKGQGYLFAVRDE
FT                   ERLVITLGWRYYCDFHRFDPKEYFRNNSY"
FT   gene            <48956..>50875
FT                   /locus_tag="Eint_050370"
FT   mRNA            <48956..>50875
FT                   /locus_tag="Eint_050370"
FT                   /product="putative cleavage and polyadenylation specificity
FT                   factor"
FT   CDS_pept        48956..50875
FT                   /codon_start=1
FT                   /gene_family="HOG000149453" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050370"
FT                   /product="putative cleavage and polyadenylation specificity
FT                   factor"
FT                   /note="similar to ECU05_0390"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniProtKB/TrEMBL:E0S758"
FT                   /protein_id="ADM11486.1"
FT                   /translation="MPSSFVSLTPLIRTETGIYCHLLEVDNVKILINCGASYTMDMSIY
FT                   APILPQILSCDAILLTSFGINCIGGLPYILQNNYYNKVFSSVPVKVLGKICLDEHLRGM
FT                   GLEAEVDIGCFERISEIKYSQPTMVNDVEICAYNSGNSIGGCLYKISKGAEKIVVGFNA
FT                   NHRKENHLDGMGFAGVGDCSLCVFNGNHVLAENISIAKRDNMFREAIGSALDLGRKVIL
FT                   PVKYSRFLEVALILNSFMGQRSEKIACLSYFGQRFVERAKSMIEWAGEKVSSMFSEEKI
FT                   NPFEFEKIEFIGHYRDVSEFDVIIVIDEYVHGGILTTVLHKFNDENNVVFLTDPRMEAI
FT                   IKKESLGMKWYDFRLVERVNEKKRGNGDIEASVIIDDAPDANGAETHWSETRYEVWCEG
FT                   GDEVFPAVSRRRAYDDYGEYMDRSLFVSEILSAEEISEEKMEKEVVVEEREVAGEGIVL
FT                   KYRVEKMDLMGISDLNSCKMIIETISPKKLVCIGEDEDTECFFYHTFKYMPCFEDVYMC
FT                   RSKIILSSDVSMGMVKLDEGFDSLNYQMIGNDTVGSFRGVRDGDVVRCIGNGPGVMIGH
FT                   VDINELRRMIIERNMRVEQEENGLLVEDCVWIRINADGLTIDGKDSGVFYAVRDVVYMN
FT                   SAFI"
FT   gene            <50933..>52597
FT                   /locus_tag="Eint_050380"
FT   mRNA            <50933..>52597
FT                   /locus_tag="Eint_050380"
FT                   /product="actin-like protein"
FT   CDS_pept        50933..52597
FT                   /codon_start=1
FT                   /gene_family="HOG000149452" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050380"
FT                   /product="actin-like protein"
FT                   /note="similar to ECU05_0400"
FT                   /db_xref="GOA:E0S759"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:E0S759"
FT                   /protein_id="ADM11487.1"
FT                   /translation="MYLELQNLSSKNRYERYRKSDTIVIDNGTYECKAGYSGDGPQMVF
FT                   KNILYRHKTVSSIESFQGASPKTMFDGDVVTNFEVLENVIDEILEYLKPEKLKNLIFTE
FT                   KIFNPTHEDLVKFLFDVYGFEKIQIGVDSYYSYLWNMSGEDCMVVDMAHSATTCLVICG
FT                   GRIMDVYKINFGGKAAGDYLSALMFNKFFNGKKNYKGLIPYLRCSLDYRRETVQILEEM
FT                   KVGNYSRNYFLDEELEMVKEKPVDKKQKMCAAPMVSTSMPEIDMCLLNTADVDLDPEEI
FT                   KEKKKQKILYHSTLHRLKTRVEKCLEKLSSHILYMEDEREKLEDLEGFISKKKTELQAL
FT                   KRELEIRSRLRRDVKNRKTYEFQVRFKEGELTADEKTLVEKIRDAEDLDKENKILESLK
FT                   SLIHQIKELDPYFEPYTADTVDLLSGHFIGRMNANVDLLKIPEIVFSPSIIGLDQMGLT
FT                   EIMEDVSKKYRVKKVLLTGGFSQIKDIDVRIRNEMTSMSFVGEIEVIKAKDPIGDSFRG
FT                   ARICEAFPTYTLEEYNRSGIVGVCRIPGEKSTLNPKS"
FT   gene            complement(<52616..>53182)
FT                   /locus_tag="Eint_050390"
FT   mRNA            complement(<52616..>53182)
FT                   /locus_tag="Eint_050390"
FT                   /product="vacuolar ATP synthase subunit E"
FT   CDS_pept        complement(52616..53182)
FT                   /codon_start=1
FT                   /gene_family="HOG000202442" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050390"
FT                   /product="vacuolar ATP synthase subunit E"
FT                   /note="similar to ECU05_0405"
FT                   /db_xref="GOA:E0S760"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniProtKB/TrEMBL:E0S760"
FT                   /protein_id="ADM11488.1"
FT                   /translation="MDRVPSKDIERMMTFINHEADEKIREMKIKATQEYNAEKARIIKE
FT                   ETTRIENEFLLKQKEIEKKKVMAENSLINMYNQKYLEEKVKILDEIYGETLKICSSRPL
FT                   NPSLIAECARKIDGEFIVYCNKKDRKVVEKECKNSEIREMVPEGVGGVLLCSKDYTTIV
FT                   DNSFASRLQTIRDEFEAEVNKIIFR"
FT   gene            complement(<53318..>54406)
FT                   /locus_tag="Eint_050400"
FT   mRNA            complement(<53318..>54406)
FT                   /locus_tag="Eint_050400"
FT                   /product="GTP1/Obg developmentally regulated GTP-binding
FT                   protein"
FT   CDS_pept        complement(53318..54406)
FT                   /codon_start=1
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050400"
FT                   /product="GTP1/Obg developmentally regulated GTP-binding
FT                   protein"
FT                   /note="similar to ECU05_0410i"
FT                   /db_xref="GOA:E0S761"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:E0S761"
FT                   /protein_id="ADM11489.1"
FT                   /translation="MNVLDKIREIEAEMARTQKNKATSNHLGILKAKLAKLRRELISAP
FT                   KSGSSGEGGFDVGKTGIARVGFVGFPSVGKSTLMSRLTGTFSAVAAYEFTTLTTVPGVL
FT                   SYNGAKIQILDLPGIIEGAKDGKGRGKQVLAVARTCSLIIVCLDVLKPVSHKAVIEREL
FT                   EGVGIRLNRQPPKIKITKKEKGGVSLIGDSLDAATVKAVLGEFRMSNAEVITNGPCTID
FT                   DLIDVIEGNRKYVPCIYVLNKIDSISVEELDLLYKIPHSVPVCANLGWNFDSLLSKMWD
FT                   YLDLVRIYPKPKGEPIDYEEPVILKSSKRSVADFCNAIHRGILAKFKHALVWGTSVKHN
FT                   PQKVGKEHILNDSDVVQIVKGV"
FT   gene            <54468..>55682
FT                   /locus_tag="Eint_050410"
FT   mRNA            <54468..>55682
FT                   /locus_tag="Eint_050410"
FT                   /product="hypothetical protein"
FT   CDS_pept        54468..55682
FT                   /codon_start=1
FT                   /gene_family="HOG000150196" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050410"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0420"
FT                   /db_xref="UniProtKB/TrEMBL:E0S762"
FT                   /protein_id="ADM11490.1"
FT                   /translation="MKIVAEYDIRLSKETEPIAFYKLPCTERNLRIQTVRWKRQFKYLE
FT                   MDMKLPKPGRRMRRTEERKTNIITYESYGFTPSSIQWYGKIDHLKKTIILRQIECIHLF
FT                   NPKFGSSEIEKDRQEADGYQFKRAETREEKEHRRKNINFYIKKMNLEEFVTMEYSRKEM
FT                   SQECSNSHDLSAVEDDVKPGMKIRSSIINAKVVNFSELALLYKDQNAIKAALSRYTNFI
FT                   NGRYILSNMFYEKSLHCIRDGILELFKGRERVLCKDVYLLAGEEKFLVEELCRRDGKYF
FT                   LLRGFSEDTNKCDDGSIGQEIRFIVEKHKPCSIEVIQEEMLLDPDAIKRNLPGDVAVLA
FT                   NGMLAVCKGDDKRKRIIEMLVEKKSWKKSEVLRIAQNESGGIEDFFSVFGEYCELRGNV
FT                   WSIKE"
FT   gene            <55753..>57048
FT                   /locus_tag="Eint_050420"
FT   mRNA            <55753..>57048
FT                   /locus_tag="Eint_050420"
FT                   /product="hypothetical protein"
FT   CDS_pept        55753..57048
FT                   /codon_start=1
FT                   /gene_family="HOG000150195" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050420"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0430"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="UniProtKB/TrEMBL:E0S763"
FT                   /protein_id="ADM11491.1"
FT                   /translation="MEFCRINELNKRIQELYHAMLAVVPLEGIGEHPFDYFKGEVGRII
FT                   DSVDVVLKEMVNKKLELQKEIDGMVKEMMRDCTDIEVSVPSIPNLCNLYVLKEYVRNEA
FT                   EGIMILKKAVEGRMAAIIEEMELEASNVGMKKIDWMDMECAGDKKGVSLMNLRELEMHR
FT                   DVLRNKRESMERNRDRLYRELCVFLSQLSRSDPEVTIDQKIFILERLHRRYKEEVEKRD
FT                   KEFRGLEMEIRRREGYLGIACKDIEMDLSEANLEMMRDYERYLLEEQERQLDEIYEKKK
FT                   GLLKELLEVFGEDMEDYKRTEKDIEEMSKMIEKLESKKDLFLSISSLMEKRSELISKMN
FT                   EFEKIASDPKRLFRSSLQLLSEEKFRNSAYPNLIRIEETMFKLLDEYENRFGKLFKDGV
FT                   DFKGSLREEIENRIVNKTVFINRLDSPSRKRR"
FT   gene            complement(<57106..>57852)
FT                   /locus_tag="Eint_050430"
FT   mRNA            complement(<57106..>57852)
FT                   /locus_tag="Eint_050430"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(57106..57852)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050430"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S764"
FT                   /protein_id="ADM11492.1"
FT                   /translation="MRLIPLYAIMRNIDIFYFGKINHGMYEIGQMDRQVAGVAFQNCRL
FT                   GNIVSGEDKPVTGEMYFSAVNTVFEILIDNEEYLKTTIRDLASGKRNAAQSQDEAKRLA
FT                   EIESRIFQTMKEILRFSKSLLFESPRGLSEVIGWNLNDVLESQEDFMELISKEVGRCIL
FT                   GGDNIPGFMALHKTDKYNEIVSLVGTIPIRQSLLNLKITAPVYTQWGIQGPSCSIITYV
FT                   LLVVFCTRLKVEPYVLRQYSSIYSTI"
FT   gene            <58002..>59375
FT                   /locus_tag="Eint_050440"
FT   mRNA            <58002..>59375
FT                   /locus_tag="Eint_050440"
FT                   /product="Ser/Thr protein phosphatase PP1-1 gamma catalytic
FT                   subunit"
FT   CDS_pept        58002..59375
FT                   /codon_start=1
FT                   /gene_family="HOG000149451" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050440"
FT                   /product="Ser/Thr protein phosphatase PP1-1 gamma catalytic
FT                   subunit"
FT                   /note="similar to ECU05_0440"
FT                   /db_xref="GOA:E0S765"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011236"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S765"
FT                   /protein_id="ADM11493.1"
FT                   /translation="MDIRQIELRRQQANILFKEQRIGEALDIYQKSLAEAMKCVVPGTR
FT                   NYPLEEQLSLLTYNICIVYYRQKNFPKSLVFGLESLKYLENDKTRNKICAVYLRLGMIR
FT                   EYKEVYERIMDKSSSPEISSLLSRMKLDKQTVEKYLERCITLKRLQELSKEISEGKVIP
FT                   TDILESILEQGESVFLGCENVVYVESDKEVLVFGDTHGQYFDIVGILNKVFDGDRVFIF
FT                   NGDYVDRGAHSVENFVLLLSLKILFPKRFYLTRGNHELLDINKVYGFYDEVRRKYPFSS
FT                   SSIYQKFQNVFKALPISVIVNEKVFITHGGLPGVPTRVEDLQKAYRMTDSHADELLKGF
FT                   LWSDPEEIEGIEESKRRAGVVFGADVTERFLEMNRLDLLIRSHQAVENGYKAHHGGRLV
FT                   TVFSAPYYEGSEELGSYLILNPSEREGDQTISVSGFTRYRVERFGRSSHKEVLKLLCD"
FT   gene            <59517..>60167
FT                   /locus_tag="Eint_050450"
FT   mRNA            <59517..>60167
FT                   /locus_tag="Eint_050450"
FT                   /product="CCAAT box binding factor subunit C"
FT   CDS_pept        59517..60167
FT                   /codon_start=1
FT                   /gene_family="HOG000149450" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050450"
FT                   /product="CCAAT box binding factor subunit C"
FT                   /note="similar to ECU05_0450"
FT                   /db_xref="GOA:E0S766"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S766"
FT                   /protein_id="ADM11494.1"
FT                   /translation="MIGRMRNEYDLLDERISRFWHQAFKGAVEERILLKDLNLPLARIK
FT                   RLMKIEEGVRMVASEVPVLFSMITEKFIEELTLRAWINTEENKRRILQKSDLTAAVKTS
FT                   EMFDFLVYIVPRNDLLHPFNHLVPNKVHHGGEDFSARGDAYVKQHVLGERQMMEDMAEK
FT                   MGNPHQGFYPQEHRVGDEVAKSMANSHADDYRRGFDIPFGRDMSADIAPSSFR"
FT   gene            complement(<60223..>61425)
FT                   /locus_tag="Eint_050460"
FT   mRNA            complement(<60223..>61425)
FT                   /locus_tag="Eint_050460"
FT                   /product="inorganic pyrophosphatase/exopolyphosphatase-like
FT                   protein"
FT   CDS_pept        complement(60223..61425)
FT                   /codon_start=1
FT                   /gene_family="HOG000150194" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050460"
FT                   /product="inorganic pyrophosphatase/exopolyphosphatase-like
FT                   protein"
FT                   /note="similar to ECU05_0460"
FT                   /db_xref="GOA:E0S767"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="UniProtKB/TrEMBL:E0S767"
FT                   /protein_id="ADM11495.1"
FT                   /translation="MTLLEERLKSFFATNKERILHGELRIAMGNEACDLDSFISSLVVA
FT                   YAEDAIHVVNMRKEVFMAKGEIMCVCREFGIDVDDLIFLVKPTLHFSPKARKVGAYFDL
FT                   EGKQYPISGKKIKLLLTDHNKPAEVFDDSEVELVIDHHMLSGHVPPAKRMYIDLDVGSA
FT                   TTLVSKYLGEDLTKKNHCAELVNKRRKGEEKEALCSAFAKLLLIPILMDTGFLKRRTSI
FT                   FDIAEYKKLKRMAGVKKKELKKTIRALRLARRNDSEHGTDLILQKDFKAFHHKKFFFGG
FT                   STVKYPFEDWADREGKNIRGLPEGKTGMALQLQIESFRKAMGLDFFFVATKIKGVRNII
FT                   FSSFPFLKDIVGRNKMKSIEYKGLEYYSASKKLTRKILVPEIIKIIDKHIGDSKKDKSS
FT                   Q"
FT   gene            <61897..>62460
FT                   /locus_tag="Eint_050470"
FT   mRNA            <61897..>62460
FT                   /locus_tag="Eint_050470"
FT                   /product="hypothetical protein"
FT   CDS_pept        61897..62460
FT                   /codon_start=1
FT                   /gene_family="HOG000150193" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050470"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0470"
FT                   /db_xref="GOA:E0S768"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniProtKB/TrEMBL:E0S768"
FT                   /protein_id="ADM11496.1"
FT                   /translation="MGAVTKKSKEKKHAELEKVGKYAEEYPLVAVIENPSISNVILKKI
FT                   REDFSGVSRILFVRKKMARAVYNMPSMPKDSFFLMFGDTEAIERAKTYQYEDFLEKGDV
FT                   CPARVVIEKQVIRNKEMIEILPVSMKDEQMQLKEDYVACEAGEEVDEVKAKILRFFGKR
FT                   LKKKNLVVFDVTPSSSLLKKTTND"
FT   gene            complement(<62466..>64673)
FT                   /locus_tag="Eint_050480"
FT   mRNA            complement(<62466..>64673)
FT                   /locus_tag="Eint_050480"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(62466..64673)
FT                   /codon_start=1
FT                   /gene_family="HOG000150192" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050480"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0480"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniProtKB/TrEMBL:E0S769"
FT                   /protein_id="ADM11497.1"
FT                   /translation="MRLEDLFVRLKDDPSAMPEIEREIQRCVSSEDLAPAKELMASAIP
FT                   EVKFYALKVIEQRVRSKKMAGISLEEEMGFMAGLVQSNESDKAAQVFALLGIYEWPSTF
FT                   PQFFSIIIDLLSHKKEMGYKILENFLYLCNYSQEINEERKDELKRGCGVMSNAYMPLFD
FT                   DSMAEHIIPILTESLKMMPRTFDCSIILRRGAGFPEKTIEFLNDGMEMLDIESVIDLAS
FT                   RMDISYGMIICFNNLKDKAPRVSNVKKMYEYVFKGLRKDLITFSASVEFWTKLFGRDGS
FT                   EEIVGDVLAEVVSIYISIDERQRTEIEGEVFGLFNAICRNYPRSVISFIGVNGDCIGRK
FT                   LALYFLKKLFGASHSSNVPQDLTFSDPVLCCSLAIYRKDFSAVDYIQYFDLSEKEPCKL
FT                   VIRILELFPLSAPQLEHILSRCNVSDKTYTNEVIVECFIRLGREEKFTGNWSYDELMRF
FT                   FFYLKRSPEKFRGLSSSYYRTFLEKGPFDRCFAILRMLGDVPEEILQRIYSDLDTYSLI
FT                   DTSCFNRDLLGYLENQGPFIQKEIGRLVNEWGVSEDPGDLIVCVKSLVHVIAHASGPSR
FT                   EHKLCPYINELVEILQIDDPTVVKKVSETFNIHTGPFDTYRAVYLFMVSYNSGALENAH
FT                   SSIVSSLTLCIKQEDGPKAFSETLGIDQSTCINLKEDVLKSQTRRAQSLVRAFLQGYKG
FT                   KPLNSLYASDFKVKGQNLLGKIPKKEVELEIERSFFGDGMQ"
FT   gene            <64894..>65253
FT                   /locus_tag="Eint_050490"
FT   mRNA            <64894..>65253
FT                   /locus_tag="Eint_050490"
FT                   /product="hypothetical protein"
FT   CDS_pept        64894..65253
FT                   /codon_start=1
FT                   /gene_family="HOG000150191" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050490"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0490"
FT                   /db_xref="UniProtKB/TrEMBL:E0S770"
FT                   /protein_id="ADM11498.1"
FT                   /translation="MNNDVLYEVIKYLDFPVRDRKVQEAQFSRINSRRMMRFNRNLVEK
FT                   KLSDRPHINDLKTSNIYKESGVNFAKIHRVLSDVFGRRGSPPFQNISSTLAGLVKVMDF
FT                   KLKKIMLASRIGGKR"
FT   gene            complement(<65302..>65577)
FT                   /locus_tag="Eint_050500"
FT   mRNA            complement(<65302..>65577)
FT                   /locus_tag="Eint_050500"
FT                   /product="putative synaptobrevin-like protein"
FT   CDS_pept        complement(65302..65577)
FT                   /codon_start=1
FT                   /gene_family="HOG000149448" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050500"
FT                   /product="putative synaptobrevin-like protein"
FT                   /note="similar to ECU05_0495"
FT                   /db_xref="GOA:E0S771"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="UniProtKB/TrEMBL:E0S771"
FT                   /protein_id="ADM11499.1"
FT                   /translation="MGDEVTQKIEKEVEDLQGALKEQLKAQRDLGDLETNLRSETFTLE
FT                   KTTEEHKAAAEEAKKKLFWKNFKYFLIAAVVVMLILFGLFGNIFTK"
FT   gene            complement(<65703..>66890)
FT                   /locus_tag="Eint_050510"
FT   mRNA            complement(<65703..>66890)
FT                   /locus_tag="Eint_050510"
FT                   /product="transcription initiation factor TFIIIB subunit
FT                   Brf1"
FT   CDS_pept        complement(65703..66890)
FT                   /codon_start=1
FT                   /gene_family="HOG000149447" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050510"
FT                   /product="transcription initiation factor TFIIIB subunit
FT                   Brf1"
FT                   /note="similar to ECU05_0500"
FT                   /db_xref="GOA:E0S772"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniProtKB/TrEMBL:E0S772"
FT                   /protein_id="ADM11500.1"
FT                   /translation="MGICSNCSSGDFAEDTAQGAVYCTVCGMVQEENAIVASLNFNTEG
FT                   PKATLNGQIVGMDSRNVGTGFVDSSYYIKNTISGICASLGLGVDHVECSFRWYKLLLQY
FT                   NLSKGKSILYTLSACIYIVCRQERTPHMLMDFSNALHIDVFKIGKSFLKITNMLGIDIP
FT                   LIDPSLYMPRFVSRLRFESTEVLGLSLRLISRMKRDWIVVGRRPNNLCGAALLIASRIV
FT                   GEERSIYEIAKIVHVSVSTINKRLKEIGDTESANLSIEEFNATWIEKEEDPPAVKMKRM
FT                   EMAKKQECESGSSEVIPYSTPQSSVDSEILSDSEEIERNILSPEETKRREIVWEEMYGE
FT                   FMREREKRTKSSVKKGKRRRKNEEFGSIVEAFRSLDKRISGKLNYQAIESIFDKL"
FT   gene            complement(<66974..>67666)
FT                   /locus_tag="Eint_050520"
FT   mRNA            complement(<66974..>67666)
FT                   /locus_tag="Eint_050520"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(66974..67666)
FT                   /codon_start=1
FT                   /gene_family="HOG000150190" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0510"
FT                   /db_xref="InterPro:IPR006565"
FT                   /db_xref="UniProtKB/TrEMBL:E0S773"
FT                   /protein_id="ADM11501.1"
FT                   /translation="MKSNMSTKILKLAVVEVLSQSGFDKTADQALNVLTDILRYYIEQL
FT                   GCRIKKRHGREIVPELVCRILVEEVYEEYEYQIPELLSFLRYQVTMKNYLNDRYSMGSE
FT                   ESILHILRVLPKNAQLRMVMRNGSNLSDMNEVEKEVVEDDVMFDEFTKEFVKSSLEKES
FT                   KKGEVEYKLESVDLVGGEARKGIRIGDGELNEILEKKHREVEFLKEPRALVKDFCVWSN
FT                   LYVFKEYE"
FT   gene            complement(<67781..>68503)
FT                   /locus_tag="Eint_050530"
FT   mRNA            complement(<67781..>68503)
FT                   /locus_tag="Eint_050530"
FT                   /product="TATA-binding protein-associated factor"
FT   CDS_pept        complement(67781..68503)
FT                   /codon_start=1
FT                   /gene_family="HOG000150189" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050530"
FT                   /product="TATA-binding protein-associated factor"
FT                   /note="similar to ECU05_0520"
FT                   /db_xref="GOA:E0S774"
FT                   /db_xref="InterPro:IPR006751"
FT                   /db_xref="UniProtKB/TrEMBL:E0S774"
FT                   /protein_id="ADM11502.1"
FT                   /translation="MEQQFILRLHESIKNEVDLKNSTLEVCNEKSVVLSYGGQKYPGII
FT                   VRLPCIVESQKTMDNRQHYKVADISTLVVVYPHGDFDFEREREIHELSGLCPPLKYAKA
FT                   RRFRKKNSKIEYVEEIEKKVGELLEKDMRARLVEVITKEEKETSDDLDMLAAEIEKKLV
FT                   DYSEARSEESKIPFAETKHEKEEKPKNQELERLEKSVEEKRKQMESALNPILQKRFELQ
FT                   LEVLLKELEAMKKSLGEE"
FT   gene            <68562..>68936
FT                   /locus_tag="Eint_050540"
FT   mRNA            <68562..>68936
FT                   /locus_tag="Eint_050540"
FT                   /product="hypothetical protein"
FT   CDS_pept        68562..68936
FT                   /codon_start=1
FT                   /gene_family="HOG000150187" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050540"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0530"
FT                   /db_xref="UniProtKB/TrEMBL:E0S775"
FT                   /protein_id="ADM11503.1"
FT                   /translation="MRSYMKDGLRIGFTKETSTDHIEALPLEIARKFELLSGICDNRSI
FT                   QEFPAAIIKEIVEMCNDLRDLAPHYNMPEEYVEYVRENKDVLGYFEESENNLKGEEMRI
FT                   INKRRIFDVFRSMMEKMEEM"
FT   gene            <69076..>79380
FT                   /locus_tag="Eint_050550"
FT   mRNA            <69076..>79380
FT                   /locus_tag="Eint_050550"
FT                   /product="PI3/PI4 protein kinase"
FT   CDS_pept        69076..79380
FT                   /codon_start=1
FT                   /gene_family="HOG000150186" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050550"
FT                   /product="PI3/PI4 protein kinase"
FT                   /note="similar to ECU05_0540"
FT                   /db_xref="GOA:E0S776"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="UniProtKB/TrEMBL:E0S776"
FT                   /protein_id="ADM11504.1"
FT                   /translation="MKDLFVGSEPSEVKANRLKKYMESGRFLETLFFPHEFLESLVLFA
FT                   IQILNSTEPEKKSSFVSGGNESRYIVLRLLNKFSLKRIRNTGLVHALHCVLRNDNLPNV
FT                   ILSLKALGSLSRSGVIAGDLVEVHVGVLLGMVHNLFTNLESGEEGLIEISLFTLTEMLT
FT                   HARVFFRGLEYHAVKIDQFLACVYGNIRRAFENRRFMDGMMHKRTSSISMCSGICSLLK
FT                   LTYEQLPIVSKSGPYHVFACEAAFVGMYYCPSDLLDLRKEIYMLFSKMCIGDKEMVLPM
FT                   MDKVYMVPFLFSPDAQPMSVKGIGMLSEMLVHVKENLSKAAYMEFGSKVFNVLFSTCSS
FT                   IRRLCKEVHEGGEERQKYRRNASDIISQDIESLIVCLGAVENTCKCFGGRTGDSEELSH
FT                   IYLKSFYDIRNGFEGIQGLVRLGCAGKEEELKKVVKKFVSGFREVIGRAGILEKSGNGI
FT                   VFSVPEINILYEIFERSFDVFLHECLCQEQDIEEFFSVLSLVREHIGSDIVKCLSERIV
FT                   EYSKKNGEFFGIWRLMSSSVILGNTFCGYVLPRMIEELDREGFEFVKRAMRYIVPFFGN
FT                   DIKKIKRVNTFFMHRIISTLLAAKRMENFEILLEIFNMFGSMPEKSSFFQKYIFDNFSR
FT                   IVSHLMNLYEVEGKSIFIEMIFSLPISINLLESDIQFLMRPIEEALMLHGPVRTKALSI
FT                   LVYVLDFSTPDKISGLEKTWQNILNNVAEGLKDSTMLSLCSRILGKLKSYHKTFVVDGK
FT                   MFEETNEDLKLIRIVVDGKHAVPGHLLFFDAVQKIRGAFELSEKSFGPSGVLTRFRSLG
FT                   PRCGDGEAKGAAFRLVEKVVCHLMGWNSSGKNLIQNYYESLLEEMEEIGSIPDTLDYIH
FT                   SVHGVISSLGGRKCSDSRHLAQYVYDAILTLFSCHGTPFEKKALELLHSIFGVVILHKI
FT                   STLHRPKGKRYTILLDTDTFLDALVESFCDTENSMPFKVLSVMFVQMYEMFGRKCEYFC
FT                   VEMYRAVFSKLKAMCKSSNKRCRDAGINGIICLAATMPIRELVMLRVPEDSFSCTYLYL
FT                   LPRGSEDFSLPLRLVVFILRFRYKGIRNYLLSSGMERHFMMSHFRPFVAGLFDGRKDVM
FT                   DFSQAVLREVFQSYGPRLLERHKDMVFGFFKKEYVIGSRETMIMHLKVFIFCVREGKCP
FT                   FDDCEMKYLIEKFLDGIASNEEWRGTGGVYMGFDHCERDESTNNEDFCKCNRCGKGEED
FT                   TEIVLGGIHKKLSSLSMRDLMEIALKNKMDVVCGDCKKKIYRHKEEWSPRFSNEGEELI
FT                   YWIREFYLLVIEYRKSFEEIRTAVLYLLRYVSDDSSDYLQKAHNIRPQETEEVISEEVE
FT                   KCLSEKVDYKILNMLLCAHSISGIRENPRVGMLVLKILKEFRIPKEFAIIAQNDRYSML
FT                   AKAYEIGIRLKNQEGLCNEILETYFVLDGYAKSYTSRMYPRMIKYVEDLGSQFVSCMFR
FT                   RIQDPSAYELCSQLCKDSAKLREMVFGMKDRLAERISQIYCRLEGNDSIEKDVFVYSYR
FT                   FLDLAGYEMKPVDIQVILGIYADVKTKPRHAVEMRGLINRCIDRFSPENLETLFNIDPW
FT                   FMSVDGIDPGYLTEGLSPLTLRGIIRSIDKRNRPMIENLSLSLGENRHMLIEMFVEMGI
FT                   RSEKLIGYCKENLHITNLRGLLLYYLCTFEPLHVYFELLFKLPYEDRKYTLYCLERIVD
FT                   VFDPLLFEEIILIVLRSEVRFKTSLCILFPLLLSRPSLISKKIVLELTGSIYKLLDSEN
FT                   FPQQRMGFKLFEVLYNRCLLGDGSGNICREYDWIIRNIYTLMFVRFIHMDQDLDGDLLE
FT                   KYNLELVFELVEYSPKELNLNNMFSFLEAEILSKKNEEYKIWFLKSIGMAIAPYFRSRA
FT                   LGIKVIEYLVRIGMWNYKLLREELGVVVYDPSLLYNLLCMLCSKAGERAGLGCKAHRDD
FT                   VENMEICLIVIRHLFAEYNRERGEANQKYVEEGLEKLFYVLSLYSEMKNIVCSVTRLFV
FT                   EAFKDNSSRIDPLVSKISFLMSDFRTSLADKIEMACLLSNRGHDNEFLSEMLLPAFNNY
FT                   LYSGVTFPSGLQKFFMKGVSSKNSILRNGYLDLMNRIVPVSKWMRLKYLLEMEWKHNAK
FT                   IGYTMTAMMILSCHTAELEAEKYSEIRPSKDIEYPWSREGMRCKGNVSRCSGLVANLLE
FT                   DVGLYRSKASKPDLLEILYHFDDSLLPVLSGVLRTTVCGLDSEKCKSIFEGFVKFCSEV
FT                   TGEGKLLGALVRGLGPIYRHADLYELIKVFRGGEGWYTLLEYADDRQKTEIYRRLMNLD
FT                   EYFGMSRSVCIFPETMQAYFLQQVGKTKEAQDLYEEIQARAGKHKISFDEREYKLWQDE
FT                   WVACAKELQQWDVCYDAGVEIGDGLLSGESLWHLSNFTSQKAVEKLKSVIGKGVGFERE
FT                   FLDVFADIFMKYSAERIKGILTKNIAELRSYPVGSGANLRNLMYLQIIIEMVEAEPIFN
FT                   DKIDSIEALTSISFRWKDKEPSIYSSFAEWSLFKTWRKHVYSRLGMGEKMCGREMGYKQ
FT                   PERGYTEEMGNSLGRKPIASHLFSPKEMNENYAKIKKELVARGTNELAKTLNMFSKAAI
FT                   DHGYYDVALFHLKEVFDLSSVKVGDAFQKVVYELLCFLGKKEYKIGAEQCMSANIQHFS
FT                   DTQNSVLFNIKGLFNEKLGKASDAEKFYLQSAQICNTVGENWLTWASFLFGRIDGDAPE
FT                   VKEDVFVALLQAITYCNGPNARKGILKMILLMGEHSSLCDVELFHKVLQEIDISRFIYF
FT                   IPQLIGLLEKEDSRLVQAILGKISEEYPQAVIGPLKAAKERIRRSLGLGKEDIECKVGE
FT                   HKVEGRSSEDSKSLGTGLVTGEKNMFLENVMCIYNRIKNAQPGKEFWKILHYLHNSLNS
FT                   FAFKEEELVYLEIEKIFNSAVSHVVHGAVPSGLGHAKILNELIFQVSVSSLSRKLKEEL
FT                   TSSILKMRCICPLENIDEMVRFKSKVQKIVEESFHRMDKSEESEVNLLLYRSDYKHRVF
FT                   GQYSEIRRSYKSLASIEMFEPRQPYMYRKRMGCNRIHLRGSDGKMYRYEMKELRKMRFS
FT                   EFVLPQISLMINEAMGEDTNLRRRGAELRLFVPFIASEVLALKWIKEPVYYMDSILEEG
FT                   LSRYKMNIDQCVLLYLDHFATIYDGLDSSPGHFENRYQLEKGLTASLKPRIQGDECPNI
FT                   RKKKGFLESKESQENLINNVRMVIERQREKYTSGLRQNEVECLGCNERGEGISPCTYRY
FT                   ETSKRQRYMAYEKVYNTFKKTSFVDDYFKLIYGNLGGYFRFKNKLLSSYSANSVFLYTF
FT                   SVVDRRPRNLAITKTTGCFMNRDVCCEEAEISSKGKGMGAIGPGYQKLFGKEGIEGTMV
FT                   SIMYHYAGMVNKGDWSKDLVKALLEGRFIDMTGKGLKGAHKEMLSRVSEMIGKGEDGTH
FT                   NVIPMVSEWMDMFKLAQIDPRHMCWM"
FT   gene            <79448..>80500
FT                   /locus_tag="Eint_050560"
FT   mRNA            <79448..>80500
FT                   /locus_tag="Eint_050560"
FT                   /product="hypothetical protein"
FT   CDS_pept        79448..80500
FT                   /codon_start=1
FT                   /gene_family="HOG000150185" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050560"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0550"
FT                   /db_xref="UniProtKB/TrEMBL:E0S777"
FT                   /protein_id="ADM11505.1"
FT                   /translation="MDTVLVKLVDRNHDGAEHNPLHVSTSFTTEDLERYLRSVLGGDGG
FT                   YRFYIAGRGFEGSLLKEISSRALEVEEGLTIEYELDRNYTPDVLIELEDLVSCLTVVKS
FT                   RQPEVWCGTHGGRLKIYAYQDGVINLMKTTDYSRVRGVSREDGLYIYNSAGEVVEFESG
FT                   DVLFKVDGDITCIASSSNVVSVGTHEGECYVFKEGLMKVHKFKAYISSTAMNKDEAMFV
FT                   CADGNIGVFGISTNTFKTKDLGYGVTSSDMGDGKYVFGTSCSGLVVENKEESTFVSTGI
FT                   RFSNRIAMYNGCIVAQASQYTISVVDIGDHRELRRITVDECISDIGWIENLLIAGVGSR
FT                   IHGYIIHNLE"
FT   gene            complement(<80524..>81063)
FT                   /locus_tag="Eint_050570"
FT   mRNA            complement(<80524..>81063)
FT                   /locus_tag="Eint_050570"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(80524..81063)
FT                   /codon_start=1
FT                   /gene_family="HOG000183747" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050570"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0560"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniProtKB/TrEMBL:E0S778"
FT                   /protein_id="ADM11506.1"
FT                   /translation="MGVKHAIKSKRVANILDRKKAKTRPVENLHDGGENPRNTEGFLLN
FT                   HRLRPPYNIILDTNFINDCVRKKYNIREQLMKTVNASIKICVPECVVGELEKLGRPFRV
FT                   ALALIRGDDVQRLECDHKGTYADDCIFNRVSAHRCYIVATSDTALRQRIKTIPGVPLIT
FT                   YRGQRCFIERFVPAAL"
FT   gene            complement(<81023..>81688)
FT                   /locus_tag="Eint_050580"
FT   mRNA            complement(<81023..>81688)
FT                   /locus_tag="Eint_050580"
FT                   /product="putative cysteine protease"
FT   CDS_pept        complement(81023..81688)
FT                   /codon_start=1
FT                   /gene_family="HOG000150184" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050580"
FT                   /product="putative cysteine protease"
FT                   /note="similar to ECU05_0570"
FT                   /db_xref="GOA:E0S779"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR019400"
FT                   /db_xref="UniProtKB/TrEMBL:E0S779"
FT                   /protein_id="ADM11507.1"
FT                   /translation="MESYTMFRECIRDGNCLYISYAVALADLLAAEKDVLLRTLIDAFD
FT                   KTNEALCLYNIDELGYKGFYDSFVEILVDIANGTKKIEDVPLYSLYDCVAYLRLIVSTE
FT                   IKSNPDKYQPYIPEMDVGKYCTRFVDPFYQQAGCVEICALSGSIPVRIHVVDITKDNED
FT                   VYGDHPHEISIFYTHGHFEPIYQDRCRAEEEGESDLDKKLSILETDGGEACNKKQESC"
FT   gene            <81923..>83080
FT                   /locus_tag="Eint_050590"
FT   mRNA            <81923..>83080
FT                   /locus_tag="Eint_050590"
FT                   /product="putative aminoacid transporter"
FT   CDS_pept        81923..83080
FT                   /codon_start=1
FT                   /gene_family="HOG000149446" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050590"
FT                   /product="putative aminoacid transporter"
FT                   /note="similar to ECU05_0580"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:E0S780"
FT                   /protein_id="ADM11508.1"
FT                   /translation="MKGNKLKKECISIFMNLAKTTLGSGILRYPFLFKTYGVWYTILLT
FT                   SVSALASLFGLWLYIDLNDFYGLDNSMSTIARYIYPPLQPIVNITVCLKCFLVCTAYLV
FT                   LLKNNLPGTVKSIFGLQSSYQTLCMLGVVLCVFPFVSMHKIDKLRYTSSFGLCAVIGLM
FT                   LLSVYRYATAEDVPVFEETKGGNYLGELGSFVFGFTCHQNIFSVQNEMKVNNKTALKMT
FT                   VFLMLVAASSVYITFGLTNYLVLGNGMKENFFENIPEGMKSIISMFYFLVVMMSIPLQT
FT                   HPCRKYFLDLFDTRYSTDGKYWHLRFVTSLFIILLSFIIAMNVSKMEKLCEIVGGTFSA
FT                   LMCFIFGSLYYFIAFWNRGFEVKKILAFFVLAYGVAAFVSLFLAP"
FT   gene            <83305..>83988
FT                   /locus_tag="Eint_050600"
FT   mRNA            <83305..>83988
FT                   /locus_tag="Eint_050600"
FT                   /product="hypothetical protein"
FT   CDS_pept        83305..83988
FT                   /codon_start=1
FT                   /gene_family="HOG000150183" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050600"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0590"
FT                   /db_xref="UniProtKB/TrEMBL:E0S781"
FT                   /protein_id="ADM11509.1"
FT                   /translation="MNGILSLVLFEWAMCLEKAFNPVLPSTDFYKPSTTSSDNGLLGPK
FT                   IEGSAGIHDPVAFGEGNFYKLLHPSMTRLTSYLNDHSSEFSEWYRSPSLIMGEDLKEKI
FT                   ISGLYKAQPKDDKELKEFWGLIMGELLIRDLPELKSDLSSLKEIQNEEDKKKSIAEFKG
FT                   INEKRINEENNFFGTALFILDCLSLGVTNRNAEIYPDVIGPFVDAAIAFKTLEHSFSNI
FT                   IGSSK"
FT   gene            84083..84165
FT                   /locus_tag="Eint_050610"
FT   tRNA            84083..84165
FT                   /locus_tag="Eint_050610"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Type: Leu, Anti Codon: TAA, Cove Score: 70.56"
FT   gene            complement(<84247..>84900)
FT                   /locus_tag="Eint_050620"
FT   mRNA            complement(<84247..>84900)
FT                   /locus_tag="Eint_050620"
FT                   /product="60S ribosomal protein L10A"
FT                   /note="L1 in yeast"
FT   CDS_pept        complement(84247..84900)
FT                   /codon_start=1
FT                   /gene_family="HOG000149445" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050620"
FT                   /product="60S ribosomal protein L10A"
FT                   /note="L1 in yeast; similar to ECU05_0600"
FT                   /db_xref="GOA:E0S782"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="UniProtKB/TrEMBL:E0S782"
FT                   /protein_id="ADM11510.1"
FT                   /translation="MSKQGEEQLAFLEAKRIISVINRLKENEDAEKTATIQIQVNLKGY
FT                   DARKDNKLSKDMAFPYKVRRLDKTIVIADEAHVQTCVDAEVPYVSIEEISGDNKKAKRD
FT                   EVLKRNKYFILCPGYNKVFQLKNILRCGKTPYILKNDDDIKTVFETAKRSYKLRIKDFA
FT                   VTSFPVGHTGMETDHIYENIKTGMGLLISYLKKGSQSLKGVMIKTNQTSPITLY"
FT   gene            complement(<85041..>85871)
FT                   /locus_tag="Eint_050630"
FT   mRNA            complement(<85041..>85871)
FT                   /locus_tag="Eint_050630"
FT                   /product="putative transcriptional activator"
FT   CDS_pept        complement(85041..85871)
FT                   /codon_start=1
FT                   /gene_family="HOG000155752" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050630"
FT                   /product="putative transcriptional activator"
FT                   /note="similar to ECU05_0610"
FT                   /db_xref="GOA:E0S783"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S783"
FT                   /protein_id="ADM11511.1"
FT                   /translation="MLKNRVEMNRRRLDFSEESSRDENDSNYLGFYELGRGGNRYRGEK
FT                   RKRNRDFSSLGYPWGSVYNKDIDPRDKKKCRTQYHGNDNSDGLNTPMSVESQWSVHSED
FT                   SEEFDEKLMSLRFLILEAEEEMRRIVRGRINRHLEMNREANEKKREIKRRKREVLEEVN
FT                   KVEPEAGRKSRDSESLSVSQEDSDTRKAGIESFADFETSMFPYKSKNGVKSYVCPYEGC
FT                   TMELPTLSRIKRHYIVHTRLRPFKCLNKDCNKRFSRKDNMLQHYKIHCSYSNYK"
FT   gene            <86040..>87107
FT                   /locus_tag="Eint_050640"
FT   mRNA            <86040..>87107
FT                   /locus_tag="Eint_050640"
FT                   /product="RAN specific GTPase-activating protein"
FT   CDS_pept        86040..87107
FT                   /codon_start=1
FT                   /gene_family="HOG000149444" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050640"
FT                   /product="RAN specific GTPase-activating protein"
FT                   /note="similar to ECU05_0620"
FT                   /db_xref="UniProtKB/TrEMBL:E0S784"
FT                   /protein_id="ADM11512.1"
FT                   /translation="MIFSIGDQKKKYETREDVSGVVQEIKKSLDELVEVDLSGNHFSEE
FT                   AMEEICHVLRDAKNLHVINLSSAFLGLDKEKLYSNLAMLSKMLANHKIQKIDLSDNAIS
FT                   SEFPPELGEFISSSTDLVHLKMNNCGLGKIGGGRLGEYLLKIADKTKLEVVDIAQNRFF
FT                   SFPKELSDALLGFKNIKELRIQYNTIEEETMLEFLRAFQSHSLEVLDIRDNFLSLEGSR
FT                   YLGSLYCEWNLRELRVGDCMMGNEGVKDFLERANKKFVPMALPGDYDGKRERIALDISY
FT                   NEFEQDAVEILKDFCSRNIIKELVVFGNYYDDISDIIDIVEKQGGVVITEEHTDLSSDS
FT                   GMEIDESVIEGIAEM"
FT   gene            <87284..>89362
FT                   /locus_tag="Eint_050650"
FT   mRNA            <87284..>89362
FT                   /locus_tag="Eint_050650"
FT                   /product="Ser/Thr protein kinase"
FT   CDS_pept        87284..89362
FT                   /codon_start=1
FT                   /gene_family="HOG000149443" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050650"
FT                   /product="Ser/Thr protein kinase"
FT                   /note="similar to ECU05_0630"
FT                   /db_xref="GOA:E0S785"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S785"
FT                   /protein_id="ADM11513.1"
FT                   /translation="MIKKDAEEILMDPLAGNIIDAEEIVARSEIRDEQARVLEEEKEDG
FT                   RKGSRYKRLQTVLGEGTFKKVYKAVDQEEGKEVAWNEIKINEKGQDSKERALFANEIAL
FT                   LKSISHPNILRILDYWFTADSFIFITELMSGGTLREYIAEIGDLNVKLIKKWGRNILEG
FT                   LVYLHSQDPPIIHRDIKCENIFVNAALGEVKIGDLGVAKERRMKRYTVVGTPQFMAREM
FT                   FEGEGYGEKIDVYAFGMCLIEMATGAYPYRECTTAAEVYKAIIQGVPPVVLNSIKDVCL
FT                   RNLIMNCLVSEKDRLRSVDCLKHHFFDSSSTCNGECIPAECMSGVPLTAPANDMEISFL
FT                   SFKDNVITFQLFFMSMARFIKFDYDLQSDTVEDVANEMLEEEVVSEDQRDTLLGLLSRG
FT                   IEKAKQRIEEMECKNTEEEMKKLSIDTEKEKSKAEGPKNDFNKITDRNLSIEEVESMLE
FT                   IDVKFCQDETSRLYTWSRTVRNGDSKVGVEIGSSPDHSPELLPSEGIMEEQKKTGGGKC
FT                   FDELECPNRKYDEDVSIEEFAADVSVATKRSSETVTNWIKAFKSNDIDSVFELKILVDE
FT                   DWDKLGLTVFSSRAMKNMLYGVGKIPLKEKQLPTNTSIKDYGGGVEIKEFLHEIGAIVG
FT                   KDKCVSIWESKLLAQDIRTVEELRSLHQDDWDRLGLSVYSCRVIKNVIYKKGRVVLC"
FT   gene            <89498..>89722
FT                   /locus_tag="Eint_050660"
FT   mRNA            <89498..>89722
FT                   /locus_tag="Eint_050660"
FT                   /product="hypothetical protein"
FT   CDS_pept        89498..89722
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050660"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0640"
FT                   /db_xref="UniProtKB/TrEMBL:E0S786"
FT                   /protein_id="ADM11514.1"
FT                   /translation="MRRMSKSYDVIQIPGSIKHSDLPERMEIGKPFEINGDLYICEKRG
FT                   EGMMKVCSESEGRTSTPVLSRGFYVVRRM"
FT   gene            <89787..>91310
FT                   /locus_tag="Eint_050670"
FT   mRNA            <89787..>91310
FT                   /locus_tag="Eint_050670"
FT                   /product="glucose 6-phosphate isomerase"
FT   CDS_pept        89787..91310
FT                   /codon_start=1
FT                   /gene_family="HOG000261371" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050670"
FT                   /product="glucose 6-phosphate isomerase"
FT                   /note="similar to ECU05_0650"
FT                   /db_xref="GOA:E0S787"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="UniProtKB/TrEMBL:E0S787"
FT                   /protein_id="ADM11515.1"
FT                   /translation="MKTEIKDLFEKDKNRAKKLARKVDVGKEFIYYDFSKTHITEEIID
FT                   RYLEKMDGFGEKIEGMFNGEKINYTEDRKVLHVALRDKEVLRGISGEDVKLDSDRKMVY
FT                   DELMKIKGFVKDFDEGKICGVTGKRLEMIVNIGIGGSDLGPRMVCDALEYYGRKGIKTY
FT                   FISNIDATNTIKVFEKIDPERALFIVVSKTFTTLETIKNAELSMRFLEKRLGKDRAEIA
FT                   SKHFVAVSSNVDEVRKHNISRVFSMWDFVGGRFSLWSAVGLSIVLYIGFDNFICLLRGA
FT                   SVVDEYFRKSRGRSNAEMMHAIVELFYSERGYNNKCLVSYDEYMRKFYLYLQQAEMESN
FT                   GKPSQKTDTGYIIWGGKGTDVQHSFFQLLHQGTRKILTELLMPLKPLHSEEEYHRMVVA
FT                   NCLAQSRGLMIGKEDPNPEKSFEGDKPTVTVCYSKLTPETLGAMIAHYEHKIFILGLYW
FT                   GINSFDQPGVTLGKKIAIEVLESFDEKKESEKFDESTNEMLCLMRSCKR"
FT   gene            <91413..>92108
FT                   /locus_tag="Eint_050680"
FT   mRNA            <91413..>92108
FT                   /locus_tag="Eint_050680"
FT                   /product="hypothetical protein"
FT   CDS_pept        91413..92108
FT                   /codon_start=1
FT                   /gene_family="HOG000150182" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050680"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0660"
FT                   /db_xref="GOA:E0S788"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="UniProtKB/TrEMBL:E0S788"
FT                   /protein_id="ADM11516.1"
FT                   /translation="MFSFKERMKTFASWPENYGVATPEGLSIAGFICLSTEENNLTVEC
FT                   VYCNKTLECWERTDMPAKEHYLHMNSCPLFNVNRLESRVKMFNGWSLKEAKALARMGFV
FT                   KYNLGESDFIFCYKCGSINRSHLCERKRGHPYSLEKRGSVFFYDLIEGIYNKELVKLTE
FT                   YNVYIPQHTKEFLKEVTGGCLGSVFRSVEDVIEEYMGNKLFEIDKAMSHDIERALDEVV
FT                   AGIGKKSLG"
FT   gene            <92251..>92862
FT                   /locus_tag="Eint_050690"
FT   mRNA            <92251..>92862
FT                   /locus_tag="Eint_050690"
FT                   /product="40S ribosomal protein S6"
FT   CDS_pept        92251..92862
FT                   /codon_start=1
FT                   /gene_family="HOG000190952" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050690"
FT                   /product="40S ribosomal protein S6"
FT                   /note="similar to ECU05_0670"
FT                   /db_xref="GOA:E0S789"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="UniProtKB/TrEMBL:E0S789"
FT                   /protein_id="ADM11517.1"
FT                   /translation="MFEIERKVESRLYDKKIGDQFDGGILGEEFEGTIMEITGGDDYQG
FT                   FPMVGGHLTKKRVRPLLSKGDTGYRCRRKGERRRKSVRGSIVSEQTCVLSLIILRAGEK
FT                   EIDGLTNVVNDVSHLPRKEKKLRKMFGIPAEEENVVGYIRNIFKSECEDPKKIPKIRCN
FT                   GKKIRKEKERREEARKIRGERRRILEEERKAYLEKYFNKA"
FT   gene            complement(<92884..>93837)
FT                   /locus_tag="Eint_050700"
FT   mRNA            complement(<92884..>93837)
FT                   /locus_tag="Eint_050700"
FT                   /product="pseudouridylate synthase"
FT   CDS_pept        complement(92884..93837)
FT                   /codon_start=1
FT                   /gene_family="HOG000150181" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050700"
FT                   /product="pseudouridylate synthase"
FT                   /note="similar to ECU05_0680"
FT                   /db_xref="GOA:E0S790"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E0S790"
FT                   /protein_id="ADM11518.1"
FT                   /translation="MAKGEAEYFFTFRTNVKGRWCEKPVIDVLASEFRTRTKDYFLSAL
FT                   ECGAVTVNEEIVEPGRILRIGDVIRHTVHIHEPAHPEIDIIREEQDYVVVNKPPGMPCH
FT                   PTGGYREYSVTRALFGDKKVACINRLDMPVSGVLIVAVKNHSKCLEAIREARKIYLAKV
FT                   QGLFPDSIDVDKKISCAEGKHRYVSDEGKACLTLFRRLAYKDGHSLVECRPITGRTHQI
FT                   RIHLQSIGFPIVNDIMYGDGELPQPLWDSTCNAEISGFEDKRKYEYVVRSCKGRNNRSF
FT                   VTKDYYICLHAWKYTYNGIEYVANLPEWCKDWGLEP"
FT   gene            <93917..>95113
FT                   /locus_tag="Eint_050710"
FT   mRNA            <93917..>95113
FT                   /locus_tag="Eint_050710"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        93917..95113
FT                   /codon_start=1
FT                   /gene_family="HOG000150180" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050710"
FT                   /product="hypothetical membrane protein"
FT                   /note="similar to ECU05_0690"
FT                   /db_xref="GOA:E0S791"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="UniProtKB/TrEMBL:E0S791"
FT                   /protein_id="ADM11519.1"
FT                   /translation="MRNTNELELLQITSITALSLVVYSSGYRKSILNDFLFYIVPQYCA
FT                   VMFPDRIWSTYLCLAMLFRYSQIQKSTNSSEKTTVIGYLRFTISLIVVIAIYGVDFSIF
FT                   DRRLGKSDFFGIQMMDIGVGSFIYNSGVVGWKGRPLRRCIRSYLVLVILGFVRYFVVKW
FT                   FNIHVNPREYGIHLNFYFILAAVRLICSLIGSRYNFLLGLFLITIYEVVLKFSGLVGFI
FT                   FSDQRKTFLEMNKEGLVAVIPYTSIFLMASEIGRICSSKDKVRSKGFQVLRMSGIFGCL
FT                   YAVSQLSNEGSRRLGNAGFVFWILTLHTLHMGIYMLFESVIVLHNPLTSMFCSSNMMFV
FT                   FLFSNLIVLLGNFFYDLGSFSPLVAHLNILSYLVLVFSIPALLASRFDLRCVGLGYRS"
FT   gene            <95149..>96765
FT                   /locus_tag="Eint_050720"
FT   mRNA            <95149..>96765
FT                   /locus_tag="Eint_050720"
FT                   /product="hypothetical protein"
FT   CDS_pept        95149..96765
FT                   /codon_start=1
FT                   /gene_family="HOG000150179" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050720"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0700"
FT                   /db_xref="GOA:E0S792"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="UniProtKB/TrEMBL:E0S792"
FT                   /protein_id="ADM11520.1"
FT                   /translation="MNKEGHRMELEDERHAIILENVFYLLCGVDTTHLRIGVKDKRYAL
FT                   IGDPTYPPQLILPFESLAINVRVLNKFILKSQYSSDTIREMVGDYFEAKIGKYLKDLMG
FT                   LRCQTRSIEMLIVSLGSRVEEFDEMKEIVDDIRDMSGVRILNHLKKRRDRTVHFLGLYD
FT                   DLINPCIHRIREEVQGWVTEGLMPSSEFMVKKNECLNEFTDCVWTHWYRIAQDNVPYFL
FT                   EDHKNLIYNCGRIVNLGRMIHGKNIFHNLAEEYGNLGLTGLNSYLNTQFLESLRSSLER
FT                   ELDVMYRYLLVNESSLYLDIFEELGDEMFFPNERTVAKMNAIRESKNAEGLIFRRSDVP
FT                   TNKYILEILNTKMEACQERHLTMLQLLTVEYTPSILRNFLSPRTVSELEIIFRFLFTLT
FT                   GLSYYMSRFKGFWFARMAAMVVDKFRFSIHSRMKPVRVEKDMDYIRDSMLSSTKKWLRD
FT                   MYLTSGKAYHAWSNFFDLCFNFLDVEYKSALSKEEIKMFEGRLVGSIVLLKDVLEVTEH
FT                   SDLFVHFLGSTQWIDIGGGSV"
FT   gene            <96929..>97792
FT                   /locus_tag="Eint_050730"
FT   mRNA            <96929..>97792
FT                   /locus_tag="Eint_050730"
FT                   /product="Lrg1-like protein"
FT   CDS_pept        96929..97792
FT                   /codon_start=1
FT                   /gene_family="HOG000149442" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050730"
FT                   /product="Lrg1-like protein"
FT                   /note="similar to ECU05_0710"
FT                   /db_xref="GOA:E0S793"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:E0S793"
FT                   /protein_id="ADM11521.1"
FT                   /translation="MERKSLGKPFERNLRTVNGLADGDFEIYKKSFFEYYDDLIRKYFG
FT                   TFERFKLRQGKLARVFFSHDTLKLHSKYEWVVTRLSYGKEGELMVPRNFYILTETVLSL
FT                   DCKVGGIFRVRNSITTIKECVDAINQYVSRNLSYGEARRLLIRDFNVIDLTTAFKEILR
FT                   EYSTTIIPESLIDTMFKIARIENRDDQIILCQMLFISMPKTNRHVLEATIYFLYVMHDI
FT                   ATDGGKNHKNNMNMEGISTIMMPNLVIKPHNELDLEQVGVLVNFMKMFFRDFAKIIQLD
FT                   PNIMEL"
FT   gene            <97887..>98957
FT                   /locus_tag="Eint_050740"
FT   mRNA            <97887..>98957
FT                   /locus_tag="Eint_050740"
FT                   /product="U2 snRNP auxiliary splicing factor U2AF large
FT                   subunit"
FT   CDS_pept        97887..98957
FT                   /codon_start=1
FT                   /gene_family="HOG000149441" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050740"
FT                   /product="U2 snRNP auxiliary splicing factor U2AF large
FT                   subunit"
FT                   /note="similar to ECU05_0720"
FT                   /db_xref="UniProtKB/TrEMBL:E0S794"
FT                   /protein_id="ADM11522.1"
FT                   /translation="MGLLPLDKRARRMNLFDVGRCILEGIEYIEEILESGINITKELEK
FT                   DLYVPLLLSRLKTDGFTEEDHRNSTSIVCLTPLGPGSLNKFLLRFFKGFALSSRDGQID
FT                   IEFSSRQDATKCLYLSSRDFTFLRPSGYIEFPGDGEVREAGSKYCKDVPCTVDKILLGP
FT                   LDISASILRDALDEISPLQSFRECGNPSYFVFTFRNPELCDPFVKATSHIFISDVGRPL
FT                   ASVRAYKGCSILNLGRSIPSLMPRRMAGPIALSKEKTRIVVLLNVIGPWDVDVSEIIEA
FT                   IRGMCSRNEGVKNVMVPRSKHFPGRQPGSSRIFIECKDLETSQRIHNEFGGLVYKDRIV
FT                   AAGYYPELNYFAGEYE"
FT   gene            <99008..>100435
FT                   /locus_tag="Eint_050750"
FT   mRNA            <99008..>100435
FT                   /locus_tag="Eint_050750"
FT                   /product="serine palmitoyl transferase subunit 2"
FT   CDS_pept        99008..100435
FT                   /codon_start=1
FT                   /gene_family="HOG000206826" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050750"
FT                   /product="serine palmitoyl transferase subunit 2"
FT                   /note="similar to ECU05_0730"
FT                   /db_xref="GOA:E0S795"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0S795"
FT                   /protein_id="ADM11523.1"
FT                   /translation="MSENKIPLHVMLVTYLFYLIVVLLGHARDTFGKWLFPKIQKRNKL
FT                   DDNRVPLYSNFESFFRRRIFKRFQDCWENPISGVPGRYITVLERIIEDSNESFRLTGKK
FT                   LKLLNLGSYNYLGFSNNEGSIVEKVVEVVHKYPLVLTAPAREVGSYDIIRELEEEMASF
FT                   LHQEDCMVFSIGYGTNSSNIPVICEEGTLILSDELNHASLITGAKISKGVIRVFEHNNM
FT                   KDLESKLIFNISQGQPLTHRAWRKIVVIVEGIYSMEGTIANIKKLVELKKKYKFYIFVD
FT                   EAHSIGALGATGRGVCEHANVDFREVDILMGTFTKSFGGMGGYIAGSKKLVTWLRFYGD
FT                   LSLYGDQMPPFVCSQILESLRCIKSTELGRLKIEKLRSNTVLMRQNLVNAGFFILGDEF
FT                   SPVIPILIVCPGKLVEFSRLCMMEGIGIIVVGYPATPILTSRVRLCISASHTTEDVMKA
FT                   FEIINKVGDKLGVKICK"
FT   gene            <100475..>101434
FT                   /locus_tag="Eint_050760"
FT   mRNA            <100475..>101434
FT                   /locus_tag="Eint_050760"
FT                   /product="hypothetical protein"
FT   CDS_pept        100475..101434
FT                   /codon_start=1
FT                   /gene_family="HOG000149440" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050760"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0740"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S796"
FT                   /protein_id="ADM11524.1"
FT                   /translation="METEVYAVDFNPSKNILIYGGGDERCIVMDLGTGDIISIVENFND
FT                   SIIFCKFVDDERFIVGSLNGTISLMTLEDEINSVEVGEDISKMKIDGDKLLVGTAQGNV
FT                   HLFSLDLCIQNVCIGQHNEIQDICYERGKAYTLSEANFMVFDAKSHQKLMDLYVRDGSA
FT                   MDKIPGSDVVCLGLKGCALIRKNAHLLGRIEIEGSPECILYMNNYFIVGGDFDHILLIN
FT                   MPMGMRTFKIPIEGMSGISRIRGDGENRIVFGTFGGVVGFGDIRDEKSFKLVEGGVGCI
FT                   FDLCFKDGMIYVGGEEGFNVVDVGKDYSGAAKEYFPSS"
FT   gene            complement(<101451..>101810)
FT                   /locus_tag="Eint_050770"
FT   mRNA            complement(<101451..>101810)
FT                   /locus_tag="Eint_050770"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(101451..101810)
FT                   /codon_start=1
FT                   /gene_family="HOG000150178" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050770"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0750"
FT                   /db_xref="GOA:E0S797"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:E0S797"
FT                   /protein_id="ADM11525.1"
FT                   /translation="MEKKSLPNDPHSFDIGKKGFLSYEEYRGYCLSILKQPLGKKKMGN
FT                   RIEYNAVEFASCDTEISGVFDFLSSGEDCISFQTLKKATSKLDMNIPDEDISIMIDMFN
FT                   SDGLISKELFSRSFE"
FT   gene            <101930..>102649
FT                   /locus_tag="Eint_050780"
FT   mRNA            <101930..>102649
FT                   /locus_tag="Eint_050780"
FT                   /product="Ulp1 protease"
FT   CDS_pept        101930..102649
FT                   /codon_start=1
FT                   /gene_family="HOG000150176" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050780"
FT                   /product="Ulp1 protease"
FT                   /note="similar to ECU05_0760"
FT                   /db_xref="GOA:E0S798"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniProtKB/TrEMBL:E0S798"
FT                   /protein_id="ADM11526.1"
FT                   /translation="MIPTELEQLDAVADACLRVSTPIKREGYELFSEDLQRTKDGSMLN
FT                   DKIINVYFELLAKHSKTPMYVFSTFFYTTLSKKGVEWVQRWTSSANIFENRLIYIPVYV
FT                   PGHWMFVAFDVREMVLEHYDSMGNVYTDVVLRILEYLRSEWNRIYGRKLSVCVRIKRKI
FT                   PLQRNGRDCGVFVCMFGRYRLDGDGCWFSSNDIPMFRKMMLHEIIDGRILYQTFHWSSQ
FT                   IPCPKEDTSTVIVDTKP"
FT   gene            <102662..>102940
FT                   /locus_tag="Eint_050790"
FT   mRNA            <102662..>102940
FT                   /locus_tag="Eint_050790"
FT                   /product="hypothetical protein"
FT   CDS_pept        102662..102940
FT                   /codon_start=1
FT                   /gene_family="HOG000150175" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050790"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0770"
FT                   /db_xref="UniProtKB/TrEMBL:E0S799"
FT                   /protein_id="ADM11527.1"
FT                   /translation="MKKTPKRKETEDKKESVEEEGEIIEQVGHLRREMCEKKLGFIDKS
FT                   VADEIRELVRYSLYEDVEEFVNPWAANEVHGISNDIAAIQAALDDQQ"
FT   gene            complement(<102996..>105143)
FT                   /locus_tag="Eint_050800"
FT   mRNA            complement(<102996..>105143)
FT                   /locus_tag="Eint_050800"
FT                   /product="DNA replication licensing factor Mcm6"
FT   CDS_pept        complement(102996..105143)
FT                   /codon_start=1
FT                   /gene_family="HOG000224130" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050800"
FT                   /product="DNA replication licensing factor Mcm6"
FT                   /note="similar to ECU05_0780"
FT                   /db_xref="GOA:E0S7A0"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008049"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A0"
FT                   /protein_id="ADM11528.1"
FT                   /translation="MRKKFYPQMTEEVHSKFLEFLDNTSKIRTEAEQAIYRNETVLLVD
FT                   LQDVHSYSVDLYTDLVRNFSRDVDRINRSIAVYTMREFSTALEQVSFHNSQVVYKIREL
FT                   KSDKLGQLLSFSGTVTRTTQVRPELSQGTFVCKVCNSVVSDVFQEFKYTEPLVCPNHLC
FT                   TNRRLWKLEIDKSKFLNWQKIHVQENTEEIPPGSLPRSMDVIVRNDLVEKIRAGDKVVM
FT                   TGYLIVVPDVIQLMMPQSKTVPVQSGELDEIKKKRNINIKDLNYKLSFMCIHADCSLVE
FT                   DGEFTNEELAVINEMRSASDLYYKLSQSMFPSIHGHYSIKNAILLLLVGGVGKKAEGGT
FT                   SLRGDINVLLVGDPGTAKSQFLKQASSFLPRSVYTSGKSSSAAGLTASVIKDGETGEFT
FT                   IEAGALMLSDTGICCIDEFDKMNVRDQVSIHEAMEQQTITISKAGINATLNARTSILAA
FT                   ANPIKGRYDKKKTLRQNINLSAPVMSRFDLYFVLIDDANMENDRNVATHILNSHASITD
FT                   KGMLASYFTKEQVKLYLRYARRKTPKMTDEAKEMLIKKYIGIRQDSLVHSNNYMMTVRH
FT                   LESLIRLSEALAKIHDNEFVTKEYVEEAYRLVKSSVVEVKGEDIEIVPKTADEPGFMIN
FT                   SKDYIRITNSFIYLIKTRDPMERHELVEAFLSESESCIESEKALIEEQKKAENVLSFLI
FT                   GKEGVLFISDGKIHIHPSYDV"
FT   gene            complement(<105442..>106230)
FT                   /locus_tag="Eint_050810"
FT   mRNA            complement(<105442..>106230)
FT                   /locus_tag="Eint_050810"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(105442..106230)
FT                   /codon_start=1
FT                   /gene_family="HOG000150174" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050810"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0790"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A1"
FT                   /protein_id="ADM11529.1"
FT                   /translation="MLRLYEGMIFLPDCPPDCTFVQIVHHSTIRIPPREEYHIPVRLSR
FT                   HSIFDNLCVHTGKPSLMTVNYIQSYSFEEKRGILSYREFEGIEVTKQKILKSEIYEVLP
FT                   PFRIQEYFDGTFLFLKLEELFGEGKIDEYELYSERNERMEKKGSVYRVYPDKRYDQEYV
FT                   IFGKGFIYRLRPGCVFACPFYFKFWSTSSMVYFVARPRSGVLKVECPGLIESDTSKGTI
FT                   GIPPESLDRQGGFLCVGSHRVGFSPEFYKHYCGDYNEKNT"
FT   gene            <106349..>107935
FT                   /locus_tag="Eint_050820"
FT   mRNA            <106349..>107935
FT                   /locus_tag="Eint_050820"
FT                   /product="NOG1 nucleolar GTP-binding protein"
FT   CDS_pept        106349..107935
FT                   /codon_start=1
FT                   /gene_family="HOG000164071" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050820"
FT                   /product="NOG1 nucleolar GTP-binding protein"
FT                   /note="similar to ECU05_0800"
FT                   /db_xref="GOA:E0S7A2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR012973"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A2"
FT                   /protein_id="ADM11530.1"
FT                   /translation="MKINFGYITPVPLNTELIDTSLSKTQRRTPTVIHPQYNIIKIRMF
FT                   YMRKVKHAGSEFGSRLGTILTDFPRIEDIHPFYRDLINVLYDRDHYKLALGHVNSARNA
FT                   IDKISKEFVKLLKFADSLYRCKQLKRAALGRMASAIKRLGKTLEYLEEVRMHMSRLPSI
FT                   DLSGRTLLVCGFPNVGKSSFVRKVSRADVEVQSYPFTTKSLYVGHFDYKYLQWQVIDTP
FT                   GILDQPLENRNTIEMLSITALAHIKAVVLYFIDLSETCGYSISEQIDLFNTLNPLLNSS
FT                   MVIVLSKSDVVKLCDLEDKEMIMEFLSGKKYMEMSCEKEENIDVVKGMACDLLLDERFE
FT                   KKINSDKLCEYINRITILRPKEVREKAESFVCSREITEIENEQERYLVPSEYKYDIIPE
FT                   IIDGKNVADFFDPDIERKLVEIEKEEEDMLPMYCKTYDVLSPEERALKEEITVGIERRR
FT                   IINRLREKKRLPDSWKLRTKNSGEEVEVSVKKDNKTQIVQPPRQPSKKKARFDDKHYYD
FT                   RKPKHLYRGRR"
FT   gene            <108007..>109110
FT                   /locus_tag="Eint_050830"
FT   mRNA            <108007..>109110
FT                   /locus_tag="Eint_050830"
FT                   /product="Ser/Thr protein phosphatase PP2-A regulatory
FT                   subunit B"
FT   CDS_pept        108007..109110
FT                   /codon_start=1
FT                   /gene_family="HOG000149439" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050830"
FT                   /product="Ser/Thr protein phosphatase PP2-A regulatory
FT                   subunit B"
FT                   /note="similar to ECU05_0810"
FT                   /db_xref="GOA:E0S7A3"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A3"
FT                   /protein_id="ADM11531.1"
FT                   /translation="MGNNKIPMWEQCKAFTLEFNSLENKERTTSMQYGERLYIGCGDGR
FT                   VECYGDKKLYSFQGFELEFDYLESCDVAEKVLAIEKLDCGGPEELLAVGNERSLKIWRI
FT                   RNKGPTKEVVEGRFSEEYDYTCVKECKNVHPCILNSLSLNNDKQYLLSSDYLKINLWKP
FT                   EKIEGCFTIVDVKPHKYSDLMFVINSTKFSSEMNMVFGYSTSSGVIHINDLRLSSKSLE
FT                   VLKIDGVDVDGIEGAVKSISDFQFVDSNLILARCLNSVTLYDMRNPKDSVFTTVLCDDT
FT                   DEISSVYESDAVYTRFRISCSNGYGFTGGFQDAVHIVNLSDGSKEDLEIPCEPKNTEKK
FT                   DKLKLVCSNGERFVVACEDKLFEYKHV"
FT   gene            complement(<109262..>109984)
FT                   /locus_tag="Eint_050840"
FT   mRNA            complement(<109262..>109984)
FT                   /locus_tag="Eint_050840"
FT                   /product="putative syntaxin-like protein"
FT   CDS_pept        complement(109262..109984)
FT                   /codon_start=1
FT                   /gene_family="HOG000149437" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050840"
FT                   /product="putative syntaxin-like protein"
FT                   /note="similar to ECU05_0820"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A4"
FT                   /protein_id="ADM11532.1"
FT                   /translation="MDRTGEFMKVIQATLIPQQGRPSSSSPYTKAFEIEATVEKILSEV
FT                   SRMLENGRVYESFALQSKIDRARELIREMQEISGLEIRFQNDQEASSYANLDGIIKNKA
FT                   TRHHIRLKELTRKKNARAQAVSERRKEFDSECSQEQQNAVLMESEVVTERIKERQKISM
FT                   QISEIGQIMEEISMHISLQEESFRRIDDLMETSEGLIFGGLDLMRKTWKNVSGTRPAII
FT                   KFMVFWMVLALVFWMLRR"
FT   gene            <110052..>110621
FT                   /locus_tag="Eint_050850"
FT   mRNA            <110052..>110621
FT                   /locus_tag="Eint_050850"
FT                   /product="hypothetical protein"
FT   CDS_pept        110052..110621
FT                   /codon_start=1
FT                   /gene_family="HOG000150173" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050850"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0830"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A5"
FT                   /protein_id="ADM11533.1"
FT                   /translation="MFEYYEEPVLTNDLLSLAYILDGNVGKIVFTSEMDPKVFPRDPIV
FT                   PSKYAEALSSFESFLDFYRNLKEEGDYSEIITYYKLKHRKLSFIALHLKYVHLKKGAEK
FT                   IDQGEDAGYYNEDLYKTLLECNQYVSRRESKDMFLAPLYMSRFYKENGELVKSRRLKKE
FT                   AQKMAGASRKLDVVWEADDKTYRSFP"
FT   gene            complement(<110654..>111028)
FT                   /locus_tag="Eint_050860"
FT   mRNA            complement(<110654..>111028)
FT                   /locus_tag="Eint_050860"
FT                   /product="Grd19 sorting nexin-like protein"
FT   CDS_pept        complement(110654..111028)
FT                   /codon_start=1
FT                   /gene_family="HOG000149436" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050860"
FT                   /product="Grd19 sorting nexin-like protein"
FT                   /note="similar to ECU05_0840"
FT                   /db_xref="GOA:E0S7A6"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A6"
FT                   /protein_id="ADM11534.1"
FT                   /translation="MEEESVLEITIPGTRNVEGKYTEYEVVCVTNNKSFKKRYTKVFKR
FT                   YRDFYKLHSRLRCLVKVLPEFPRKRWNKMSGDVVEERMRMLPIYMKFVCDQILSDREAS
FT                   GKIEADIVDFIQGKDPELDG"
FT   gene            complement(<111119..>112012)
FT                   /locus_tag="Eint_050870"
FT   mRNA            complement(<111119..>112012)
FT                   /locus_tag="Eint_050870"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(111119..112012)
FT                   /codon_start=1
FT                   /gene_family="HOG000150172" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050870"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0850"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A7"
FT                   /protein_id="ADM11535.1"
FT                   /translation="MEEKIKSLEEKLSGAEQLRRKSEGFKILSTRIREYMERLEALNSR
FT                   IQTINTLMVGYDLVDFLSDEAVDMNSMGLDMVVSTMKDVMSASRQFQKDGSAEYLERCK
FT                   GLQKKIRRIGFLRLNEIIYRSVESLMVDPSFGEFVRLLEEDLVYRTQVKILQSRKVECL
FT                   RKSVYIKNNREFLFRSMVRQELCIFLKLFPWESERLRKRLKEFKEERPLASSGLFECFS
FT                   FSVLKEYFESCGIEELESLKKRLFVELKSSEKSISGEAKESEDGDFYAGVLMLVSVRHY
FT                   LSSKQNYSAQNEVIEV"
FT   gene            <112085..>113443
FT                   /locus_tag="Eint_050880"
FT   mRNA            <112085..>113443
FT                   /locus_tag="Eint_050880"
FT                   /product="6-phosphogluconate dehydrogenase"
FT   CDS_pept        112085..113443
FT                   /codon_start=1
FT                   /gene_family="HOG000255147" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050880"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /note="similar to ECU05_0860"
FT                   /db_xref="GOA:E0S7A8"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012284"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A8"
FT                   /protein_id="ADM11536.1"
FT                   /translation="MEIGLIGLGVMGRNLALNIAAKGYKLHVFNRTSSKTDSLIQERPD
FT                   ICPHYSVEDLVKGMKSSPKIILLMLTSGKVVDIFLEELGKHLSKDDIVIDGGNSSFKDT
FT                   IRRNSYGFEFVGCGISGGEKGARNGASIMVGCGRETWEKVRGFLTDISATNSSTGENCC
FT                   VWLGEDGAGHFVKMIHNGIEYGDMAIISETYLILRSLGLDNREISSLFDNWDKKESESY
FT                   LLRISCSILRMRNEKGSVIDQIMDVSEQKGTGKETVVTSMEMGVAVPAIMEAVASRIVS
FT                   HMKDKRCKLSSKLESIKGEKRISSDAVRKGFYLARIVSYIQGLNLLMEGKEKYGWKYTI
FT                   RDISRVWSDGCILRGKLINAIEEMGRGQEGDFELSPGFVSLCNKNFPYLKEMVLYSVEN
FT                   EVAVPTIASCLMYLSGIKEKEGGGSMIQAMRDYFGSHMVTMEGEAKAEHIEWA"
FT   gene            <113524..>114198
FT                   /locus_tag="Eint_050890"
FT   mRNA            <113524..>114198
FT                   /locus_tag="Eint_050890"
FT                   /product="Ham1 nucleotide triphosphosphatase"
FT   CDS_pept        113524..114198
FT                   /codon_start=1
FT                   /gene_family="HOG000149435" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050890"
FT                   /product="Ham1 nucleotide triphosphosphatase"
FT                   /note="similar to ECU05_0870"
FT                   /db_xref="GOA:E0S7A9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7A9"
FT                   /protein_id="ADM11537.1"
FT                   /translation="MECPKIELETNSDACNWTKEVKGGPRDAEKDRSELPQILFITSSL
FT                   YKYNAFRGFLGVPVKLVSLEMEEIQGSKDEIIMDKLQKVRHLVTKSNFVFVDDTSIHMD
FT                   GLGGFPGQYAKDFLKIGIPKVLEIASKVGGGCVYSTIIGVMHMEEEKIVSKLFSGEVTG
FT                   SIIQREGFESNEFKDFFLPKKEECEGIPSSIGRVNIGRYKAVEKAKKYLIGIGVYGLLG
FT                   GN"
FT   gene            <114293..>115111
FT                   /locus_tag="Eint_050900"
FT   mRNA            <114293..>115111
FT                   /locus_tag="Eint_050900"
FT                   /product="hypothetical protein"
FT   CDS_pept        114293..115111
FT                   /codon_start=1
FT                   /gene_family="HOG000150171" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050900"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B0"
FT                   /protein_id="ADM11538.1"
FT                   /translation="MLEDLDGFIFRRNGRQGTKGRRLFSEGKGELEVARGNTDGIFSFK
FT                   FVREKKRKVDLEVESLGKKSKGKDVVWTEEKGKEGMEVCEEGDICSSIVIREVPKKRMS
FT                   VSSLHEKLEEGGTLGGLVRLCVEYVLEKKKTGYGMDLGRKLHQNEDLIKKRDVEKEVEE
FT                   AEKKIEWASCEEEKWNSLRNEVENSNLIEIREPKKRVRDFGYEEKMEGVRREFSAKIER
FT                   LEFLKESALACVSRIREQSEDLLGRILRIMCKEKEVDTLFLLKTLSRTSK"
FT   gene            115228..115300
FT                   /locus_tag="Eint_050910"
FT   tRNA            115228..115300
FT                   /locus_tag="Eint_050910"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA Type: Thr, Anti Codon: AGT, Cove Score: 66.84"
FT   gene            <115369..>115590
FT                   /locus_tag="Eint_050920"
FT   mRNA            <115369..>115590
FT                   /locus_tag="Eint_050920"
FT                   /product="protein transport Sec61-like protein"
FT   CDS_pept        115369..115590
FT                   /codon_start=1
FT                   /gene_family="HOG000194479" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050920"
FT                   /product="protein transport Sec61-like protein"
FT                   /note="similar to ECU05_0885"
FT                   /db_xref="GOA:E0S7B1"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B1"
FT                   /protein_id="ADM11539.1"
FT                   /translation="MSQKSQRASLLSEYWRSVQTFLKKCIRPSRKEFSASMKHHAIGIG
FT                   FLGILGYGVKLIHIPINNIIVSSNPNKE"
FT   gene            complement(<115641..>116270)
FT                   /locus_tag="Eint_050930"
FT   mRNA            complement(<115641..>116270)
FT                   /locus_tag="Eint_050930"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        complement(115641..116270)
FT                   /codon_start=1
FT                   /gene_family="HOG000150170" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050930"
FT                   /product="hypothetical membrane protein"
FT                   /note="similar to ECU05_0890"
FT                   /db_xref="GOA:E0S7B2"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B2"
FT                   /protein_id="ADM11540.1"
FT                   /translation="MGGETPMDVEHEFNWKCSSKQRTPKCSHLSPLKKRKIDVSIAGED
FT                   HTQIVKLSSIGRKAVLKRIRWPSTSSIGQLPMVAIGYLHLALNLVMIGFVCYIVLYMLI
FT                   GLQRDIRYKITNRRTQIKHQIEEAREAYRINRCDPATRVPAIEELCNKWECVIKNGYGS
FT                   VGYTRIIAEVFGDVIDGFVRKFSVRSSLTIGFFFILFLMFRRAAKS"
FT   gene            complement(<116368..>116850)
FT                   /locus_tag="Eint_050940"
FT   mRNA            complement(<116368..>116850)
FT                   /locus_tag="Eint_050940"
FT                   /product="60S ribosomal protein L21"
FT   CDS_pept        complement(116368..116850)
FT                   /codon_start=1
FT                   /gene_family="HOG000194513" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050940"
FT                   /product="60S ribosomal protein L21"
FT                   /note="similar to ECU05_0900"
FT                   /db_xref="GOA:E0S7B3"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B3"
FT                   /protein_id="ADM11541.1"
FT                   /translation="MRSKGYRRGTRSLFSQDHRKHGVAHVSRYLEKYEIGDMVDILVNP
FT                   SMMKGMPHKYYHGRTGRVYDVKPRSVGIALYKRVRGKYVIKKVIARVEHVRKSRCCEES
FT                   QKRIREISEMTKEAESKGMVLPPIKRKIEGPRKEMVISLENNQPIEVGYEPHIVIF"
FT   gene            complement(<116952..>117170)
FT                   /locus_tag="Eint_050950"
FT   mRNA            complement(<116952..>117170)
FT                   /locus_tag="Eint_050950"
FT                   /product="small nuclear ribonucleoprotein G"
FT   CDS_pept        complement(116952..117170)
FT                   /codon_start=1
FT                   /gene_family="HOG000149434" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050950"
FT                   /product="small nuclear ribonucleoprotein G"
FT                   /note="similar to ECU05_0910i"
FT                   /db_xref="GOA:E0S7B4"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B4"
FT                   /protein_id="ADM11542.1"
FT                   /translation="MGKRAVPNLTGLLHKRVVVRIGGGQVIKGRLAGYDAFMNIVLSEI
FT                   TEPDDVESSAVVRGEFIEDIVLVEETS"
FT   gene            <117322..>117876
FT                   /locus_tag="Eint_050960"
FT   mRNA            <117322..>117876
FT                   /locus_tag="Eint_050960"
FT                   /product="40S ribosomal protein S9"
FT   CDS_pept        117322..117876
FT                   /codon_start=1
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050960"
FT                   /product="40S ribosomal protein S9"
FT                   /note="similar to ECU05_0920"
FT                   /db_xref="GOA:E0S7B5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B5"
FT                   /protein_id="ADM11543.1"
FT                   /translation="MAGKKGSKRANTPRDPFEKERLIREIQLVGVYGLKNKHELWTMEK
FT                   IFSKDKERARTLLTSTNPEDIPINGRCLLKKLMKYGILNGIDLCDKERVIDGLNKVLDL
FT                   TINHYLERRLQFRVFAAGLARSVHHARVLIRGRCISIKDQIVDVPGFMVRADKEPLIEY
FT                   NPYSRFGDKGKKKAEATVERG"
FT   gene            complement(<117877..>118629)
FT                   /locus_tag="Eint_050970"
FT   mRNA            complement(<117877..>118629)
FT                   /locus_tag="Eint_050970"
FT                   /product="phosphatidylinositol transfer protein"
FT   CDS_pept        complement(117877..118629)
FT                   /codon_start=1
FT                   /gene_family="HOG000149433" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050970"
FT                   /product="phosphatidylinositol transfer protein"
FT                   /note="similar to ECU05_0930"
FT                   /db_xref="GOA:E0S7B6"
FT                   /db_xref="InterPro:IPR001666"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B6"
FT                   /protein_id="ADM11544.1"
FT                   /translation="MAKVEKIYVTVLPMTTDEYAVGHFYTVTAMTESENAGGLKVEILK
FT                   AESVVHETLGKVSKTHKVMYLKSRFPRMLHSLIPEDACIVEEISYNAYTKCHTFYRNRY
FT                   FSNDTFNMVFNTVNKDGAEILENPFEYDPARISGVESIRLDLNSPPINPIFDPSVYYHE
FT                   ESGRGRLDENWIETYKNRGMPMMVSYKHLTVEINNYMMGWVSAEIEKAMRSVITSVQQR
FT                   VFCTMDKWYGKSIDSIREESQKDKSFIK"
FT   gene            complement(<118745..>122752)
FT                   /locus_tag="Eint_050980"
FT   mRNA            complement(<118745..>122752)
FT                   /locus_tag="Eint_050980"
FT                   /product="putative Ski2 RNA helicase"
FT   CDS_pept        complement(118745..122752)
FT                   /codon_start=1
FT                   /gene_family="HOG000149432" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050980"
FT                   /product="putative Ski2 RNA helicase"
FT                   /note="similar to ECU05_0940"
FT                   /db_xref="GOA:E0S7B7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B7"
FT                   /protein_id="ADM11545.1"
FT                   /translation="MDYEEYFRTKHPVYTNISAQFTGIGHLIVDGGALISSISKRYGVS
FT                   YESLPLHTYIHGIRFMMSNLQKVGFDNIMMFFRAESGHRRVIKECLMRRFDCMDISKVY
FT                   EYIENERVALVLGGTEKGELEFLYECLGISLYCGVLDQMEFRIPSVYAFVYSPLDRKTG
FT                   RKATKPLDEESDEGSDGDVDTEIKKINAEMSIETIDRLFKTRTKSFGPCKLSVPMELCR
FT                   KLVWMFRNESPERTMDFDGRLLLGEMEMGEDPKCMEYQDLIGNNHRDIESKNLEMELDL
FT                   LISGKEVSPASAAAHMKNVRKSAQSLFDGKLLYTPIVRTKGGKPPKISQKQKQIIEENE
FT                   KRMKEERKVKEASWLRNFFGKYKVLDYQGKRSLLESVKRDGSGIYRRVLLLKIEFYADM
FT                   WNLKKRSEDCDEGIIVPCYLSCMEYIREFGRLGKEDQAPDAELEFVFQNLIGCGFEATV
FT                   RELVEKNGLEGLNLEFFTDDTSAPSEFDICFQLKHTGDKLQRSVNSKKDPRVLFNPDEW
FT                   QVRLLDVVDQNKSAVISAPTSAGKTFICFYAIEKVLKESDTDVVIFCLPTKALVNQVSA
FT                   DIYARFTPKVNSKTFLQGSLMKEFSIAPWNCQVLIVIPSLLESVLNTPPKGFIERVRYI
FT                   IIDEVHKISSEEMGIPIERIIHLSPCPMLVLSATLGNIEGFYGWMKKIEKEKGRECELV
FT                   SYDERYCELKPYVYSHGFEPKMVAINNLFAYSYSHIKKFGFGNDMSFLPEELLHLYDSI
FT                   CAVLSKDQEHLIDRITPENFFKSNIVTKKEVREYGKYLLETFQEMIEGDLLNEKQVKYV
FT                   YKLQTKEARKAFETVVDYSTDYLLENILDLLMELKERGMFPCIVFNTDRDFASKLALKV
FT                   YRQLESQDMEKKKNKLIEKMKKEAKRTRDVEKTKESWIEESIAAEKSFQMRSDKKNIKY
FT                   TFLDPLTKLTDYEISEETKFIKNTDFEFIDMLYRGIGVHHAHLNRKYRSLVEILFRQKH
FT                   LQVLFATETLALGINMPCRTVVFAGDSLQLDPMNYKQMAGRAGRRGFDTLGNVVFMGIP
FT                   KQRVQNLMVSLLPNIKGVYTYTNTSFVGFNMKDSLVKNPLLESTLYSNQDELGRSIGKL
FT                   SISENSSSSYDLSNIYESEEKRAELVDYQLRLLNPYFLPRSYLCDLVIGNRDSDPEILS
FT                   FALLLESRVLPLDPTTLMNALAHFFETKPLLFDMGCTLPPLDPAVYEFCKKINSISKAC
FT                   VTRLYSPILKSLQEMSDTPLHIIDSFLSVKNLDKVKNSYLVDFFRHGNWNRIAEENCIG
FT                   TGELFKSLNVVNNVILSLIKLYDTYGLCDEDRSKIVRFHSMFEPKFKAMFA"
FT   gene            complement(<122825..>123571)
FT                   /locus_tag="Eint_050990"
FT   mRNA            complement(<122825..>123571)
FT                   /locus_tag="Eint_050990"
FT                   /product="putative methyltransferase"
FT   CDS_pept        complement(122825..123571)
FT                   /codon_start=1
FT                   /gene_family="HOG000111527" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_050990"
FT                   /product="putative methyltransferase"
FT                   /note="similar to ECU05_0950"
FT                   /db_xref="GOA:E0S7B8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022238"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B8"
FT                   /protein_id="ADM11546.1"
FT                   /translation="MGIPEHSGPAELYYDEEESLKYTQNSRIVYIQRLLALRCLELLEA
FT                   KDGGLLLDVGCGSGLSGSVLTENGYPWVGIDISMEMLKLGMEREEGVGYIRMDMGKGLD
FT                   FQPGTFDGVVSVSAIQWLFHSYSSEDHPVRRIRTFFTTLYSVCKPDAKCVLQFYLKSQN
FT                   QIEMLKSEAIRAGFSGGIQIDNEGTRNVKSFLVLTSNREARCRKERKKKGIGRIDAILR
FT                   RKEKLKLKGVEVPRNTRYTGKKRSRR"
FT   gene            <123680..>124432
FT                   /locus_tag="Eint_051000"
FT   mRNA            <123680..>124432
FT                   /locus_tag="Eint_051000"
FT                   /product="hypothetical protein"
FT   CDS_pept        123680..124432
FT                   /codon_start=1
FT                   /gene_family="HOG000150169" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051000"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_0960"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7B9"
FT                   /protein_id="ADM11547.1"
FT                   /translation="MSIAYEVLGVKRCARSGAEFERDLKKFSIAEKIMILIFYLLPILI
FT                   PSTAKSIDTLTNLVFPLSMGLSTFSFMPIATRAARRFFDSDVVRIVTLHSLIVTIYILM
FT                   VFASSLRVSNIFYSDNFLESSGSSGEMAYRMVILISYLFYESGRLINRSKGLCKRFVVV
FT                   SQLAGALLTGVSAVVCRMGLIPDSLLHQLFFCCGVVSIIMSLALDSFPSMITLKKDLDI
FT                   LPLIGAGGCLFNAFLGTYMILPSLPLNQ"
FT   gene            complement(<124460..>125533)
FT                   /locus_tag="Eint_051010"
FT   mRNA            complement(<124460..>125533)
FT                   /locus_tag="Eint_051010"
FT                   /product="putative iron hydrogenase"
FT   CDS_pept        complement(124460..125533)
FT                   /codon_start=1
FT                   /gene_family="HOG000150168" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051010"
FT                   /product="putative iron hydrogenase"
FT                   /note="similar to ECU05_0970"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7C0"
FT                   /protein_id="ADM11548.1"
FT                   /translation="MSFFAGLSKNNQKCIKTDTPFNLSLSDCLACSGCVTTDEAGALSA
FT                   DISFVRDSAPQTSFVLSPQSKVNIFNIYGKGNMSYREFEGALSSFLRAKLNVRRIVDTS
FT                   SMRRKIYKEIYKEYLATDHLVISACPGVVAYVERTAPHLIDYLSRVKSPQQMAFSLVKG
FT                   DRTVSVMPCQDKKLESGRDGVKFDHVLTTREFRRVLDELEFELFLKANSWNHHEIEDME
FT                   VTQWNIGTSSGGYAEFILSKHRSVKKIKDRNGIREYMVDDGGIVSQITGLENSINYFKI
FT                   SKTKGPKYKMAEVFLCKNSCIGGPGQERINSVEVDSAEYNIYGKEQPEIYYSDPGLEEK
FT                   RTFRPVSVKRIDFKVDW"
FT   gene            <125588..>125998
FT                   /locus_tag="Eint_051020"
FT   mRNA            <125588..>125998
FT                   /locus_tag="Eint_051020"
FT                   /product="anaphase-promoting complex subunit 10"
FT   CDS_pept        125588..125998
FT                   /codon_start=1
FT                   /gene_family="HOG000150167" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051020"
FT                   /product="anaphase-promoting complex subunit 10"
FT                   /note="similar to ECU05_0980"
FT                   /db_xref="GOA:E0S7C1"
FT                   /db_xref="InterPro:IPR004939"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7C1"
FT                   /protein_id="ADM11549.1"
FT                   /translation="MEIRLSSFKREHSLRELLSKDMSEYWATDDVLPHSIQISFDKVRY
FT                   VQSVQLFLSFTQDDSYTPEKIEVRSGLTRERIRPISSVELVEPEGLLTLNVARNCLYVQ
FT                   IVINSNHQEGKDSHVRHLKVLESSTKEIYYKI"
FT   gene            <126057..>128918
FT                   /locus_tag="Eint_051030"
FT   mRNA            <126057..>128918
FT                   /locus_tag="Eint_051030"
FT                   /product="DNA-directed DNA polymerase alpha"
FT   CDS_pept        126057..128918
FT                   /codon_start=1
FT                   /gene_family="HOG000149431" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051030"
FT                   /product="DNA-directed DNA polymerase alpha"
FT                   /note="similar to ECU05_0990"
FT                   /db_xref="GOA:E0S7C2"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7C2"
FT                   /protein_id="ADM11550.1"
FT                   /translation="MKSDMLGYPMYFYILNIEQVNETTVMLYGKQLDGLPKEPPVDASL
FT                   CSSISGKIRVENIHSPVFLKAVKGKDEELKRDVELFMRSKGVECVFESTSKENVFYSNM
FT                   DRKVDLIKVLPKRNISFDNFFSDYSEAIITEFGNPTENIVISRRLRGPCIVRIDGHSMS
FT                   SARETVVRSPSMIHFVCNSSLPKLVFGSLAVRFDKTGITKYCLYAQGTYHCGGVKLPDC
FT                   KENFEGKGVEYTHHQSSDALVKDLNNLMSSKGIDCIVYHNLPSLVLKKLDISGMVRCDL
FT                   FVFASGSIKGCDFSIGELLGTLNLEVPGELKEIQEHTDGQPKNLFKTLALESKAILEIF
FT                   EATEALHLSKEMCEISGYILNRTLQNLRAERIEYTLLHELYNRGYLFPSSVSRREVKYT
FT                   GGLVLSPQAGFYEDLVLLLDFNSLYPSIIQEFNVCFSTIGMFDKSVSGDMSPEKLAVLT
FT                   EKSRMSERGFLPKILEGFVGRRKAIKDLMKQSRTPEEAKALDIRQKALKLTANSIYGCL
FT                   GFTGSRFCNYTMAAYITNKGRDLLLEAKRIAEEECGMRIIYGDTDSVMVYTGLCGEKSN
FT                   YKRALEMSRKLRDTINSKHQKIEIEVDKVFKKLLLYKKKKYGGLYMDEDGKTYVEYKGL
FT                   DLVRKDFCEVSRKICKIVLELLLADSEDPMVYERFYKDKGEAKTILNNGNTKIIEAVYD
FT                   ELKNLSSNLESIPSKEFVIHNTLSKAPESYDPSVGLPHVSLALRLKESGMKFDQGDVVC
FT                   YVIGKGDLREAVHKRAYHLSESFTIDYGYYVSNQILPPLLRIVGVVKGFHPEKIGKIFG
FT                   VEKAVKQGVEKSISFLTPCCEIAQGASSKCRECGKPVSREFYVWKVMEMVRKEVECLYS
FT                   AESRCLECGISSYTHMKRCFNCNSELSFEPLNYDFDRLLSKVQSMFTGWVEIEDITKKY
FT                   AAASEYRRIDLSKYFEKEIGRNH"
FT   gene            <129003..>129626
FT                   /locus_tag="Eint_051040"
FT   mRNA            <129003..>129626
FT                   /locus_tag="Eint_051040"
FT                   /product="hypothetical protein"
FT   CDS_pept        129003..129626
FT                   /codon_start=1
FT                   /gene_family="HOG000150165" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051040"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1000"
FT                   /db_xref="GOA:E0S7C3"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7C3"
FT                   /protein_id="ADM11551.1"
FT                   /translation="MDGVWGSIKRKLKDMYDRIFVVRMRVAVIGPEKSGKSSIVMKMFG
FT                   DGLRYQGKQNDAEVYKYDEDYMSYVVYDLKGKKNTRRKWDYFHGMCDVILYCVDSSGDE
FT                   EEWGEAREKLKSMVYRNLRSKKNILVLGTKNERGNALECIEIVLKLDLLDIEGREVACF
FT                   SVSAEKNVNVECIKTWLRGQSSFVRSRWGSRVVRSWWKAGFVEN"
FT   gene            <129684..>130700
FT                   /locus_tag="Eint_051050"
FT   mRNA            <129684..>130700
FT                   /locus_tag="Eint_051050"
FT                   /product="WD40 domain-containing protein"
FT   CDS_pept        129684..130700
FT                   /codon_start=1
FT                   /gene_family="HOG000149430" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051050"
FT                   /product="WD40 domain-containing protein"
FT                   /note="similar to ECU05_1010"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7C4"
FT                   /protein_id="ADM11552.1"
FT                   /translation="MEVHRDSSGSEEEATEFSSNDYEVYEPQADDENLEVSEEAYNVME
FT                   YISLDWPAQSIDILRGFTVVLGTNPSEGGTPGMVSIDLFPTNGMKAPEKMRISKRKVKE
FT                   SYNKVRVNGEMVYCLSDDKLVVHNSKFDEVYRRDIGQGLGYGLCFGNSGCVFGTKEGEI
FT                   SINDWKFNEVGTMKIHEGSIESLCYHGGMVFSGSCDHSVKITDIRSGSNIFQKKFEVDI
FT                   NAVDFNGDYLLAFGDDSGMIRLMDIRNHMIEEVQRHKTPISCLKWRDSDILVSGSDEQV
FT                   CIWDVSLDASEEGGYLLFVHQGQRFYKDITFCRGDNNYVVTTSIDGLCVFYPISFDT"
FT   gene            <130802..>131875
FT                   /locus_tag="Eint_051060"
FT   mRNA            <130802..>131875
FT                   /locus_tag="Eint_051060"
FT                   /product="putative rRNA pseudouridine synthase"
FT   CDS_pept        130802..131875
FT                   /codon_start=1
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051060"
FT                   /product="putative rRNA pseudouridine synthase"
FT                   /note="similar to ECU05_1020"
FT                   /db_xref="GOA:E0S6W7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W7"
FT                   /protein_id="ADM11553.1"
FT                   /translation="MTGSSGHLGKETKEDEEKAWDFLLTDMDKMIVKTNHYTPLGCGSM
FT                   PLNRKIDEYIKYGIINLDKSSNPSSHEVVTWVKEILKCEKTGHSGTLDPQVSGVLTVCI
FT                   DRATRLTKSQQSLGKEYVCVIEFLEEPSEEGFRKAAERLVGSLFQRPPLMCAVKRELRI
FT                   RNIYSIDILEFNKERRLGLFRVSCEAGTYVRTLCMHMGILMGCGAVMKGLRRTRSGRIS
FT                   EKDIFTLHDLLDGVHIFNSTKDERVIRRVIRPLESLLVGYPRIMIKDSCVNAICYGAKL
FT                   SITGVLRFDRNIDVGMDIVIVTTKGEAVALGIALVSSPEMSIIDHGLVCRTKRVIMEKD
FT                   LYPRSWGFKSEYEILSE"
FT   gene            <131960..>132760
FT                   /locus_tag="Eint_051070"
FT   mRNA            <131960..>132760
FT                   /locus_tag="Eint_051070"
FT                   /product="DNA polymerase delta auxiliary protein"
FT                   /note="proliferating cell nuclear antigen PCNA"
FT   CDS_pept        131960..132760
FT                   /codon_start=1
FT                   /gene_family="HOG000149429" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051070"
FT                   /product="DNA polymerase delta auxiliary protein"
FT                   /note="proliferating cell nuclear antigen PCNA; similar to
FT                   ECU05_1030"
FT                   /db_xref="GOA:E0S6W8"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W8"
FT                   /protein_id="ADM11554.1"
FT                   /translation="MLELELAAKEKSNGGAASEVLTLMKRMLESLNEIVETADIKATEK
FT                   GLSIQVMDVTHVAFADIFLSSTMFTKYRCDRDLVIGVQLKTFTKIIRGMSVEGGGIFKM
FT                   ECDDAITNLNVKNIREGNVLSFKLKLFSSDSEVYNIPDFEFDVSASIPADEFMYVPRLV
FT                   GTFGDVVGVQAEGKTLMFFQTGEHADASMSFEESPGREGIKIEAKELITQEIAMKYVNL
FT                   ISKVVPLYKDVKISLGVGKPVFFGLYLDGTAHMKLYVAPKFENE"
FT   gene            complement(<132842..>133573)
FT                   /locus_tag="Eint_051080"
FT   mRNA            complement(<132842..>133573)
FT                   /locus_tag="Eint_051080"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(132842..133573)
FT                   /codon_start=1
FT                   /gene_family="HOG000150164" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6W9"
FT                   /protein_id="ADM11555.1"
FT                   /translation="MQRLPLLGVLVFAVRGLHAKYISHLYDVYINENYVNPLKELNPPS
FT                   DENKMISQGEYLHRVYFGMCVPAYKRIGMQITKERSEYIVMVLNFLYEFCSTRQYELAA
FT                   VTATVLHNTSYLRIFEGPGRNPYRPRGIFQVYSDVNYINLQKVSFFYHDYVENPDRASV
FT                   LNIHVLVDMVCFWLDMTFNKKKKIDLLDVLEVTNPVEWRVLRDKWNYMASEVKKAEEKL
FT                   KSREELYQKLLSIIYINYYRD"
FT   gene            <133855..>135069
FT                   /locus_tag="Eint_051090"
FT   mRNA            <133855..>135069
FT                   /locus_tag="Eint_051090"
FT                   /product="hypothetical protein"
FT   CDS_pept        133855..135069
FT                   /codon_start=1
FT                   /gene_family="HOG000150163" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051090"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1050"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X0"
FT                   /protein_id="ADM11556.1"
FT                   /translation="MESEDNMKEYTMISGMVKNRYYTIYGVIVDWLEWKRCRGGDYMMT
FT                   LDLIDECMKKLSVKIFSPKKIFSKGFCVGEVVKIRNLRIYDACRAVTDRSNDIEVIFTP
FT                   YESPSDVIAPFPKRLMEFFNQNREIFVKERKISEIEEGRYFDFNGELIDKQKERCNLIL
FT                   LRFVDYSRNKRVQGQDTTENYPKDMVLIVKAWGCFAMEAEKCEIGGWYRLRNLKADEVG
FT                   YRLYASLSESSKGSISNIGRDTTLGKYFQTKKDKYMEGFALRQGGMKVPDGIARYRLTE
FT                   IKDILLPGVYRIRVCIKRYMPSGGMEVFFCKTCGSEDRGVDGDCKCSIPEIKKIKVVKL
FT                   LLWDGKQEIIAVCRNKLVEHIFIKENDGYLSRRMFDCMILNVRGVEGMVYHLIDLGFFE
FT                   VEKEG"
FT   gene            complement(<135100..>135423)
FT                   /locus_tag="Eint_051100"
FT   mRNA            complement(<135100..>135423)
FT                   /locus_tag="Eint_051100"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(135100..135423)
FT                   /codon_start=1
FT                   /gene_family="HOG000149428" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1060"
FT                   /db_xref="GOA:E0S6X1"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X1"
FT                   /protein_id="ADM11557.1"
FT                   /translation="MKITGRIRLLSKIDALDIIDNSMESHPGQTEFLEKVRLFCTFSMT
FT                   RDKAGKVREALMNMGLTEFESIQLIDLNPRSIVCLQLVIEDMEERFSEGDLFKILGLFE
FT                   NDK"
FT   gene            <135496..>136656
FT                   /locus_tag="Eint_051110"
FT   mRNA            <135496..>136656
FT                   /locus_tag="Eint_051110"
FT                   /product="RIO-like kinase"
FT   CDS_pept        135496..136656
FT                   /codon_start=1
FT                   /gene_family="HOG000150162" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051110"
FT                   /product="RIO-like kinase"
FT                   /note="similar to ECU05_1070"
FT                   /db_xref="GOA:E0S6X2"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X2"
FT                   /protein_id="ADM11558.1"
FT                   /translation="MKETRPERRRKDKSDRATVDKVLDKRTLKVLERLQARGKLTNLWG
FT                   SLCTGKESNVYLAEASTSLCSKFIKNRYNELEETGDLEEMIPVAVKIFKTSIMSFRDRE
FT                   RYIRSEKRFQRFCTSNPRKLIKLWAEKEVRNLKRLGNAGIPSPEPIYLKNNILIMTQIG
FT                   RQGEVAPKLRDAEIEDIEGCYLQCVEIIKNMYKKAGLVHADLSEFNLLYYEGVVYAIDV
FT                   GQSVEIDHDNAQRFLIMDINNVNSFFGKKGVNTIRGNDLFEEITGNVIPSYLKDMDIVK
FT                   DVFIPSRVSEVGNLEDLVAFKAEREDSESMESLSCQSSIESESCLEDSSANLEGEAKDG
FT                   GDSKEEKKKKKRAVKELNRIRRASRISKKEKKKIFKKYIGMKKRKS"
FT   gene            complement(<136977..>138140)
FT                   /locus_tag="Eint_051120"
FT   mRNA            complement(<136977..>138140)
FT                   /locus_tag="Eint_051120"
FT                   /product="26S proteasome regulatory complex component"
FT   CDS_pept        complement(136977..138140)
FT                   /codon_start=1
FT                   /gene_family="HOG000150161" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051120"
FT                   /product="26S proteasome regulatory complex component"
FT                   /note="similar to ECU05_1080"
FT                   /db_xref="GOA:E0S6X3"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X3"
FT                   /protein_id="ADM11559.1"
FT                   /translation="MEELLEKERKARVKNDYETLLKTFEDLMNLCKSDEELVGLARVLT
FT                   IKRGQNRMAIKWMIGQLFERKKQEKGFVVFFSSILREVIEGRIFLEEERIYITEELKKR
FT                   YELSGDIKSALDVVINVPVETFTMVKESVVVNYQLEQLRLCVQNQDWIRADISMKKIRR
FT                   KYFEENDTVAEKIKFYELIVLLHLGQRRYFNASDVYYSLSKLGENSTCYVVLSSFFCIL
FT                   TTCETEMEDVVDRRIEMLRKLSLDKNNDEVSRSIVNRFLSRIIIDRSMINEIQQAFSSV
FT                   LDVSIYLNDLGSVIDEHNFRIVERFYSSISIQEISMVMQSSSENVIRKISFMVNNKFTK
FT                   CKINQKTGIIEFRKRKWNDSVDDVMNKLIKCNHLIHKERLKLSIKRS"
FT   gene            complement(<138199..>138705)
FT                   /locus_tag="Eint_051130"
FT   mRNA            complement(<138199..>138705)
FT                   /locus_tag="Eint_051130"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(138199..138705)
FT                   /codon_start=1
FT                   /gene_family="HOG000150160" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1090"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X4"
FT                   /protein_id="ADM11560.1"
FT                   /translation="MFILFGWLVMASSVLCFSCEIISTDCSKSIIRYTTTHPTTHFLAI
FT                   EYPSNVIPHLISMPVYRIVEKKSSTIVIFCLKGKRVLDILWEKNLCRVWECSPYIDEGV
FT                   VIKAVGVIEGKAVWGNRVVDWIVIPDFTVQFVAFNSFGILLTFIMKTYCRPENIFWKPR
FT                   KNIRN"
FT   gene            <138769..>141954
FT                   /locus_tag="Eint_051140"
FT   mRNA            <138769..>141954
FT                   /locus_tag="Eint_051140"
FT                   /product="RING Zn-finger domain-containing protein"
FT   CDS_pept        138769..141954
FT                   /codon_start=1
FT                   /gene_family="HOG000150159" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051140"
FT                   /product="RING Zn-finger domain-containing protein"
FT                   /note="similar to ECU05_1100"
FT                   /db_xref="GOA:E0S6X5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X5"
FT                   /protein_id="ADM11561.1"
FT                   /translation="MNPFAEDIQFDPRLYEVVSRAGKKNDKTKLKGLRELNDMLDGVDL
FT                   EANIDTLLEVVEDAMKSQDLQIKNLSIDILYRLLSSVKDRLKFKRVLSIWLYGFIENPV
FT                   YSTSKKIFTEFVRIEELEDEFVQILNFKENPVLGLSCLQLLVKKGRKDYSGVISENIKY
FT                   LDLNSARELREIYKLCKMQGKIEGLYKKVVEVRGPNLANLKWKILLDIFGSVPECIKSD
FT                   GKYLDSETLSRAVEKLDVCDDIPVRTIDALRIVFPKIKDKRHYMKGYLKNGSIEEICIL
FT                   EFLNDFHFLNENAGFETVNKLIENVMNIHFQSDRDVEKSISKMNIEVHSESCPSPNEKL
FT                   RESHEHICSLDESDFRGSILRMLLSSLDGLHGKKKIIRADILGIELNPDEFSKEEIEEV
FT                   FQHSVNVFPKDYILNSSFSCNLLPLVLKYPEDVGEEKIRKTICKDNLFLFIPVCKDLDF
FT                   LRSLVFSYDNRSINEIYLSSDIPSELDLDFYYRLGDKIDKPRIVDYKRVLEQYLDREFI
FT                   SGMIESEIMDRNVLYTTVVEQLSLTDVPISTSYTSAFYDWDECFYRDIKIREQSQMVLG
FT                   LRDVYICIHKGALEAFLLLVLDAMCDDEDESLDEKLKSMGVPGGKKALAESVLGSQSAI
FT                   EKWKNTDLGTNQHFVEKVFFDLGLPSRRCGDKKLEQLLEEGGPRAIDYVFRKHIIPPRF
FT                   VASVDFSYLSNKALMYVIGILERGSRNGFPIRFEEFPVEDLESCFCVDRKAIDTHLLES
FT                   LGLVRTLEDLGIEEVVQMIEKDQQLQRKELYKKRYSIYSPLLRTIYIHVANSILNMYSI
FT                   SRLDINSVDDEVYSLLRGCLFESEILFWNLLLNSLLTIRNIRVNAFLEKMVGKNEKWKE
FT                   FLQDADLEQRSLFAFVFPNLFATAPKMEIFLDPFILKETSIGVIDVSAKTQKLTNGFDI
FT                   RITYEAGGTQFTALISIPSDYPYKKPIFTSEMGKKSLLNLKINEMIKRCSKFMELVGLW
FT                   KINIDEKLSGHGECPICYLVIDIHDSSFPNAQCETCKNKFHSRCIVKWVAAGTRNNCPM
FT                   CRRPIEVIPGKGT"
FT   gene            complement(<142013..>143704)
FT                   /locus_tag="Eint_051150"
FT   mRNA            complement(<142013..>143704)
FT                   /locus_tag="Eint_051150"
FT                   /product="putative DNA helicase"
FT   CDS_pept        complement(142013..143704)
FT                   /codon_start=1
FT                   /gene_family="HOG000150158" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051150"
FT                   /product="putative DNA helicase"
FT                   /note="similar to ECU05_1110"
FT                   /db_xref="GOA:E0S6X6"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X6"
FT                   /protein_id="ADM11562.1"
FT                   /translation="MEIDSRRKEYLDHLCKDLQGILEAQEKESPTTKFKCKLASMENRG
FT                   GAYLYSLRVVSMSRRTKISRVLKEEEKLFVQTPSGPVRCTVVGIEGDIVRAVGNRKLKG
FT                   YDFEAVLDLKYTNRVLLDNLERFVKLGKPFNDFIVESWRGAKEAHNLKKDILDIRNSKI
FT                   AESWSLNLYDSSLNESQRKAVEMLKYNNPYKILGPPGTGKTRTVVEIISQLLVNNKRVL
FT                   VCGPSNVSVDNIIERFLKSKYFACNQPSFYRLGSSEKGFSHLNLDSQAELHTKFMKKER
FT                   NDKNFYKDKREKQKKFIEEKQANSSVVFATLFSSLKEKTKFDWVLIDEACQACEAESFL
FT                   AVSKGSTFILVGDPMQLCPETSSLYESLNLPTMLLNEQYRMPSGLLKFSNEVFYNGRVK
FT                   SITEEHTSVFGKSLILFVDTQYFELYESDGVSKSNIGEAEIVKSIVETLQGEEVGIIAP
FT                   YTSQVLLLRDMVDVEVSTVDGFQGQERDYIIITLVRCNDRDEFGFLDNEKRLNVALTRC
FT                   KKGLVVIGDSRTFRRSSTFQMLFKFLRNNSLCLDPETLKEFIRTRK"
FT   gene            <143750..>144763
FT                   /locus_tag="Eint_051160"
FT   mRNA            <143750..>144763
FT                   /locus_tag="Eint_051160"
FT                   /product="tyrosyl-tRNA synthetase"
FT   CDS_pept        143750..144763
FT                   /codon_start=1
FT                   /gene_family="HOG000228237" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051160"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="similar to ECU05_1120i"
FT                   /db_xref="GOA:E0S6X7"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015624"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X7"
FT                   /protein_id="ADM11563.1"
FT                   /translation="MSVEQKLHLITRNLQEVLGLEELKKIVSERNLNVYWGTAITGRPH
FT                   IAYLVPLMKVKDFLDAGCNVKVLLADIHGFLDNLKAPIEKVQDRCIYYEKLIKSCLKML
FT                   GVDLGRIQFIKGSEFQKSNEYTMDLYKILSITSEHDAKKAGAQVVKQVKNPMVSSLIYP
FT                   AMQALDEVHLSVDAQFGGVDQRKIFTYARKYLPLLNYEKRIHLMSPMLPGLNSEKMSSS
FT                   DDLSKIDLMDSKETIFKKIKKCFCEEGNKENGLMKIFSHIIFPIFQHKGENVKITDKDG
FT                   REMEFEKYQEFESEFVSKSIHPGDLKSNAARLIDGIIRPIREEMEEDLSMVRRAYN"
FT   gene            <144819..>145940
FT                   /locus_tag="Eint_051170"
FT   mRNA            <144819..>145940
FT                   /locus_tag="Eint_051170"
FT                   /product="pre-mRNA cleavage complex GTPase subunit"
FT   CDS_pept        144819..145940
FT                   /codon_start=1
FT                   /gene_family="HOG000150157" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051170"
FT                   /product="pre-mRNA cleavage complex GTPase subunit"
FT                   /note="similar to ECU05_1130"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X8"
FT                   /protein_id="ADM11564.1"
FT                   /translation="MEIRLWPNQEFRIEVSETQKLKVMVVSGLAEIKGQELLNEKWYAF
FT                   KDIKTFIFTFSGCKLKVEGACDLQYVSGTTNVPSIFGIVNFFSKNGFDYSKLRTFMVVG
FT                   NGRSTLCFTLINFFVRMGKKVLFTEIDPSRGNIFPGALSTMHVDTLIDCIEGLRLKNPL
FT                   SFFYGSTEITNMELYDLQTTKLQEAIKSKNIDDLHLILCPEGASAFYNTLIKRFEVDRV
FT                   IVVGNERLYHTLDVIVEKLMISRSGFVEEKEIGKSISRYFKGVNNEYTPFTFNVKYKWR
FT                   VVRIGEMYVAPASALPLGSARKVGCVEASEVEISENSVLGISEAREIEDVAGSPVLGYV
FT                   VVIDTGTFKILCTQPRLPKYVFLIQGDLKHIEY"
FT   gene            <146013..>147533
FT                   /locus_tag="Eint_051180"
FT   mRNA            <146013..>147533
FT                   /locus_tag="Eint_051180"
FT                   /product="transitional endoplasmic reticulum ATPase"
FT   CDS_pept        146013..147533
FT                   /codon_start=1
FT                   /gene_family="HOG000149426" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051180"
FT                   /product="transitional endoplasmic reticulum ATPase"
FT                   /note="similar to ECU05_1140"
FT                   /db_xref="GOA:E0S6X9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6X9"
FT                   /protein_id="ADM11565.1"
FT                   /translation="MNRKNPVRDAGSILRDKYITSHLNESLKIDHEYPPLQKVGGIKYL
FT                   LPKITELVYNPLFARAKYDEIGIHPPSTLLLHGVSGVGKTFLVNCISQEYKLPIVKACV
FT                   DSDKELRESFRKSSLLEKSIVLIEDIDTLGEDDKKVISQLSEYLENYKGKSIVIATARN
FT                   PAFIHESLNKFENSLLVKIPTTSERREILASITDRMKCQDIDWLELAKLMPGFVGRDLK
FT                   RALKIASTKAVTDGSHVIRMVDFEMALKEIRWKGTDITFDSIGSLEEVKDELNMSIIFP
FT                   SRFPEKFHKLGITRPSGILLYGPPGCGKTLLVRAVSNMSHCNFLSIKGPELISKYVGDS
FT                   EKEIRKLFDKAKQLQPCVLFFDEIDSLCGERNGNEFTSRIVNQILTLLDGLDDRGDVYV
FT                   IGATNRIESIDKAILRPGRFDKILKVPLPSREGCVDIFRKCTKGIPIEPFDFEGLDLEG
FT                   FSGAEIAGLIRDAAMLCLKRNFNADSFLISKVDILEALKAARVTKDFR"
FT   gene            complement(<147615..>150524)
FT                   /locus_tag="Eint_051190"
FT   mRNA            complement(<147615..>150524)
FT                   /locus_tag="Eint_051190"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(147615..150524)
FT                   /codon_start=1
FT                   /gene_family="HOG000150156" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051190"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1150"
FT                   /db_xref="GOA:E0S6Y0"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y0"
FT                   /protein_id="ADM11566.1"
FT                   /translation="MHYAMRTINDPDSAVSGARIEYEREPCIAVTRGMIVEIYNLDLRP
FT                   VDVIYPNGYVTLIVPVVFRSSKRFLLVSNRGDYAIMGRDKPVVCGRMPAPLSYIKCIRT
FT                   SKNFIFIAENDTVTVASMGHEGLVFGDDVNDFGYYKILDGFSNKGDVGFLLEDISGDVF
FT                   YSRYQMAPSKPKMILKEKMLLRKGLVSARAIGDGLLLIGEGKLYYYVRGKFVLESEFAN
FT                   PGIKNTLAADGSILLSMEDGEIIRISLEGNIPTSNKTCENEIASYKGLSLKTEVLGNLG
FT                   SWFSVLLHLEDKLYYGGSPCGNSYHLEIGKELRVLKTFEGGACPMSLSYLGTSFRYISR
FT                   NSIKKITYSVDLSVEPRYNLSGVIRRFGIADGVLIVSHPNQGKVLREGMSEEQDFGEIL
FT                   NIHIDGYCYFNTKNHMYRLKGRDISSLEIKDIVLSSYHQGLCIVFTGDRNLKAICLETM
FT                   ECIECVECPYEVSLLYLHSYLFISTYYDEFIIMNKHLQVVHRRKHEILKSVCIAGGRLF
FT                   FGDMHGVGYEVTFGQEPETSSRSILSILKETEEENKWELLFLKPSFFSDTMIETMIPVG
FT                   RHIMGIGVSSIFIDLQDFSCYKCSLEGISYALVADHLYVSVGKSIYRCHLGSIPKIKIS
FT                   IEDKLQETDPRNGYVLKFSAMNDEKEVTGLVSPILNIDNDPIINSYLSLKVKRHVHNLF
FT                   LQDEIVMDGRFLSRHYFVVVSNLSREGSFSRLAMFSTRGNCIKLVYESTGEGVVHALDS
FT                   DGDYLATHRNHNVYVYKRQARILVELCVMKIGFIPYRIAMHGSKIACSCIYRSFGVFTF
FT                   NEETNHLSLDFLSNGKEQIESMVFALESLILTTTDGKVLMLDRNYNMETLSIGDRITSM
FT                   CPGSLSLPRSDSVYFTTRNGGIGILGSLTLGNEELGLLTELERHAGRLAPFFQEKTTRI
FT                   INVDVINNMNSADLEDFIEAGKYDRNKIIMALDRLNTFY"
FT   gene            <150601..>151068
FT                   /locus_tag="Eint_051200"
FT   mRNA            <150601..>151068
FT                   /locus_tag="Eint_051200"
FT                   /product="skp1 G2 allele suppressor-like protein"
FT   CDS_pept        150601..151068
FT                   /codon_start=1
FT                   /gene_family="HOG000150154" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051200"
FT                   /product="skp1 G2 allele suppressor-like protein"
FT                   /note="similar to ECU05_1160"
FT                   /db_xref="InterPro:IPR007699"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y1"
FT                   /protein_id="ADM11567.1"
FT                   /translation="MKVTYDFAETKDTAIVFVYKPSAENMHIDPVLEGPRRLRLSENIS
FT                   IDLYGDVYPEIKINESKLRMEIHLRKVEAIRWGGIRGRPIEEPQDSNKESVIEDSEDEE
FT                   NTSVMDLFRKIYQRSGEDVRRAMEKSFYESEGTVLSTDWDQVKSKKITRED"
FT   gene            complement(<151641..>152339)
FT                   /locus_tag="Eint_051210"
FT   mRNA            complement(<151641..>152339)
FT                   /locus_tag="Eint_051210"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(151641..152339)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051210"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y2"
FT                   /protein_id="ADM11568.1"
FT                   /translation="MDGQTAEIIRALDDIGNEMASRKNSLLFVVYSILVTIRNLLENMS
FT                   DGNMVQFSFSEDIKLYLSREDLFGNKIKRTIKETESNIDRLLLDVRSWEISTGLEVCYR
FT                   ISPEDFKEFQNLGSKIDPYYSFLIHNPEKKNSRYIWEKFQQLAMDIRKNAVTNEDKSIF
FT                   EILERIRDDIRASSEVKYLVQQVFFSVPKGVPLELMKGVSEIFNGKYNSWVIPYLEFCI
FT                   QFHLLGIVTS"
FT   gene            complement(<152455..>153414)
FT                   /locus_tag="Eint_051220"
FT   mRNA            complement(<152455..>153414)
FT                   /locus_tag="Eint_051220"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(152455..153414)
FT                   /codon_start=1
FT                   /gene_family="HOG000150153" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051220"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1170"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y3"
FT                   /protein_id="ADM11569.1"
FT                   /translation="MRGIGNVVKAIFKVFSSGIKKAESKAKRLMSSSCDKGKIPTKLAK
FT                   KSEKMSFPMEEEKQHLEDSLPSSKDFRDEKPFQSPVFIEMGQDLSLLDIKLKKIGSDTL
FT                   FLYDIDDTLYHPSNNLQEMEKKFLMEKYISLKEGGTEEMFEEHLAISLLYSFLFYKYVG
FT                   ISLEEYWKMLSEFDYLQYLSPDPSLREFLLSMKNVRRCCFTNGPRDRAENILAKIGILD
FT                   CFEVVICIGKYDTTFCCKPHYKSYEFVTKALGIEVPRNVYFFDDSNSNVVKAKEIGWNG
FT                   ELITKDCNIINVSSRILQAIDGPSDFQQTISKVLRETV"
FT   gene            complement(<153495..>154085)
FT                   /locus_tag="Eint_051230"
FT   mRNA            complement(<153495..>154085)
FT                   /locus_tag="Eint_051230"
FT                   /product="hypothetical transmembrane protein"
FT   CDS_pept        complement(153495..154085)
FT                   /codon_start=1
FT                   /gene_family="HOG000150152" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051230"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="similar to ECU05_1180"
FT                   /db_xref="GOA:E0S6Y4"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y4"
FT                   /protein_id="ADM11570.1"
FT                   /translation="MISFLVNAFVAMLVLYNVLQSFRACREDKRVYKRYNKYFMVIAVF
FT                   LVLDNLFSFVLDFIPFYQLFKLIVVAWISIPACTGAVFVYKFYIRGFMEKYQGDLEEIV
FT                   ERTRSAIFRYFNEYYEKAQKNYRGRGTEEMEEEILGIKNEEGISKMSPNNSHMEDVSDS
FT                   GFSTIDSTVVNGEKNESSLSSKMPTKPVDHGQE"
FT   gene            complement(<154500..>156167)
FT                   /locus_tag="Eint_051240"
FT   mRNA            complement(<154500..>156167)
FT                   /locus_tag="Eint_051240"
FT                   /product="Uup ABC transporter ATPase component"
FT   CDS_pept        complement(154500..156167)
FT                   /codon_start=1
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051240"
FT                   /product="Uup ABC transporter ATPase component"
FT                   /note="similar to ECU05_1190"
FT                   /db_xref="GOA:E0S6Y5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y5"
FT                   /protein_id="ADM11571.1"
FT                   /translation="MDRKISSLKSKYLGKLEKFPFESKEEAIAVGVESYTVDYGRNPIP
FT                   LETPFSMRSIESRKEEAIPDTIAEEEYLLESSSSGEDTDSEEFEGDLHLNIDLFVRGKE
FT                   IVRETPLTIIKGRKYGLVGRNGIGKTTLLKAIRKRKFGIPRGMKIYMIRQDLLSEGTVE
FT                   EFVGAEAGRTLNGLGFTKDMVGKKMNDLSGGWRMRAHLAKAINMNPDLLLLDEPTNYLD
FT                   INALSWLEKKVKELKTVIIVSHDRNFLNSTTEMILHLNDLKIDMYKGNYENFVRQRKER
FT                   MTAAKREYENQLTVREHMQTFIDRFRYNAKRASLVQSKIKALAKMPTLVPPKQDPIIKF
FT                   SFSSTPSQGILLEMSGVGFSYGLGKTLQGLDIRIMSNSRIVVVGANGQGKSTFLKLLAG
FT                   KIEATEGNLIRSPSLRVGYFAQHHVDQLKINENVLDFMMKSYGQEESRRVLASFGLNVD
FT                   NQCIGTLSGGQKSRLGFAIINGLRPNLLVLDEPTNHLDMESIDALAEALRRFEGAVVCV
FT                   SHDLSFIDSVFKEIYVCENRNIKRFYGSILEYKKGLNI"
FT   gene            complement(<156285..>156980)
FT                   /locus_tag="Eint_051250"
FT   mRNA            complement(<156285..>156980)
FT                   /locus_tag="Eint_051250"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(156285..156980)
FT                   /codon_start=1
FT                   /gene_family="HOG000150151" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051250"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1200"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y6"
FT                   /protein_id="ADM11572.1"
FT                   /translation="MSEKSRLNLILRCVAYTKEPKILILVNLLEMAWKASALVHSNEFS
FT                   FFILNNNILENIKGEDTPEFAQEMTEILSKIRNDLEGLEMQVCLWYIDAHKLIEKEIGK
FT                   ASLREFNLYIGQEFKEIFSQLYDISSPFNSDKKAWWAKLLSILDACNSTKTNQNQNITE
FT                   WTEKFKEEFLASEYVKFVNNNKIVYTGQKFEKKKKAIRRILIEGEDKGHLFDFWILPHC
FT                   CNLMERLVS"
FT   gene            complement(<156977..>158218)
FT                   /locus_tag="Eint_051260"
FT   mRNA            complement(<156977..>158218)
FT                   /locus_tag="Eint_051260"
FT                   /product="DNA polymerase alpha/primase large subunit"
FT   CDS_pept        complement(156977..158218)
FT                   /codon_start=1
FT                   /gene_family="HOG000149425" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051260"
FT                   /product="DNA polymerase alpha/primase large subunit"
FT                   /note="similar to ECU05_1210"
FT                   /db_xref="GOA:E0S6Y7"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y7"
FT                   /protein_id="ADM11573.1"
FT                   /translation="MKRIKAAKGDELPGIKFYTMLSKSSVDYETFRKCAERRIEILKRE
FT                   EVNPSVSRCFEMDTEDDTLSHFFCRMVCSQDPWAATWFVNAEVNLLRLRMAKNPEGAKE
FT                   FFLTEVLPYMDGAEIRNGVLVLGMKAKYNPDCAIGMMSSEVLVHFTKVIDMVGRRIVIP
FT                   EGGYLKLNDEGIRSLLGNEFRRYLEGKMNELVEMFLRNPDERMKSLATKLLLNPTTCEK
FT                   NTVFSLEDAEKYFPLCIKAIMQRLRKNRHLKYNDRQTLCLFLKDCGMSVEDGIDFFRRS
FT                   FKAGKEVFDKEYLYSIRHNYGLEGKRANYTCFTCSKIANTTNEERKSNCPFVEDGEYLR
FT                   SQIEGLEVDIEDIMGVGTFSGRCTRFLEKLVQRKQDKLVVTPIRYYIECRSIDRNDGED
FT                   SPRDSRDIVKSPNK"
FT   gene            complement(<158267..>158968)
FT                   /locus_tag="Eint_051270"
FT   mRNA            complement(<158267..>158968)
FT                   /locus_tag="Eint_051270"
FT                   /product="t-SNARE complex syntaxin"
FT   CDS_pept        complement(158267..158968)
FT                   /codon_start=1
FT                   /gene_family="HOG000150150" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051270"
FT                   /product="t-SNARE complex syntaxin"
FT                   /note="similar to ECU05_1220"
FT                   /db_xref="GOA:E0S6Y8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y8"
FT                   /protein_id="ADM11574.1"
FT                   /translation="MLVNRTLEYKKFTKRKDVRFNPLSTSGLRVFLEDVRKSICRLGIV
FT                   QEKHCMPSFSPKRKKKEEIEDIKRCIVEHIHNAEKNIEGIREISPSKTLTECMYGYFVG
FT                   QLKSIVHDYRGLQQKFLKNIDIYEEIEEEDEENEGSRMLLENVKDLRKSIYDLTSVLLD
FT                   MKMAVGQQTLQIDRLDFYLESVNFYLEGANCELEKIPASHRRMKDKIMYFMLLLSVVLV
FT                   LMSILKVARRK"
FT   gene            complement(<159070..>159492)
FT                   /locus_tag="Eint_051280"
FT   mRNA            complement(<159070..>159492)
FT                   /locus_tag="Eint_051280"
FT                   /product="G10 cell cycle control protein"
FT   CDS_pept        complement(159070..159492)
FT                   /codon_start=1
FT                   /gene_family="HOG000235066" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051280"
FT                   /product="G10 cell cycle control protein"
FT                   /note="similar to ECU05_1230"
FT                   /db_xref="GOA:E0S6Y9"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Y9"
FT                   /protein_id="ADM11575.1"
FT                   /translation="MTRIPINPPEEFEKVKAFLEKIETEMRKAENAPLATNPPENYWPI
FT                   FQLHHQRSRYIYNLDKKGEISNELYKYLSLNRFVDHELVCYWKKEGYEDLCCLRCIQPI
FT                   DSKHGNVCICRVPERSIDVARAIRCDNCGCRGCSGY"
FT   gene            <159594..>161327
FT                   /locus_tag="Eint_051290"
FT   mRNA            <159594..>161327
FT                   /locus_tag="Eint_051290"
FT                   /product="gamma glutamyltranspeptidase"
FT   CDS_pept        159594..161327
FT                   /codon_start=1
FT                   /gene_family="HOG000175620" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051290"
FT                   /product="gamma glutamyltranspeptidase"
FT                   /note="similar to ECU05_1240"
FT                   /db_xref="GOA:E0S6Z0"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z0"
FT                   /protein_id="ADM11576.1"
FT                   /translation="MDILFFKTMQGKLTGLLTLLLGSIGASIVKENTLGSPDLRTSEVL
FT                   YSNGACSTEVPLCSRLGVKKLMEGGNAIDAAIASAICIGIINSFSSGIGGGGFVLIKGP
FT                   DGSNMFDMIDFREVAPKSLSSDKLEGMGRTKVGGLSVGVPGEVLGLYEAHQKYGKLPWK
FT                   NLFPENIAIAKGFPASNQLIKRINKFSSYVRSDPGLKEVYTRNGVLLKEGDIVVRKNYA
FT                   KTLETIMNNPKSFYTGELADSIVKAVREKGGLMEKKDLEKYRIIHRDVLEGRYHDYKVY
FT                   TTNLPTSGALILRALNILEKYDLKKLKEDSIKNGNFKYIHLLIEVFKFAMARRGELGDP
FT                   AFLPGWERIVEEIVSKKAAEEAYKKINMEKILDVKEYGIKARGVEDHGTTHINVIDKEG
FT                   MAVLLTSTVNLEFGAQFMDRKTGIVFNNTIDDFYVSSLDNSHEKHPNEVEGGKRPFSSI
FT                   SPVILLKDDEILTLGAAGGIRIPTSIISTIFYLSTGENLREAIMETRIHNHLSPDTTFV
FT                   EYNSPRKLWKYLSGVGHRIEKSLQNTVFTSVQGIFLKKIGGNRVIQAVSDPRKGGEAFG
FT                   Y"
FT   gene            complement(<161345..>162547)
FT                   /locus_tag="Eint_051300"
FT   mRNA            complement(<161345..>162547)
FT                   /locus_tag="Eint_051300"
FT                   /product="ubiquitin carboxyl-terminal hydrolase"
FT   CDS_pept        complement(161345..162547)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051300"
FT                   /product="ubiquitin carboxyl-terminal hydrolase"
FT                   /note="similar to ECU07_0410"
FT                   /db_xref="GOA:E0S6Z1"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z1"
FT                   /protein_id="ADM11577.1"
FT                   /translation="MNLCIHVESLKNVEKILKAITLKLGHLKKKGLSTRCNAGKTSIDL
FT                   QICLQCYCLLCSTDKGLHSHEVFLDPTSSVISCAVCARRYFLRSLTNRIEDTVIVSISS
FT                   SLYEVFPYIPLKGFSNLGNTCYINAVLSIMINLCPIRDELLSNTHTRFKCRDSRCIMCA
FT                   MKSLIDYSYGSECVLTHKFIHTMWLLVPHFVGSMQQDVHEFFVCLLQKIHEAYDFQSTD
FT                   EITCKCLSHRTFFGMFSSTMLCRNCNLKKTKEEAFATIPLECLPSIQSSLDIFLGTEDL
FT                   KDEVMCEACQEEGLCTKRLEVKRYPRVLSLHLKRFSYEGVSRKIDSHVALSNTLAVGER
FT                   IYDVLGFISHRGSITYGHYLSYAIFGGKWYRMDDERVEVIPYEKVSTEGLYLAYYLLRG
FT                   K"
FT   gene            <162642..>163832
FT                   /locus_tag="Eint_051310"
FT   mRNA            <162642..>163832
FT                   /locus_tag="Eint_051310"
FT                   /product="CDP-diacylglycerol synthase"
FT   CDS_pept        162642..163832
FT                   /codon_start=1
FT                   /gene_family="HOG000111503" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051310"
FT                   /product="CDP-diacylglycerol synthase"
FT                   /note="similar to ECU05_1250"
FT                   /db_xref="GOA:E0S6Z2"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z2"
FT                   /protein_id="ADM11578.1"
FT                   /translation="MIGQKRASKEDLSICGCSRTFRRREESDTSEKTHYEVVQNKVTTI
FT                   TKTNFFKRLIWSILMISGFFWICVNNKIYSFILIIFLTISIIREMIGITKKSEGRPFHL
FT                   RVSILFGFSVPIYLYLVFPSIMGVYFPGLPKYFFRRLSFICFYSYVVVFMSFVASLRKG
FT                   KLKSQLGLFALVHLSTYIMAIVAKCAIFNLNKGRFWFMFPALLVISNDISAYVVGKSIG
FT                   KRPLYRLSPKKTLEGFIGAFVFTAIVGFVLGYLHVNSGFLRDGDSEQFQKLIKFKALGM
FT                   SLKIQSIYIHIIPFVLVTSFVAPFTGFLASALKRAYKKKDFGETISGHGGIADRMDCQI
FT                   LVGIFTSTYINSFIYTEDKSIGSVFGFICRNFSSEEIMILIEMLNRRIEGIRGREH"
FT   gene            <163911..>164942
FT                   /locus_tag="Eint_051320"
FT   mRNA            <163911..>164942
FT                   /locus_tag="Eint_051320"
FT                   /product="hypothetical protein"
FT   CDS_pept        163911..164942
FT                   /codon_start=1
FT                   /gene_family="HOG000150149" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051320"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1260"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z3"
FT                   /protein_id="ADM11579.1"
FT                   /translation="METFKMIEAMRQKNRFSSGDYTGYKNYLKVEMRGRGQGEDRDLYK
FT                   LESNLSKFFIFNSTRFLKSNLRILRRNRSEFGVMYSTLMRGMVGGLMEKPIEIGDLLEL
FT                   RKRLLPYKTFVGQIDALLESAPYSFDTSSLKTRYMWNDIAIGFRNDFERDQFLEGKAPQ
FT                   DGGYDADIATFILKVENKKKRLLSLIKSKPTKIVCISKKVEKLLETLDRLKVVLNENLV
FT                   ESAYVEKMINDTEELKAYYLNIAEFKRCLKWDDSIDGFKVPLSFKEVEPQILEVRDDLS
FT                   YVSRKCLRGALSKYLEKSLQPTKPAIKVPFIPVLFDVARDYISYPAEDKNMEDLFKKLH
FT                   MFK"
FT   gene            <164986..>166224
FT                   /locus_tag="Eint_051330"
FT   mRNA            <164986..>166224
FT                   /locus_tag="Eint_051330"
FT                   /product="pre-mRNA splicing ATP-dependent RNA helicase"
FT   CDS_pept        164986..166224
FT                   /codon_start=1
FT                   /gene_family="HOG000149424" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051330"
FT                   /product="pre-mRNA splicing ATP-dependent RNA helicase"
FT                   /note="similar to ECU05_1270"
FT                   /db_xref="GOA:E0S6Z4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z4"
FT                   /protein_id="ADM11580.1"
FT                   /translation="MRSPAILRSLKNKILAKLNRKKKSICNRSTSESNSLGDEVLANNS
FT                   EELLMEWPLPFNKDLLPPYPTDVQKTVIPYILAKKSINVVSETGSGKTLSYVLPYTHIL
FT                   ENEDKRLLVIVPTRELVSQVSKVFQKFSEGLLEVLEITGEGSIDSQRLEASKPFDVVIS
FT                   TPGRLKELMELKSIGSFEYVVVDEADRLMQHDIRRDVAFILREARPEVTSFFSATSFEW
FT                   YGGIKISIGGVSVSRNVEEFFLYAENNEKQQVLGEILNSCEDWFGRTMNVRRDELEIKK
FT                   IFIFCNTIKMCEDLHERFRESLVLHSKKSMDERKTVMKALEGENVVLISTDLGGRGVDI
FT                   RDVDLVINYDLPKTIEAYVHRCGRAGRQKKGVSLSMVCREDKEILPKLRRLIERKGGVV
FT                   PRFMNRKEDIILD"
FT   gene            <166447..>168150
FT                   /locus_tag="Eint_051340"
FT   mRNA            <166447..>168150
FT                   /locus_tag="Eint_051340"
FT                   /product="DNA repair protein Mre11"
FT   CDS_pept        166447..168150
FT                   /codon_start=1
FT                   /gene_family="HOG000149423" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051340"
FT                   /product="DNA repair protein Mre11"
FT                   /note="similar to ECU05_1280"
FT                   /db_xref="GOA:E0S6Z5"
FT                   /db_xref="InterPro:IPR003701"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007281"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z5"
FT                   /protein_id="ADM11581.1"
FT                   /translation="MKILITSDNHLGYKESDPVLFDDSYNAFEEVLKTAQREKVDLILQ
FT                   GGDLFHENRPSRNCLNRTIGLLRRYCVGDRRSSLKSNHSLNIHDQNIGISIPVVAIHGN
FT                   HDDPSGINMISPLDILHSSGLVNYIGKYNLMDRIDVFPLLLEGDYRIAIYGLGHIKDRR
FT                   LYKMFCEGRIMFHRPPDCDSWYNILVLHQNRVPREKEHPSEDFIDDFFDLVVYGHEHES
FT                   KVIKKERLVLQSGSTVRTSLCEGERYDKYIYILRIGKECILEHIKLRNVRPFVLDVLRI
FT                   EGKDNAEEVVGNKIRDMIEAGKRKEVCFNKEITAVDVDTQRFKCKEKKEEENEEDTICK
FT                   NFAHEEKEYTPLIRLKIENCGNNVFDRHRFGIQFKGLVANSGDMLTISRRPRRKEEIEI
FT                   EAVEEKVEIARVLRRILRDVEFGVLSRTGFSESLEEFVKGDSNAFMGMIRKNIEKITKV
FT                   IDYSSIVEEDVIKTMKRISNEEDFYDGEDRLEDKGDKGASNEKRVEESFTKDLEDEYSY
FT                   HSEDNEKNKAGVKKNFNVEDLLGKKYLSKKPRKNKEDSSTDVSFTLSKYL"
FT   gene            complement(<168174..>168683)
FT                   /locus_tag="Eint_051350"
FT   mRNA            complement(<168174..>168683)
FT                   /locus_tag="Eint_051350"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(168174..168683)
FT                   /codon_start=1
FT                   /gene_family="HOG000150148" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051350"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1290"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z6"
FT                   /protein_id="ADM11582.1"
FT                   /translation="MAVRIVTYSSPMSFPPTMFIGNTLLQNTQMKLSYTHIHFTNNVKA
FT                   ISPCDILVVDGNFVPMNALEEAKKVHSKTILWSRDVINSAVWLIEKFSASPTKSYIIVV
FT                   DDSTSIEERDFSSDIDLEASPSLPDLKVEPQKNSTEDYLEDKFSSLEKKKPVESIFSRL
FT                   HLSKNL"
FT   gene            <168766..>171642
FT                   /locus_tag="Eint_051360"
FT   mRNA            <168766..>171642
FT                   /locus_tag="Eint_051360"
FT                   /product="hypothetical protein"
FT   CDS_pept        168766..171642
FT                   /codon_start=1
FT                   /gene_family="HOG000150147" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051360"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1300"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z7"
FT                   /protein_id="ADM11583.1"
FT                   /translation="MLGFVAGFIVGLLSFPMIYCLFPRAVVEVNKKKMVRISNKSKGIE
FT                   ISDEQMKTVIRSMHRCRDTHWINAVIQRLYMEVSKSYAIEAKIKSIILKRFEMSGIRKY
FT                   FKSIDVIEVVLGEEAPYIENIQVVSDDDIHKMIFLEGRKYEDCEEEKLFHLEEEIKKSL
FT                   EIEGIIPEERCECPIDSDESVPLEEVENSGVETKTDNRKKCVSELSTKLVEDCLTSQDR
FT                   ETSRMVFSQKVFENLQVLLGIRYKGGAQISLSLELPKRINLKTTIFIKGMKGDVLVRVP
FT                   SKDYDTRYEYCFLFNPTLSVAVESGISGEIGKLYFRKSISNFIERYIRHLIARTMVYPS
FT                   WNGQYLPFVVPPIKDVVHRIEKVTLENHAIHLPQIVENILLYSSMDYKIVEVDGEVVYR
FT                   RTGYFINEKERIFCTHFPIPKTSLKISHFVGKNRLFKGLTLQESKIMSQLYSWGAFTNV
FT                   ISRFQELKMKTILTPTSSLVELEFENIRYEFIRVIVKNTLVFQRNDPKSPEFIVFKIAD
FT                   EVLYIYQYVTTKHFMMTKRRIWKLRKKLDSKPFTVLGSVSLYKLIKFSKRMMLDHLRKP
FT                   LSEVVEESTDSLSVEKNSDTKTELIEIFEDIKETFSDEKYHQKKMCSKASSESIYRVLS
FT                   LDEVRTKLFSENCGIYTVINEADNIRSIVIESRLQSGSSEFSSQGNTQPDITMEIEEDF
FT                   IIHSYFGEDMIIDLRFGREKEILIYRIRRMEENSYGYSSKVVLYYSKSMNLNFPNYFIE
FT                   AFQLRIRQDEYLMIAAQHLYSTSFLEKEFRKVVEIGKGALYIEFYTDVPDDYSFTVYGA
FT                   SGDSVYSIYKVITSRKARIILPTVKEKEVFTIVLTPKFNRNRKIHYKIVSLPEEFSTEV
FT                   LVDCNVGLSKNMKFYCPVFGRTDSVIFWEKGDDNEIKGYIENSDTKIMISRSGTMRTEN
FT                   REYNIYYKNKGEKKRDIKIFLGISLRRT"
FT   gene            complement(<171694..>172023)
FT                   /locus_tag="Eint_051370"
FT   mRNA            complement(<171694..>172023)
FT                   /locus_tag="Eint_051370"
FT                   /product="U6 snRNA-associated small Sm-like
FT                   ribonucleoprotein"
FT   CDS_pept        complement(171694..172023)
FT                   /codon_start=1
FT                   /gene_family="HOG000223549" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051370"
FT                   /product="U6 snRNA-associated small Sm-like
FT                   ribonucleoprotein"
FT                   /note="similar to ECU05_1310"
FT                   /db_xref="GOA:E0S6Z8"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z8"
FT                   /protein_id="ADM11584.1"
FT                   /translation="MLDEDFDNTRDYEKYLEQEVVVMLRDGRYLYGVMKSFDQFNSITL
FT                   DKVIERIFHDGKYGERKHELFIVRGENITMIGLKSPEIAEELTQVNFWDLREEIQALQA
FT                   QTQVG"
FT   gene            complement(<172120..>172662)
FT                   /locus_tag="Eint_051380"
FT   mRNA            complement(<172120..>172662)
FT                   /locus_tag="Eint_051380"
FT                   /product="U3 small nucleolar ribonucleoprotein"
FT   CDS_pept        complement(172120..172662)
FT                   /codon_start=1
FT                   /gene_family="HOG000213883" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051380"
FT                   /product="U3 small nucleolar ribonucleoprotein"
FT                   /note="similar to ECU05_1320"
FT                   /db_xref="GOA:E0S6Z9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniProtKB/TrEMBL:E0S6Z9"
FT                   /protein_id="ADM11585.1"
FT                   /translation="MRELKFHEKKLLKKVNFLEWKNTNTSLEHLAIVKYCLRDREEYVR
FT                   YNRIVGKIRKLAEKLAKLPENDLIRANVTKKLVGKLYSIGIIKNRKLVDCTKVTVSSFC
FT                   ERRLPMVMKRIRMVPNFKDATRFVEHGHVRLGSKVVYDPSTIISKAMEDFVSWVDESKI
FT                   KKKIDEFNGVADDFNYV"
FT   gene            complement(<172741..>173277)
FT                   /locus_tag="Eint_051390"
FT   mRNA            complement(<172741..>173277)
FT                   /locus_tag="Eint_051390"
FT                   /product="protein kinase"
FT   CDS_pept        complement(172741..173277)
FT                   /codon_start=1
FT                   /gene_family="HOG000150146" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051390"
FT                   /product="protein kinase"
FT                   /note="similar to ECU05_1330"
FT                   /db_xref="GOA:E0S700"
FT                   /db_xref="InterPro:IPR006572"
FT                   /db_xref="UniProtKB/TrEMBL:E0S700"
FT                   /protein_id="ADM11586.1"
FT                   /translation="MKSYKVFKKPYVLIEDFKNKFQPFYKEYVNSDAPKLHLDSPTLCC
FT                   PFQATKKYKQSNKRRHTREGFCEICYTRFSNYEEHIKEFEHREFAKDNSNYKKLDAFIS
FT                   TSAFESASVSEEYTPQSPTFRMTPASSGRNHPGVCSNGNEKYSQTLHFSPISTEDCREQ
FT                   EVVLFDHFIAEVFDK"
FT   gene            complement(<173411..>174109)
FT                   /locus_tag="Eint_051400"
FT   mRNA            complement(<173411..>174109)
FT                   /locus_tag="Eint_051400"
FT                   /product="26S proteasome alpha-type subunit C9"
FT   CDS_pept        complement(173411..174109)
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051400"
FT                   /product="26S proteasome alpha-type subunit C9"
FT                   /note="similar to ECU05_1340"
FT                   /db_xref="GOA:E0S701"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:E0S701"
FT                   /protein_id="ADM11587.1"
FT                   /translation="MEDNKPKSNTFTDEGRLPQVEFAIKNVSKAGTIIGYVCTDGIVLI
FT                   GINKEPTNGPMEKIYQLSDDIYCALSGLFGDAMRLKRYAQLKAQEVLEKLGVQCPLTTL
FT                   CKAIGQRKQAFTQYAGTRPFGVSFLYAGIVNGEYTLFSTDPSGTLNRWKGMCYGENEEA
FT                   VNGGLKNDLPEEEMDMNTATIEILKLLGRIRELGPKEGDRMEILHFSKDCKRFLAQEEV
FT                   LRCLEEVHAK"
FT   gene            <174259..>174768
FT                   /locus_tag="Eint_051410"
FT   mRNA            <174259..>174768
FT                   /locus_tag="Eint_051410"
FT                   /product="RNA-binding protein"
FT   CDS_pept        174259..174768
FT                   /codon_start=1
FT                   /gene_family="HOG000149422" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051410"
FT                   /product="RNA-binding protein"
FT                   /note="similar to ECU05_1350"
FT                   /db_xref="GOA:E0S702"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E0S702"
FT                   /protein_id="ADM11588.1"
FT                   /translation="MKNLFDKLEISSSCCLGKKDKKDINRQLGREILGKTEGYMLHKCR
FT                   NRASVISREGLAILFCFNKKYFPTIQYLEKHSNEEFHEVFLDDGALGPLSRGADVMIPG
FT                   ILKYKDLVKGDFEEGDSVVIRILGKSIVGIGEAVVSFKDMAKKGNGIGIEVYHRIGDEL
FT                   YNEKCL"
FT   gene            complement(<175027..>176121)
FT                   /locus_tag="Eint_051420"
FT   mRNA            complement(<175027..>176121)
FT                   /locus_tag="Eint_051420"
FT                   /product="putative translation initiation factor E2B gamma
FT                   subunit"
FT   CDS_pept        complement(175027..176121)
FT                   /codon_start=1
FT                   /gene_family="HOG000149421" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051420"
FT                   /product="putative translation initiation factor E2B gamma
FT                   subunit"
FT                   /note="similar to ECU05_1360"
FT                   /db_xref="GOA:E0S703"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="UniProtKB/TrEMBL:E0S703"
FT                   /protein_id="ADM11589.1"
FT                   /translation="MFEIIILIGPGTELFPIVNEKFSKACLPIMNSPMILHTMECLKSV
FT                   SKRFFVVGLNEEKEDLMSALGEDIDVPVEYVGIDTYDGTVASLLSLYPRITSNDVLVCK
FT                   GDIVTNMDIQAMAFHYFDSKKALMVILGNAVSETSILGYKGDDLMFYSNDCNEEIPFHL
FT                   LKKGLTLTKDLDILQFYMLKTSLFKMFKPDYFSFKHDLLPNVVKNLALTNPVGIHRPGK
FT                   SYIYQIRSISNYLSVNALLKRHSISTDKKLKTSESNAKFIKDYVKKYNLKDLSNVIDNN
FT                   TKTGNVLLLDSIIGRDCDIGEESKIISSIVMSSVSIGHGSHIEGSIIGMGATILPGSVL
FT                   INCKVSPGYTFTEVVNADTRSFSK"
FT   gene            <176198..>177424
FT                   /locus_tag="Eint_051430"
FT   mRNA            <176198..>177424
FT                   /locus_tag="Eint_051430"
FT                   /product="putative zinc metalloprotease"
FT   CDS_pept        176198..177424
FT                   /codon_start=1
FT                   /gene_family="HOG000149420" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051430"
FT                   /product="putative zinc metalloprotease"
FT                   /note="similar to ECU05_1370"
FT                   /db_xref="GOA:E0S704"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E0S704"
FT                   /protein_id="ADM11590.1"
FT                   /translation="MCRKTKGVFLLFFSVRLGIMLWEVRFQHLYSSYLERGLPWFKPDT
FT                   LTGKMATDGRLFGDAQLKASNLRLKSLYKEMKALVLYMGVVFLIFNNKIRSKAIRLLGF
FT                   LWIPNSEVMFLLLLISTITFIEKLCGVGLTLVEGTCSVRYIEYPFNMVVLFLVELPLTI
FT                   CLIIKLFELLRKKTMATFYAAFVISNLFNTFWNARIDKNRLTKVPLEKFPSKLQAMLKS
FT                   EGLEESIYKVKGTQEKKNASLIGFSSFKRIEITGDFDKDPKKLYPVLFHEIGHSIDNII
FT                   LKKKIIIHIIVGCEALAFWLIYVKGSKAFGFSDITSESFVLIILAMYLVLGRTLILIPL
FT                   NMYVQRSELFADEIALANGHGKELSQTLFDMALEHSTVIDTTYLFNAIASLHPIVRERI
FT                   DRCGSLLQK"
FT   gene            <177450..>178040
FT                   /locus_tag="Eint_051440"
FT   mRNA            <177450..>178040
FT                   /locus_tag="Eint_051440"
FT                   /product="glutaredoxin-like protein"
FT   CDS_pept        177450..178040
FT                   /codon_start=1
FT                   /gene_family="HOG000150145" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051440"
FT                   /product="glutaredoxin-like protein"
FT                   /note="similar to ECU05_1380"
FT                   /db_xref="GOA:E0S705"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E0S705"
FT                   /protein_id="ADM11591.1"
FT                   /translation="MNGIEDSNPFEELKEYEVVVAYDDENKKLSNVMKDRGLDYVEVNL
FT                   AVSEKLRTEFMKHFRVSELPVLLIEGIPALDDPSERIKEYIERKEKKSLEKIQSVIDPN
FT                   KITLFIKGSPEHPRCGFTKSLIEILYGLGVTRDKIEYLDVLSDEDIRERLKEINRWPTF
FT                   PQVYIRGRFIGGLDIVRKMSEKGKLKDELSGII"
FT   gene            <178101..>179315
FT                   /locus_tag="Eint_051450"
FT   mRNA            <178101..>179315
FT                   /locus_tag="Eint_051450"
FT                   /product="hypothetical protein"
FT   CDS_pept        178101..179315
FT                   /codon_start=1
FT                   /gene_family="HOG000150143" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051450"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1390"
FT                   /db_xref="GOA:E0S706"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E0S706"
FT                   /protein_id="ADM11592.1"
FT                   /translation="MKYLSRGMFYLFFMLTYLAQMIEVLNVLITKSHLDSGQTGIEEGL
FT                   ATNEMAKKDQDYAPKAKKAIGKRNKELLEDIVAHTIHFTANILFFTGIGKSFSMRILGK
FT                   IFGEIFDLEIVFLTAVISMISLDGFIEYIVCLVYKNPSLEMIFLWCFFAIVFVIPTCIL
FT                   ISIKLLRIFGSSFVISCYLSYFILEISDILSVSNVDFSKMEKVPSNIFSENVQVLMKDR
FT                   GLSDSIYREINPGKNVNAALIGIGGAERIEIYGKVENMNDGQLESILIHEVGHSYDGSL
FT                   VKKISVFLILLGFEMMLLVFLYDNIAKEFIWNNISKEGSFVVLVCLYFASIRPWLFILY
FT                   NLTSQSAEMYADLLTKQYNYNGKLADTLYKISVDSFDFLAPSWLYNSLNSLHPSIMNRI
FT                   EYLSN"
FT   gene            <179415..>180113
FT                   /locus_tag="Eint_051460"
FT   mRNA            <179415..>180113
FT                   /locus_tag="Eint_051460"
FT                   /product="20S proteasome sububit alpha"
FT   CDS_pept        179415..180113
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051460"
FT                   /product="20S proteasome sububit alpha"
FT                   /note="similar to ECU05_1400"
FT                   /db_xref="GOA:E0S707"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:E0S707"
FT                   /protein_id="ADM11593.1"
FT                   /translation="MEDFKQSVNTYSSEGRIHQIEYAMKAMNLGTTTIGIRTKDFAILC
FT                   SEKKILSTLQNPRTVVKHYEIYDHIVLGFSGISGDTKTIVKKSRDFCISHMHMYGENAS
FT                   VERLLKYLSSLSLRFGEEDEAKMIFRRPFGVSLIVAGFDSEPRLYSLDPSGSYVSYKAK
FT                   AIGSGHEVVEGILENEYEEYKELDQSLKKALYTLSKVMKDKINKENVEVVTVTKEGNKF
FT                   LTPEEISVYL"
FT   gene            complement(<180142..>181050)
FT                   /locus_tag="Eint_051470"
FT   mRNA            complement(<180142..>181050)
FT                   /locus_tag="Eint_051470"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(180142..181050)
FT                   /codon_start=1
FT                   /gene_family="HOG000150142" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051470"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1410"
FT                   /db_xref="UniProtKB/TrEMBL:E0S708"
FT                   /protein_id="ADM11594.1"
FT                   /translation="MSLIRKKDLVIFGTPNCDTGLLDKSITKKILRRNPSVLASIYRRT
FT                   NQKNKAIQALQHKLVGNQKVIYNHEILYNYIYFEDYDGAMQRIASLNFRDETIERLLLQ
FT                   IFIHEKTQNEKVCCGSDTYNKIIGRILKYLFTHFSIDVFSYFTKILEDFCNNNNGCKDK
FT                   LCGNSKIALFKKHCNRKYMEQLSLESLKYIYHELGLLEALRLIVHRNPKVDEFYFKEFA
FT                   RKCLPTDEELKSILNRVYSPSLFSLLKERDSLTRAIVELKKHYKKDYTDSEVSFESEYC
FT                   TKIGVRKKNRYLSTYDIPDET"
FT   gene            <181190..>182149
FT                   /locus_tag="Eint_051480"
FT   mRNA            <181190..>182149
FT                   /locus_tag="Eint_051480"
FT                   /product="hypothetical protein"
FT   CDS_pept        181190..182149
FT                   /codon_start=1
FT                   /gene_family="HOG000150141" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051480"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1420"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S709"
FT                   /protein_id="ADM11595.1"
FT                   /translation="MDTKIKIDLDKEMYPGGSEVRGAVDIKMRSPLRISKINLVFSKTT
FT                   RLKIQEIERKENTENNEVEKIYDGYRHEFEIYSSDDPLEEVSSGHHRFPFRFMLRREDE
FT                   GSLEIKGVYFDILCNIRSIYDLYAEIYILGVHNPAYTVRREIQIVDPIMEPRNFNTAID
FT                   VLSPICFLSRRYNIRLEVDKEFYYSGDCLVTEASIPSKKPKIKRMECFIYEILSVSVEG
FT                   KEILRTKYIGGGEAEHYDGGRVLRASLKIPSTTPSTVMGSNFSIRVVLFINLELYRGTP
FT                   VRIKKYIHVIKKNIIHPEIDCMDVLEGEIYPERILVLP"
FT   gene            complement(<182216..>182791)
FT                   /locus_tag="Eint_051490"
FT   mRNA            complement(<182216..>182791)
FT                   /locus_tag="Eint_051490"
FT                   /product="protein tyrosine phosphatase-like protein"
FT   CDS_pept        complement(182216..182791)
FT                   /codon_start=1
FT                   /gene_family="HOG000150140" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051490"
FT                   /product="protein tyrosine phosphatase-like protein"
FT                   /note="similar to ECU05_1430"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="UniProtKB/TrEMBL:E0S710"
FT                   /protein_id="ADM11596.1"
FT                   /translation="MVYLSYIRIYNTVGFIICIVALSTSLMFYKTMDPKYLREAGLCQT
FT                   FFLMEVANICAKKSNARYVPTVMQLVSRMFIIWVVFWYYGIIDWTFPIITTCWYLSDSI
FT                   RYVFYMFRVDTIRVIRYNLFLLTSPIGFALEMYCLKTLYYSLGKILSYFVVLAGVVYIP
FT                   GFIFLFSHMLRQRKWSRKVKACKNRKKD"
FT   gene            <183001..>183906
FT                   /locus_tag="Eint_051500"
FT   mRNA            <183001..>183906
FT                   /locus_tag="Eint_051500"
FT                   /product="putative arginine/serine rich pre-mRNA splicing
FT                   factor"
FT   CDS_pept        183001..183906
FT                   /codon_start=1
FT                   /gene_family="HOG000149419" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051500"
FT                   /product="putative arginine/serine rich pre-mRNA splicing
FT                   factor"
FT                   /note="similar to ECU05_1440"
FT                   /db_xref="GOA:E0S711"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S711"
FT                   /protein_id="ADM11597.1"
FT                   /translation="MQIFIGKIPSHVSEEQIKEYFGQFGEVTDLSLKGTYGFLNFDSES
FT                   SITRVLNQRSHAIDGLPISVERANGRKRPLDGEYHDRYMDMGRGGYSPHRDYRGFRNAP
FT                   YPPSMRYDGRSPGRYDPRFPDRYGGRSPEYRGDGFRGDPQRSRDFCEYCNSCPIHGIRD
FT                   VVDSRKRLHTTRDHPNNHLKVVFENIAPNTTVEDFKNFVHDHGFEPSYARLGYSGNHAV
FT                   LEFKNIEDKDNVMKKLDGVEFNGHVLKTRSYLSKDEYKSRERESYTRNELQPTDTNSSE
FT                   PQGTTGDIYEGIEDGKAEND"
FT   gene            complement(<183941..>184282)
FT                   /locus_tag="Eint_051510"
FT   mRNA            complement(<183941..>184282)
FT                   /locus_tag="Eint_051510"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(183941..184282)
FT                   /codon_start=1
FT                   /gene_family="HOG000150139" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051510"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1450"
FT                   /db_xref="UniProtKB/TrEMBL:E0S712"
FT                   /protein_id="ADM11598.1"
FT                   /translation="MRKDPISLDKGGYKVIEILCISKPLLSLKAGTEHTEGMHKALVQN
FT                   ESGYKVVYFIDPIDFGAGSKIFLKENTSSILLRNTNYIVTFKKNYRTNTALIGKLLLRN
FT                   DGTAQGVKP"
FT   gene            complement(<184339..>185523)
FT                   /locus_tag="Eint_051520"
FT   mRNA            complement(<184339..>185523)
FT                   /locus_tag="Eint_051520"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        complement(184339..185523)
FT                   /codon_start=1
FT                   /gene_family="HOG000150138" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051520"
FT                   /product="hypothetical membrane protein"
FT                   /note="similar to ECU05_1460"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniProtKB/TrEMBL:E0S713"
FT                   /protein_id="ADM11599.1"
FT                   /translation="MIRKISEVSHLERRFLASLFLTLFTSYTMRNRARAHHLLSAMLIL
FT                   YIAFDYKHTAYILGSIFLNSLLLKYIPMSEYSFTLFNILILYIYKIFGPLFEERISGSF
FT                   DISGVLMLMTIKMCYLGKEYDRKTNSIKDALSYMLFTPGLMLGPTPTFKDFIQNKYEEP
FT                   KRPPYGTFLKSFAFLILFQALRISVPRSHLLEENTSLLSRLIYLYLFTVGNRIKFYFAW
FT                   HFSHGCFAFQNFPDLLNADFMKVELATSVKDLSTYWNICTGIWLKNCFFLPMKEKSIFW
FT                   ASIATSGVSALWHGINPCYLIMFLSFSSSIPIVKENNKLLQRFCPSLFWILSRIQMLLL
FT                   TTYFTTSFFLLSISDLIHVWKGVYFAGHVFLVFSLAVQMILKLFLRPEKDKNTH"
FT   gene            complement(<185615..>186301)
FT                   /locus_tag="Eint_051530"
FT   mRNA            complement(<185615..>186301)
FT                   /locus_tag="Eint_051530"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(185615..186301)
FT                   /codon_start=1
FT                   /gene_family="HOG000150137" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051530"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1470"
FT                   /db_xref="UniProtKB/TrEMBL:E0S714"
FT                   /protein_id="ADM11600.1"
FT                   /translation="MGIGEKTLLLVSGSREMSVLTGTSQAQVLSPDKGYTVKKVSSSNT
FT                   FIVKRGNRYTEIKHVLELVENPLDLEKIHDSIPSSSIWNLLPPVDVQGCFYLGDSQIEL
FT                   VEKELKLLKLSGGYAKINYKDMADVACYISSVKECSDFGIKMDIYPEIVKEWALRNFTG
FT                   DPAEVALHCLLACDEGGNMEIFLKSWEEMHLDEVNIGDLTQRVNSTFIPQKKKERLQQY
FT                   LNKLTG"
FT   gene            <186300..>186791
FT                   /locus_tag="Eint_051540"
FT   mRNA            <186300..>186791
FT                   /locus_tag="Eint_051540"
FT                   /product="hypothetical protein"
FT   CDS_pept        186300..186791
FT                   /codon_start=1
FT                   /gene_family="HOG000150136" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051540"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1480"
FT                   /db_xref="UniProtKB/TrEMBL:E0S715"
FT                   /protein_id="ADM11601.1"
FT                   /translation="MEEKFYSEDIKSVSCDLDEARSSIQNEVLDVKSDLLSVYLMNLVL
FT                   YKEMDSEDRKGSPVEEMLSKTSILLEKICAIERRAGSLGEVPQSEENKGSVEEEDPAEE
FT                   GKRTITDKMKKNKFVKKRKAEDRIPRLKYKNKARKLAEMAEIKHDGNIDTKKPSFNKFD
FT                   "
FT   gene            <186885..>187211
FT                   /locus_tag="Eint_051550"
FT   mRNA            <186885..>187211
FT                   /locus_tag="Eint_051550"
FT                   /product="60S ribosomal protein L30"
FT   CDS_pept        186885..187211
FT                   /codon_start=1
FT                   /gene_family="HOG000055224" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051550"
FT                   /product="60S ribosomal protein L30"
FT                   /note="similar to ECU05_1490"
FT                   /db_xref="GOA:E0S716"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="UniProtKB/TrEMBL:E0S716"
FT                   /protein_id="ADM11602.1"
FT                   /translation="MSGKSSKGDNVTSALLLAMKTGECIVGFKRAIKSIIMKRAKCLVI
FT                   SSNYPSTKRKQLEYYSVLAGGLPIIFHNANNEELGNITERGHRLGCISIIDQGEADLIP
FT                   AKGE"
FT   gene            <187596..>188897
FT                   /locus_tag="Eint_051560"
FT   mRNA            <187596..>188897
FT                   /locus_tag="Eint_051560"
FT                   /product="WD40 domain-containing protein"
FT   CDS_pept        187596..188897
FT                   /codon_start=1
FT                   /gene_family="HOG000150135" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051560"
FT                   /product="WD40 domain-containing protein"
FT                   /note="similar to ECU05_1500"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012952"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S717"
FT                   /protein_id="ADM11603.1"
FT                   /translation="MSKKIIREKIKSGKKIAEEALKDVVNYDILRTESCGYIEVDSDEK
FT                   TYDVTQGKIRKYVSIKASEQAYDLKLENGPVHAKYSRNGNHILLRNDKGYLASFNSKSM
FT                   DLHFEMDVNETIHDAIYLHNERFIAVAQKNNVFIYDGNGVEQHCVRENSHVFKMEYLPY
FT                   HYLLASASHQGFLRYQDISTGKIVSEIFIKERRVTSMKQNPANAIIHTGSIKGVVSLWS
FT                   PNCKEYLMKILCHRNTISSIEIERSGRYMITAGMDNRINVWDLRNTYTQLNSLKGKTSL
FT                   SATSLSQKNMLALSYGNNVYIWKNFIDLNSDEALYMKHKTGTLVSSIDFCNYEDILCVG
FT                   SLNGISTIIVPGCGDPVYDSYEDSPFISKKARSEKEVRSLIEKIPYELISIDSKVGSIF
FT                   KEPRMDRPKEELPRYFEDKPVRRGALSRFYDRGD"
FT   gene            complement(<188990..>189949)
FT                   /locus_tag="Eint_051570"
FT   mRNA            complement(<188990..>189949)
FT                   /locus_tag="Eint_051570"
FT                   /product="casein kinase II subunit alpha"
FT   CDS_pept        complement(188990..189949)
FT                   /codon_start=1
FT                   /gene_family="HOG000233021" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051570"
FT                   /product="casein kinase II subunit alpha"
FT                   /note="similar to ECU05_1510"
FT                   /db_xref="GOA:E0S718"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S718"
FT                   /protein_id="ADM11604.1"
FT                   /translation="MVIPTIAKSNVYVNEKKDEKYWNYEYYSIPTGCIERYQIYQRMGR
FT                   GKYSEVFEGRKDREKIVIKTLKPVRKAKICREVLILKNLSHKNIINLMDVVVDSESQIY
FT                   SLIFEYVEHEDYAKIFEKLSYKDVVEYSRQILSALSYCHGMGIIHRDIKPQNMVINQEK
FT                   RELKIIDWGLAEFYHPRKEYSVRVASRYYKSPELLVDYPYYDYSLDIWSFGCVLAELVF
FT                   RRRPFFHGESNSDQLVKIARVLGYTDLRKYIEKYKMDPLSPKHEGTGERVLLSSFSPPG
FT                   SAALYANAIDLLERILVYDHQSRPTAEECLKHPFFESK"
FT   gene            complement(<190043..>190915)
FT                   /locus_tag="Eint_051580"
FT   mRNA            complement(<190043..>190915)
FT                   /locus_tag="Eint_051580"
FT                   /product="acylcoenzyme A thioesterase II"
FT   CDS_pept        complement(190043..190915)
FT                   /codon_start=1
FT                   /gene_family="HOG000149418" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051580"
FT                   /product="acylcoenzyme A thioesterase II"
FT                   /note="similar to ECU05_1520"
FT                   /db_xref="GOA:E0S719"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="UniProtKB/TrEMBL:E0S719"
FT                   /protein_id="ADM11605.1"
FT                   /translation="MEFLKIARLDSWTFEGSNLWSPLPGYPAFGGQLAAQSLASAFSTV
FT                   SSDSVPVTMNILFINRCKSDKKVRYSVKNLRNGSIMDMRQVDCYQDDVLISSSHISFSR
FT                   PDNNSHDYESPPYTAYDDEFIPFSEYISRSLANTSTNQAEIAVKFQVLYENMLMLFKVL
FT                   DVDVGKENKDMRQIRIRIKEKPESMVEKASLITLITDILLMETALITSNLSLFSKDLSL
FT                   LTSLNHVVNFVNLEKNIDDCYLYYIVKCKGIRNSKAICEGQLIHQDGTLICLTGQQGVF
FT                   RVKSSYSRQ"
FT   gene            <191004..>192704
FT                   /locus_tag="Eint_051590"
FT   mRNA            <191004..>192704
FT                   /locus_tag="Eint_051590"
FT                   /product="DNA replication factor C subunit"
FT   CDS_pept        191004..192704
FT                   /codon_start=1
FT                   /gene_family="HOG000149417" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051590"
FT                   /product="DNA replication factor C subunit"
FT                   /note="similar to ECU05_1530"
FT                   /db_xref="GOA:E0S720"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013725"
FT                   /db_xref="UniProtKB/TrEMBL:E0S720"
FT                   /protein_id="ADM11606.1"
FT                   /translation="MSLEREPLKGKVFVFTGDMKMSRDDAKARVMVLGGRCTTAPSSKT
FT                   SFLVVGDNPGPMKIQKANELNIKILNEEEFVKLVESNIDDFSSTPETEKHLKMDPEKGG
FT                   GSALSSVWNEKYRPKRKDEIIGNPGIMKQLEDYLQGCTKYKAALLSGHPGIGKTTMAHI
FT                   VCRSLGFDVVEFNASDIRNKSEISSKVRSFTNSQSICSGTSKKKALIMDEVDGMSSDRG
FT                   GIPELVSVIKKTTIPIICICNDRNNLKIRTLSNHCLDLRFRKPDSRPVLLRIKHILEKE
FT                   GKRIPDGVLSEIIAKSNGDIRYAISMVQGISLRRTLNSSISTNFVKKSVMKSLFDVAGE
FT                   VFQRKSVSEKIDLYFEDYSLVPLFVSENVLKTSFKSLGDLSECFDSISLGDVVERLIRG
FT                   AGQDWSLAPLHAVYSVVIPTRGRPLTKKMMFPSWLGQNSKHLKAERALHTASVHSSCRI
FT                   RANAEELRKYALELILRRYSCHLKACSIDKAIDNIIEYDMTKEDIDSLGNIVLGGVEMF
FT                   EGIERKTKIHLDKEYKKLKRKLPYPEVEKEGHHTESQSSEEEIASYQEY"
FT   gene            complement(<192731..>193861)
FT                   /locus_tag="Eint_051600"
FT   mRNA            complement(<192731..>193861)
FT                   /locus_tag="Eint_051600"
FT                   /product="putative transcription-associated recombination
FT                   protein"
FT   CDS_pept        complement(192731..193861)
FT                   /codon_start=1
FT                   /gene_family="HOG000149414" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051600"
FT                   /product="putative transcription-associated recombination
FT                   protein"
FT                   /note="similar to ECU05_1540"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniProtKB/TrEMBL:E0S721"
FT                   /protein_id="ADM11607.1"
FT                   /translation="MSEKERVEELLEVLSRLGTNREEGMDIYERRVFAFMKDIKPETFD
FT                   SLDFGSELERIAAYPIVLGALFMRKEFKKIDKMVNENLLPYLIGKKRIYDYFIGLVVKI
FT                   FYLARKNECQDNSTLFSLLVTNKELGNEYTVSVITNCLLDMLISNKIFQRIESSIVTTS
FT                   EQARYNYYNGIISMVEGDYESALKCFHTSIILSTNRDVILGAEKRVILCMLLNSDYNIP
FT                   YSYRPSLKTYFELASVVKKAEIKKFEETLENNKNELMSQGLYFVARRLYQNVIQEGIRR
FT                   ISVIYSQISYADIGHLLDINPEEVEYLVKRTIRKGLIVGKVIDGIFYSLREDKSGADIG
FT                   IGIRDCIQLTKYIQEHMRYPAIEPLCYEKVRKTHDK"
FT   gene            <194218..>194868
FT                   /locus_tag="Eint_051610"
FT   mRNA            <194218..>194868
FT                   /locus_tag="Eint_051610"
FT                   /product="hypothetical protein"
FT   CDS_pept        194218..194868
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051610"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU05_1550"
FT                   /db_xref="UniProtKB/TrEMBL:E0S722"
FT                   /protein_id="ADM11608.1"
FT                   /translation="MRLLYQSVLGLMFLVSIHASDSKGASGGESKVDQGNPSLEPSYKY
FT                   VALAVKVKEHSNLYLRVSSRIQNVIKACNEGKVALEENHLRLYKSLGELSELLFKSWND
FT                   FSSLLEQGAELKDLKRELLDITKLESRVIQISAELNIEILVNEDFLREFNEHAENNDHK
FT                   AFAELLGDMMVSVRESLLLRVSKGKEAEEKQQEEQEQQQQQQQGEQEQHREQE"
FT   gene            <195373..>196185
FT                   /locus_tag="Eint_051620"
FT   mRNA            <195373..>196185
FT                   /locus_tag="Eint_051620"
FT                   /product="phosphomannomutase"
FT   CDS_pept        195373..196185
FT                   /codon_start=1
FT                   /gene_family="HOG000181843" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_051620"
FT                   /product="phosphomannomutase"
FT                   /note="similar to ECU05_0260"
FT                   /db_xref="GOA:E0S723"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="UniProtKB/TrEMBL:E0S723"
FT                   /protein_id="ADM11609.1"
FT                   /translation="MDIGKVDKIIENTPRRDKKTIFLFDVDGTLTESRSPISRKMKEML
FT                   KEVKKKVLLGFVGGSDLSKQKEQIGDDLLELFDYGFPENGLSFYKKGALMSQKKIINVL
FT                   GEELLKEFSNFVLEYLTKLEIPMKRGKNFVEHRNSTIYINLIGRRCNRKDRRKFLEIDE
FT                   RGKFREKMVAAMRERFKDTCLVFSIGGEVSIDCFPKGWDKTYCLRHIKREGIENVYFFG
FT                   NMTQEGGNDYEIYIHKDVHGTTVKNPDDTYEKVRQKLKDLKLGDMDKN"
XX
SQ   Sequence 196642 BP; 58021 A; 39297 C; 42244 G; 57080 T; 0 other;
     ttcaatcctc ttcccctctc cccacatcga ggaaaaaatg cacagcctca aaatgtcgga        60
     ttactcctcc attcgcacag cttgcatcca taacggtcgt cttccgtcca catcacagcg       120
     cagtcagtct tcaggcttag aggccttcag ccattatact cccgacgtag ctccgcaaca       180
     gccagcaggc ttgccgctcc accagaggtc gcaatcaaga gttcctctcg tactatcaag       240
     atttactgcc cagtcaatca cagtagggta aaactaacct gtctcacgac ggtctaaacc       300
     cagctcacgt tccctgttgg tgggtgaaca atccaacact tcgcaatttc tgcttcacga       360
     tgataggaag agccgacatc gaagaatcaa aaagcagcgt cgctatgatc gctcggctgc       420
     tacaagccag ttatccctgt ggtaactttt ctgtcaccca tgtcccaagc cttataggac       480
     atgggatctc taggccaggg tttcccccaa acaatcccgc aataggaata gtctcaagca       540
     ggcttatgcc cttgtgctcc acgcgtggtt tccttccccg ctgagcccgc cttaggacgt       600
     ctgcgttagt ctttagcagt cgtgccgccc cagccaaact ccccacatcc ataaataaac       660
     cgctgaggct cagtcatagt ggtctcgcac atctcccccc acctctcttc ataaccaccc       720
     tcagcacttc tcacatgcta gagtcaagct caacagggtc ttctttcccc gctgatcagc       780
     ccaagcccgt tcccttggct gtaggttcac aatacaggtc gtagggacag tgggaatctc       840
     gttgctccat tcatgcgcgt cactaattac atgacgaggc atttggctac cttaagagag       900
     tcatagttac tcccgccgtt tacactcgct taagctcaaa aagccgtaac taaaagtgca       960
     ctgggcagaa ttcaccttgc gttcttccgc aaggctatgt ttttaataaa cagtcagatt      1020
     ccccacaaca aacagttcta gcacgctaga gccaatcctt ctcccaaagt tacacatcca      1080
     tcttgccgac ttcccttaca acccttctca aattcgcttc cgcgtcaaac agtggacacc      1140
     tgttgcggtc taggtacgac atgcatgctt ctttttcatc ggaacaggtc atctcctcag      1200
     cgctgcttcg tctcttaaca atccacaccg ctacttcccc tagttctgct ctcctaggat      1260
     caaaaatccc ccatccgtca tcatcaagtc gcctcaaagc atccatacac tcaatcttca      1320
     atcagtctcc gtttcaacag tcgattcacc cccatcaaat ggggaaccct cgtccacagc      1380
     gcaaatcctt tcttgttact actaccaaga tctgctcata tcacccctcc acccccgctc      1440
     acgcaggacc ttcgtcagaa tgatatcgcc ctcttactca gctccgccgc taaggcctcg      1500
     gatacctgca attcaatccc ttccattttc tccagcgccc aattcggtag gtacgttgca      1560
     acacgtttct tagcggatgc caacctccat ggccaccgtc caactgtcaa aatcaaaccg      1620
     ccagattctc ttcccttgca tacggctcct tatcctaaaa aaggttcatc ccttctcgca      1680
     catcatgctt accacaatat gcccactggc taccccctta caagacatct tcaaagttta      1740
     acgctatcgc attagtgctt tacaacatct tacatcaagt cgccgctgtc ctgagagaca      1800
     tttcagaggg aaccagctac cagatggttc gtttggtctt tcgcccctat gcccatctca      1860
     tgccatcgag ttgcacgtca gaacggctta gatcctccag aacactttcg catcccttca      1920
     atcaacacag gcatagttca ccatctttcg ggtcggatca ctgcatccac tagctctcgc      1980
     taaaacaatc cagccatcct ctccttggtc cgtgtttcaa gacgggcggg tctcatcccc      2040
     ttcaaagcat tcactttcat ttttcatctt gtctttttca catttcaatc actctacttc      2100
     ttcgctatcg gtcattagct tatatttagc tttcggtgaa aaaaaacacc acccaattca      2160
     ggctgcacta ccaaacaacc ctactcttct ctcaagtccg gatacttaca ggccattccc      2220
     cctctaagat cagggacttc aatccctagc tcagtctcct cctactcaaa acaacccgcc      2280
     aaacgcagtt accattcgag ctcctgtcct ttcactcgcc gctactccga caatcccttt      2340
     tggtttcttc tcctcccttt attgatatgc ttaagtcaaa ggggtcccca agcgcttccg      2400
     cttcattcag acatcctcaa aaaggcatat cgtcctccta cacgtccttc ctcgctgcta      2460
     atgcctatca atcccgtgaa tcctcaaatc aaaaaaattc cccccaatct ctcaaatact      2520
     gatcctgctg ctggttctcc aacagcagcc atgttacgac ttatatctta tctaacacga      2580
     aggactcaga ccttccaatc ttcgtccact gcgtcatctt agatagcgac gggcggtgtg      2640
     tacaaaggac agggacccat tcaaaacaac ttgttcaatc gttattacta ggaattccac      2700
     gttcagaagc ccattacaca gcttcatccc tcacagcagg ctccctcgcc atctatcgta      2760
     gtgcgcgtgc cgcccgcttc atctcagggc ataacggacc tgttctgttc cattcctccc      2820
     ttgccccaaa gagcactgtc aaagggtctc acatcttacg caacttaatc caaagctcac      2880
     gccatccatt tcaaacggcc atgcaccacc gccgcgcgca tcccgtcctc gttctcctgc      2940
     ccgcttcaga accggtaagt tgccccgcgt tgagtcaaat taagccgcac actccactcc      3000
     ttgtggtgtc cttccgtcaa tctcttcaag tttcactctt gcgagcatac tatccccaga      3060
     acccacatac tcaagatttc tcatgcacaa cactatatag tcccgtccag tcggcatcgt      3120
     ttactgctag aactaaaacg gtatctaatc gatttcgatc ctctagcctt cgtccttcat      3180
     cgtcacataa gtccaagagc acagccttcg cttctgtccg tccagtcagg gtcttcgtat      3240
     ttcacccctc gcccaactat ccggtgcccc tcgtcctctg ccaaacctct tacatccaca      3300
     tcaggacata atcccccaaa caaagacata caaaagacta cggacttttt aactgcagca      3360
     ttcaccatag acactattgg agcaggtatt accgcggctg ctggcacccg acttgccctc      3420
     caatcaatct cgactccttt acactcgaaa aaaactcact tctcataacc gcctccccaa      3480
     aggattaggc aagtttcgcg cctgctgcca tccttggacg tagtagccat ctctcaggct      3540
     ccctctccgg aatcaaaccc cgatcccccg tctcccgtct ccgcctagtt aggccattac      3600
     cctaactacc agctgatagg cctacaactt acttggctcg tgtcaaaaac actcctagcc      3660
     ccctacctgc agtttcccgc agttacagct ctcccgccaa ccaaatcatc gtactatcac      3720
     tgagccgtcc gtcaatcccc cacaaggttc atcaacatgc atggcttagt cccagagaat      3780
     agcatccacg tcaggcagaa tcaacctggt gctacccccc atcaaaaatc tctcagatcc      3840
     ctcatcaaca aacccctggc cacagccaca tcaaatccca aaaaatcctc catccccacc      3900
     gtcaaacaca aatctctctc agaggagacc aaaactaatc caaaaccact ctcttttctc      3960
     cccacatccc aatccccccc ctcgctcccc cttctctcca taacccctcc ccccacatcc      4020
     caatcacaac atggacccct gccccccaaa tccgtggtag actacatcat tacccccgtc      4080
     cctgaagatc cccacttcta ctatccctat ctccttccca gactcttttg tttcaagcat      4140
     tgcaagagcc actttccttt ctcttttcac tcctctttct tcgtaacttc ttgtaagatc      4200
     gaagaagtcg tctgcatctt catgtctaag cagccccaca gcctccacta tgtcatgaaa      4260
     cttcttctgc tctttgattt cctcaatgct tcgtcctctc cacttctgtt ccgttccctc      4320
     gtccaagatg ttctttataa cttcaggttc cttcttccat tggaaaaccc tcccatggat      4380
     ttcgtagttc tttttctttg ttttttcttc ctttttcccc cctactgctc ccttttccga      4440
     ctttttgtct tctatctctt ctttcttgtc ctttgtaaca atcttcctct ttctactatt      4500
     ctccactacc tttcccttcc cttttccctt acttcttctc ttttcttctt cctcttctct      4560
     catcagctct tctgcatttt ggttagcttc cttttctttc atttctttct catctgtatt      4620
     tcttttcttt ctttcttcaa cctcaagaac aatcctattt atttcattct cataatcatc      4680
     tttatattct aagaatgctt cctttactaa ctctgctgca acctcccttc catgttcttt      4740
     attggtattt atcaaaagat tatgatccaa atagcctatt aatgaaagta tatcactttt      4800
     gtattgataa tacgagttct ttggtttaat tctcaattcc ttggcatgta accttctcag      4860
     accaagcttc aaaataaaac tttttatatc ttcttctctt ttccagagat tcaaacactc      4920
     atcgcatacc atattcatcc ccttaactat ttggtcttgt tcttggatgg tacgaataac      4980
     tttcccatgt atctcgatct cctttaattt ctcttttctc ttcttatttt cttctgaatc      5040
     agggtcaggc aaggcctcta tcttcttaat ctcttcggaa gccttggacg taaggatttc      5100
     tccaagttca tcaagtgttt tcttgcattc tttgactatt ctctttgtta aatctctaaa      5160
     tgtcccattc ttctcataag acagataaac cgaatcaaaa tacccggatt ggatttttgc      5220
     cgtggcgaat gcttctatta agcttttaat ccattcataa taaatcgagg tattcaaaac      5280
     tcccatacac ttcaatgcta cttttgtaat ctccctcata atctttttga catactctcg      5340
     ttttccactt tctatctcgt tgtactttgt cgtagggaat actaaaaatg agtcattatg      5400
     aataacaaat ggatataata tcattttccg ataattaaat atgtcaggag agttataaag      5460
     tacttttttt atccttcttc ttattttctc atcattcatc ttcttctcaa ttcctatttc      5520
     tgtatttgct actgctcttt ccggggatgc tccccacaca acattcatca ttccaagtac      5580
     ttctactcca cagatccaga tcatccaaag gggagaacaa atccaactta tattactctc      5640
     cctttcttgc cttcatcaag gattcattat taataaaaat atcgattttg ataagttcct      5700
     gacttcattc ttctccaaat caagaatatg ctttgtcagt tagaaacaac tcaattctaa      5760
     ctatctaaca tcttcagaat gataataaca acaataacaa actctttgtc tgaaccacta      5820
     aacaactcta ctcaatctca cataaaccat acctttttat tccaatcata ttgtggtagg      5880
     cctttctgtc acatctagct tcgttaacac cttctttgtg cttttaagat ccacacagag      5940
     aattcagaac tccttcccca ttctttccac tgaccattgc attcatcgag gatacataaa      6000
     cggattttcc tcaccttcac tctccaaaca attcctagac aaggtctcaa agccttccac      6060
     aacaaatggt acttttccct cccctgcatt cgtcaactca aaagctttat atgtttgttg      6120
     attaagatat tcatataata agtaagctat ctattttcca tatctcgatt tcattcttct      6180
     ttattctcca tgtctttatc ctcccctttc cctatatatc gagataacct gggaacaaaa      6240
     catcttctac ggcatctttc tccttaccat ctacaattta aaagctgtgc aattgtttgt      6300
     cttctcagtt aacttcctat acactagtta ctttcgtatt tgcatcttat tgctaaaatt      6360
     tctttacttt gggtcccaac ataaatgagt ttcccatccc atattactga gtttattgct      6420
     cctacaatct tcatctttcc aacgcagaac atagaactat ctaaaaagtc ccaaaatcga      6480
     agcattccat ccttggatcc ggtaacaaac gaatcctcca tcgatgctcc acacttgatc      6540
     catgagtcat gtgcatatgg aacagtttta actatggttc catctttcca tcttcttaac      6600
     gagcagtctc ttccgaagct tatgagttcg ttcttatagc acaataatcc ctgaactgag      6660
     tccagatgtg gaggggaaag ggttataaag ccatcattgt agcgcttaac agtatggtct      6720
     ctagagcctg tatatgtgtc ctgccccatt ctttctatgc agaacactgt tccggaatgt      6780
     gctttttcgg caaatgctaa cttacaattc ctttggtcca gtatagaaag agtcccatct      6840
     tcatgccctg taaatatata gttatctcta gagagtaacg ccgaaacttc gcttctgaaa      6900
     ccatatactg gacgtgtacc agatctgtgg tcaaacctct tcaatattcc tcgagttgtg      6960
     tataagagtg tttctaatcc ttccatacat ctaacgccct cctctgtaaa cagagtttct      7020
     gtcctatcac tccattttct aattttatta tctatagatc caaatacaag gcaggaatcg      7080
     aaaagggcca atgtagtagg gaggtatcct gatagtttct ctacgatagt tgtattcatg      7140
     gttatcttct cttttctcgg tgtgaaaagt gcatattttt tggtatttct ttctaaatca      7200
     aaggaaacaa ttcttttatg ggtcttactg gaggctgcat gtgtcatctg atcttctata      7260
     atctcgcatg tgtcagatat ctctagagag tctacatatt ttcttattgt gtcgattttg      7320
     ttgtattccc tttggctctg attttctatt tggcgtttgt attcattatc tcctggatta      7380
     tttgtcgatg cttccggttc gtctaactct gcaactatct ttaatttctc ttcgtccctt      7440
     ttctttctgg aactattttc tggagagttt attctattct ccgatgcttt tcttttaaaa      7500
     gattctaggc ctttgtattc atctgtgatt aaacctcgat tttccggttc tctcggcatt      7560
     ctttgaatcg tatccttaag tttttgattt tcgtttatca gattttgaac aaaaggatgc      7620
     tttagaattt cttggacgat atcctccctt ctgtcgtttt tttcaaaatc tagagtttct      7680
     aacttcgatt tgagactccg attctccaaa attaattcct ctatattaac tttggactcc      7740
     cgacggaact tctccttaag tatttggttt tcagccttaa gcttctgtat ttcttttttc      7800
     aataaaagag ttgtaaactt tgaactatcc acttgtatat tcattttcgt cgtggtttct      7860
     atggaggctg ctctgcttgc atactttaag gtgttgtgtg tttcgccaat gtcggcatga      7920
     gaagaagaaa tgcaagccac catcaataca tatccattaa ggcagctttg aagaattcgg      7980
     gtaagttttg agtctcgaaa gggaatgtgg gaagatttct taaataaagc agaaatgaca      8040
     tttccaagag ccagaagccc tgagttgatg gagattccct cctttgcacg gtctccggca      8100
     cacatggttc ttttaagcct ttcgcttcct gccaagtcaa caaaggaaaa cttcgatgtt      8160
     atgaatgatc catttacttc ctttctatgg aaaagggtaa atatagcatg gcttctagac      8220
     gattttgaat tcatattggt tgattttgtt gttctttcca aggatccctt cttcagggcc      8280
     tcaattccat cttcgtatga tttcagagtc acttcacttg ctccagcaat ggtgacttct      8340
     ccatttactt ctctcaggct caaaggcatt ttgtgcttac tgaacaggtc aatcacttct      8400
     tcattgtaaa cctcgatgaa aatgcagttt acctcctggg ttatcttgaa tatgtgctta      8460
     agagactggg gaacaatccc cgtcatatct tcgtgtgtca ttcccattgt gtaagttttt      8520
     ccactgcctg tttgtccata agccatcact gtgcaattat acccttcaag aaaagactct      8580
     gtgagatgcc tgacacttct gtcgtaaatt tgtacctgcg atgtagtaag gtgcacttta      8640
     ctaaaagtgt aagtttttgt tcctacggtc aatgctgaag gtgtactttc tattacattg      8700
     tctaatctag gatttattcg cacctcgact tgaattgtgt tcttcttatc ttccatcggg      8760
     aagacttcaa ttattttttt tattcttcaa aggaattacg attccgagat gagaaagaca      8820
     tcaaggaaaa tgcttaaccc cagtgcgaaa tgatgttatt agttttccta attgtaataa      8880
     tgattatgac cgggttgctg gctgggttca agcattatgg ctcttcaaag tacagaacaa      8940
     ttccttttaa gataaaatca agagctcccg agaagattgc atctacaagg ctacttggga      9000
     tgactataga agatgctatg aagagacatc cgctattcaa tttctaccca agacagtcaa      9060
     tcaaagagat tttagaaagc tgggatagag taaagtataa aaatggggac ataataacaa      9120
     cgcctggatt tatattacaa ggttgtgtgg agatatggta tggaaattcc cttacctgca      9180
     taaaagaaaa aggctctttt cttaatggat ctatggagct tttaggatat accacaagag      9240
     gaattaagaa ggcaaaaggc tttgttgagg ttctcttggt tgatgcctct ttagccagaa      9300
     ccgatgtatg gtatatcttg ttttccatgg ttagaaagtc atgtatcgag gtagcttgca      9360
     agtattttga gttggaaggc aagcttgtag aaaaagaaac tatgaagatt ggaggtgacg      9420
     gaatgagcca tctagatttg tttctagatt ttctgaacag aaagtttttg caaggcttgg      9480
     atgatggaaa ggaggcactt aaaaagagca ttgaaactag atttgttggt aaaggtgagg      9540
     ttcttaagga ctctggagag cctatggatt atattgtgta tgtggtttcc ggagagattc      9600
     aggtactagc gggagaaaat gcttttagtt ttggaaatgg atccctgttt ggatattttt      9660
     ccttattttt tgattcatat tcgtccatca agattctggc aaagggagat tcctcgattc      9720
     ttatatgcaa ttcatcggtt ctgttcaaac ttggcctgga tgaaaaaaga tttgatcatt      9780
     ctatgttact ggatatcgac gagtgtctcc atgtaataga tgagtcagtc gaatggataa      9840
     ggctttcccc aggggatatg attgttcaaa aaggaggcac ttcgaaggag atcttctaca      9900
     ttgcggctgg aagcataaag tctgcttcga aggagttttc ttctggaatg gcgatagggg      9960
     atagggaatg catctttggg gaaaattggg gcgaatcttt tgtggcaacc aaaataaccg     10020
     atattgttcg gattccatct cttttagtag actatttctt tgaaaatgac aagactttct     10080
     tcaaaaagta caccaaaaga ctgtttgaga atggaagtag aaagaatgga aaaatagtca     10140
     gcatcattcc gattgggcaa tatagggata ttgagtcttt ttcaagaagg ctacgagcag     10200
     caatcggagc ttcttcattg cttttgaacc gtaaggatgt tgttgacatt cttgcaagaa     10260
     gatcgtttga tacgactgag gagctcgggt tcatggatta ccttacaaag atgtctaagc     10320
     gctatgaaat aattcttatt tacgtagaga acgaatattc tagattattg aggtacttgc     10380
     taaacttttc ggacattttg ttgacagttg gaacaacatt tgccgacatt cccgagtaca     10440
     atgtttactg tcgaatagaa tttgtcaaaa tctacgagga aagaaaggct ttaaacgaaa     10500
     ggagcatgag gaagcgagag aaaactgcac cttctcgcac cgggaacgcg aatgaaaaag     10560
     agacgccgag acaatatgac cggattcatc atgttctctt tccctcgaaa accattcttt     10620
     tctgttccaa ggactttcag aggctggcga gatcgttatt aggaaaaaga ataggactag     10680
     ttttaggagg aggaggagca agaggactgg ctcatattgg agttattcag gcacttgaag     10740
     aggagggaat tcccatagat tgtgttggag gaacgagcat gggagcattt atcggcgcct     10800
     tgtatgcaag ggaatgcaat aactattatg tgtttaagca ggcaaaaaga ttttctagaa     10860
     agatgtccaa catatggctt ctccttctag acttaactta tcccatctgc tctatgttct     10920
     cggggcacgg attcaacagg tcactccatt ctgtgtttgg tgatagtcta atacaagatc     10980
     tgtggctgga gtatttctgt atcaccacca atatatctaa ctacgaagaa gaggtgcaca     11040
     gaaacggaat gatttggaga tatgtgcgtg caagcatggg gctctgtgga tatctgcctc     11100
     ctatatgtga taacaaaaaa ctactagttg atggaggata cttgaacaac gttcctgctg     11160
     atgtgatgat gagtatgcaa gtggagaaaa tcattactgt ggatgttggg acggttctag     11220
     aaaatgatta ctttgattat ggagacaccc ttagtggatt taccatccta ttcaataggt     11280
     tctttggcaa caagaaattt gtgacgatgg aagagattca atatagactg gcctatatct     11340
     ctacagagcg aaagacaaaa gagctccagg caaacggaaa tatagttatg ctaaagcctg     11400
     atcttggaaa atatagaacg atggacttta agaagtttga cgaaattgtt gcatgtggat     11460
     accagtctac caaagatgca atctccgaat ggaagcggaa aggaatcttc gatactctct     11520
     ttctcaatct aaaaaaacaa acaccaaaaa gaagatattc cgtgtgatgg agtcttcatc     11580
     cttttcatta aatgtttata aactcagcac tactcccagc ataaaattac taactttata     11640
     tcccaccatt ggttctccat ttgcaaagtt ctatcagtgg taatgtatca acactcaaac     11700
     aaggctgtta tgattggaag gttttctttc ttaaaaagag aagttagaaa aagtccaatg     11760
     aaccaagact tgactttcaa ggacgaccct tttagaataa tcgactactc caaagacgag     11820
     aaggcacaat tcttaaggaa tctacgtgat aggataactt gcaacgaaag ggaaaagtct     11880
     ctcttgtttg aaaccggatt tacaaaggat agaaacttta atggaagtgt ggaggaaagc     11940
     gcgataagcc tggaggtatt ggccttgtta gccacttcca agaaccaaga tatcagacag     12000
     ggagttaaag catgctcctc ccaagtcttt gaattcataa agctacagcc gttaccacct     12060
     tcctccatcc atatctccat gtttcgatcc ttcaggataa tcatatctga agtagaccag     12120
     gattcgtttt gcgacaaata cctgcctttt ttcttatctg tgattgaaat ggagcatcaa     12180
     tctttatgtc ttaattcgat taagaatgaa ataatcgaac tcttttatca gatgctaaag     12240
     atagacaaaa agatcaagtt caaacttaaa ggcagaaggt tcattaagat cttatgcagc     12300
     cctaacctta atggtataaa actcctcaac gaactaatga atgaagatgt gggaaaacat     12360
     attaagatga agcatttgct tgagagagta aacagctcca acataaataa caagttggag     12420
     gttctttcgt gctgtgccaa gttgtataag ctgaaccatt ctggagacac aagagttatg     12480
     gagagaatct tgtatgaatt gaacgaactt gtggagtata agaaggaatc tcttgtgctt     12540
     gtaggctcca tggttcaaga caacatccag ggacagctct tctgtaggga catagggctg     12600
     gtctccaaaa ttgcagacca gttccacgag ggccatccaa acttgttaac tcctgaactt     12660
     ctcttttgtt tacattccct gacggcagga cttgaggaga accgaaagat cattgccaaa     12720
     agcaaaataa ttcctagtgt ttttggagcc ttcaagcaga gggtaaatag aaagcaaata     12780
     gaccttgttt ttgtcatgat tgtcttactt ctgaaaagca tgacaaaaag cattacattt     12840
     cttcgatcgg atcttttgga ctatccggtt atagatctac tgatagctgt tttggatcac     12900
     aagtttccgg acactgtcga tggaatcgat agaatgatag cagaggaaga tctaaattca     12960
     ggatttgttg aggaaaacat tttgaatgtg ctggttaacc tggtcatgga atacggggac     13020
     tataaaaata agtttatagc atcgaatggg gtcgaaaagg ttctcaacta cacatccaag     13080
     tttccgcttg tagtcctaca aatctttaaa aactttctgt atgatactgg gttcaattca     13140
     aaggaagtct ttattaaggc aacagacaga agatttttca gtaaatttct tgatatgtac     13200
     gaagagagca gaaacacaga gatacttgag ggatgtttca atctgatgag aaatctcttg     13260
     tgtgatgaca ctcttgacta tattgtccaa agctacgagg gaatgattga ttcgatattt     13320
     ctttatctag atagatttgc caacgaaaca accgtatcag agaacagcag agaagagaat     13380
     gttctattgc agatactcta cactgtagtc aacctaagtg ccaactcaga taaattcaag     13440
     agcttagtgt tgaacaaaaa gcatttggat aatatgaaaa aggtgagcac aactagaaac     13500
     ctttcaattg cgtttatatg gattataata aacctgtcat ggaaagaaga tggatcagaa     13560
     aacagggttc agatcctctg cgacaatggc ataaaagagt ggctgatcaa aatacaggcc     13620
     aaggattcgg tgctagccga caagatagga actgcattgg aaaatttgag attaacatga     13680
     ctttctcggt tcctatatgc ttgaaaatag attaaccaaa taaatgataa ttttatgaag     13740
     tcagacgatc cttcttacaa tctcttctgt taacatttgt ttcattgcgt aagacagaag     13800
     tccaaaacag atgaaacaaa catcaatcta taaacctagt tgtgtgtttt tgttcaattc     13860
     aggaatgaat gtcggtttac gcagtttgta cttcattttc atttcgatgg cattcatgct     13920
     aatgaaatgc agatgtattc atcacagtca cagttacggc cacagcatgc ataatagaag     13980
     gtggcatcac agagacctaa gaggatggag acatcctgtg gtcgaaagga atgcttatgc     14040
     gtatagaaga cgaacaccgg cgtacaatgg tagagagatg ataacattag aggaactaag     14100
     gaagcctaat gttccaataa ttgttcctta tgaagtaacc cccaagcagg tactgaccct     14160
     tctaagacat taaaaaggct tatctttgaa aatgtaattt ataaaatgaa tcctattaaa     14220
     tagggaaaat ttattggaag ctattgttag ctttgcttgg atatataata ataaatccct     14280
     gatccttcag atgttccatc atgagaatgt cttcttcatt caacagtttt ttctccagtc     14340
     tttccccttc taggagactc ttagatctcg tattagctag gacattcatc atgcataaat     14400
     ttatagagag aatataacgg actattctca tttacttctc tgagcggaga cattttaaac     14460
     gattcaacaa cttaaactgt ttcaggtttt attaccaaga ccaagggaag attttgaaga     14520
     caatattatt ttgttttata gtgaaggatt gacatgtcca atagccttca ggcttacgag     14580
     cgaaagatca tatgggttta ttcataaaga ttccttctta ttattatagc taatcattgc     14640
     ttccaaccat ttaaaagctc gtgcaagagg tccggttatg ctattagcac ttccgcttgt     14700
     tatagtaacg tagaaaatct ttacaacctg tcccttttcc gggtcctcct gatcttcgat     14760
     tccagtctcc tgagcaagcc aggatttcca ttggtaatca gcctcggcag tttccggcgt     14820
     atgtccctca agatcgatct tattcataag tacaactatt ggtgcctttt tttccagagc     14880
     tcttacagtc tcatatgctt cttttacttc taaaaatctt tctacatcat gaacatcaac     14940
     tataaacaca attccgtggc aatcataaaa gtaatctctc catgcaagtc ttgctgctgt     15000
     atgccctcca agatcaataa cctgtgcctt caaatttcct atctctatat aggaagtgct     15060
     gggatgatga gtaggcatat agacatctgt tgaatcactt ttcaatttgt tcaccaaggt     15120
     ggtcttccct gcattgtcta taccaaggaa gagaatcgaa gaaggctttc caaagagaga     15180
     tttgatgaaa ttttgaaata ccttttcgta gaactcagta agcttgaatt tcacaagctc     15240
     aagatacccc tgtatgttac taaacattgt tgttttgttt ttttccgggg tttgtttttt     15300
     cgaatttata ttcttcagtc ttaaaaccgc acaggccctc ccatctatag agaccctatt     15360
     cctctgcatt cctggaaata caaatccccc atactttgtt cttttacttc ctcacggaat     15420
     tcttcttata taagaaatct aagctttcag aaagtggatt gtgaagtatt tctttatcga     15480
     tgtccatgaa atatgtcatg aaaaacaagg catcacatcc tttcaaatat ctttccagtt     15540
     ccttgagcac tggcactccg gctcctccat cgatgctagg gtcaaagtcg atctctatgc     15600
     aaaacacctt ctgcctaact actatgttca cagatccgta gaacttgagg tagaatcccc     15660
     tgaattgaaa gaatagccca tttggagtca tatgccaaga aaccaagtcc agcccggcta     15720
     attttattaa gagttgcctt aaagaaaatg gggatatata cactctgttc aatcttatgt     15780
     atccatcgat ctcaaacacg gtcaatacgt cttctagcct aggattctta agaagactat     15840
     ttatcttgtg aagaattcct tccattcagg gtccatcaca agagaaaaca ttaactctgg     15900
     acagggatta tttcatcttt aaaaggtatt caaattcttt ctattggata aagtcaattt     15960
     gttctccatt agaagtctat ataacgttga aacatccggt tttgctttaa ctacaacata     16020
     aaagaaaatt gttcggatcg acttatgaag ccattcctaa taattctttc tctgataaat     16080
     attacaagta ccgaaaccaa atccagagcc cattccttac gccacaaaag gtacaataat     16140
     aatcatctgt cacaaaatca cctccatcgg aaccacgact tttctcactc aacccataat     16200
     aagcccctca gtggaatagg aatatctgga ataaggagaa tctccccagt ttacttaccc     16260
     gggtatacaa gtccattagt agccgatgtg ggtggagatt ctggagagag tggggttata     16320
     ttggccccaa gtgctagcaa cggttctata aaagagaatg taggaatata tgtttctccg     16380
     tcccccaatg gacaagatac aaacaccaaa gaaaggctgg tttctctgca tcatctaata     16440
     catcatgcac agggagaagc actaaaggca aaagccatga gctccgctgc aaagctcgag     16500
     gccagtcaat taattgcctt gaagcaagaa ttaaatgcaa agataatggc taataaagcc     16560
     gagatgctac gggaagaaga agaaagactt gtctctcaaa gatcggcaga tcccttggtc     16620
     ttagtaaaag acaccgttcc gattgcaaat gtggcaaaca acaacttgag ttttgaacat     16680
     cataatgaac ttttatctca gaagcttaat atgataaaga aggatcagga tgatgcagta     16740
     aagaaggcag aaaaacttgc aaggttgcac aaggcaagaa cagaaattct cccagacagc     16800
     cttgtttctt ccgaccccga tcaatttaaa gaatttgtcg cggctggtcc tgtacaagat     16860
     ttaacctttg aaatcccggt cgatccatcg gttggaaatt actatatttc tggaaatccc     16920
     gaagggagcc tttcttctga ggggatgaac ttaacccaag gagatttgcc ctattttgtt     16980
     gcgcatcaag aaggctcggc ttatagttct tcctagttta taaaaaagaa ggcatctcta     17040
     gcttaggttc aaactaatta aaagtcgatt cttgtaatct atagctacat aagttgtgga     17100
     tattaaaatc taagagacca aaagctaatt tattacaaga gggtctagtc actactgcta     17160
     tcacaggact cttcgatatt attagatagg aaactagacc atgatttgtg ggtaggaatc     17220
     caatttttgt agagcctggc ctctaaagag ttctgagact ccctcagacc atatcctagt     17280
     gaattctggc gagccacaac cattctcaaa gtcaagtaga caagttgcat ctttcttttc     17340
     atgtattaga atgttgagca gttatccata atttttttat tcatctgtcg attcaaaaca     17400
     gttttatgga gagtcagatc aacgaaaagt tattggtacg gttagccgtt gattaggcac     17460
     gggtacatct tttagttaca ttaacatctc cgaatctgtc ttgttgaatt tctattttga     17520
     tattctcagt ctaatggatt attagaagaa tggttggaga ccctttcaaa gtgatggaca     17580
     ggacaaaagg aattctgaag gtggaaaacg tggaaattac aatggagggg caggtaatat     17640
     gtaggaacca aaaaatagaa gctgtgggtg tttatgggat ttctggactt tacaatgccc     17700
     ttcgagatgc tctgatggct tcactgacta ttcctgtcat ttctgacact agtctaaggt     17760
     tttatgggaa catttccttc gatggtagtc ctataagcta caaggaactt cggaagatga     17820
     tgaacctgtt taccatgttt tattcttgcg agagtgtcca aagttcactt gaatttgtaa     17880
     atttttctaa ggttaaggat gtgatgagtg cttttgaatt ggaagctata aatagttgtg     17940
     agctctcaaa gttagggatt tcggagtcta gaagatggga agcagcggtc aatgttgctt     18000
     cggggtcgaa ggtggttgtt cttcgaaatt tccattctcc ttacaagaat gtaagaaagt     18060
     atctgtcgtt tcttgttgaa catgcaagaa acaacgggtc tgtaatcttt gtggaggatg     18120
     actttccctt ggaacacggt ctgaatggat gtgttatcat aaaaaaagac ggctttgaat     18180
     gcgtgaattt ctctatagaa aaagaattct acagatacaa aagagtgtta cttgagatct     18240
     ttctgaagga gcttgaagta aagcagaatg atgagaaaga tgcaaaggaa tccaattcat     18300
     cggcatccat aaacgagagt tccgatggct cttgggatat ggccggaccg ttggggaaac     18360
     cggtagggtt ttccgctttt agaggaaatg ctttgaattc agataaatat attgaagact     18420
     cagagataga tttccatgga aacttcacag atcctagaat agtaatattt gatgatgcag     18480
     tagtctacaa gcttaaagac ccccaactct cttccaattc agaacaaaag atctcggatg     18540
     tctccaagac atacgatcgt ggaaatagct gttgctggat acgtaggata gaagaactat     18600
     ttacaaagtg gtttttttcg gtagacatca ggctttctct gctcttgaca agacgaaagt     18660
     gttttcttga ggaaaaaaag actaaagact tcaggaaatt catagtctca tttctgatgc     18720
     aagtgtattt ggcaataatt ttgaagttca agggatccat attcaatgat acaaccatat     18780
     tctcgatgct tagtactttt ctaaacccac tggaagtatc taaaagatgg gaaacttctg     18840
     tcgaagatct tatcaaaaga atactttcaa cgcctatctc taccatggtg cgatgctttg     18900
     tagattttcc tggtgtctgt ttttcactta tggggtctac attcagaaat accggtaagt     18960
     ttattgggca gataagatca tataattggg atctggtgga ttacaaaata atatcaacag     19020
     gagtgtattt tctggttttt acaagaggag gaaccatggt taacgaggaa agattccaga     19080
     actatagccg tagaaataga atttactcgc caggaacata cttctttcat atatttattt     19140
     atttatttct caaggcatgg attccggtcc tcctgatttc atatattctt aatttcaatt     19200
     ttgtccctgt ttttctcgta acagccactt ttacctgtgc tcttttgaat ttggtcttaa     19260
     acttaaagct caaatacatg ctcatgtgca tagctcttgc attcaactta ctgtatcctc     19320
     ttgatggaga gcactttcaa aaaagctttt ttcttagatc ttccgagtcg tttaatcttc     19380
     tggttgcatg caggcaattc ccattggcat cgtctccaag agaaaagctg atacttttgg     19440
     gctgtttact acgaggattt ctgtttatat atttcttctt ctgctacata tttgccaaaa     19500
     tcaatactta aaactagaca tgtgttgaga agattattcc gaaaaatcaa ttagaagaga     19560
     ttgattttat tattaagtgc ccaatctata tctcatttcg ccaataaatt atttaggatg     19620
     taaataaatg gccgttggga agaccaattt tccttgatta ctttttggaa aaggcaataa     19680
     gcttcttctc tgtaataagg agaacctgaa agcaaatttg tctacagaaa atttccaaaa     19740
     atggtatatt tacatataaa actataaata acttgaaaaa gataaaccca ttatgaacaa     19800
     gaagagtttt ttgaggatat ttatcattac aattcttgct ttgggcataa ctcttctagc     19860
     ctttttcctt cttagagaaa agcctctagg atacctcact gaggaagacg ttcaatcact     19920
     ttcaagtgaa cttcaattta gattcaaaga ttctgggaaa aacgaggatg gaaatgaggt     19980
     taccgacgtt aaattctttg tctgcctgaa tagcatccta aagttgttta attctgtaga     20040
     aatcagtctt attaacacct tcttgtccta tggagaaaaa agtagtaaag gggagaagaa     20100
     agaggaggag gactacaacc ataaaggatt atatgtaaag agtgcattac aagaggctag     20160
     aaatataatg ttcctgtccc caacctcgaa ggaggctata gtcgaaattt tgcagaagga     20220
     aaatgaaaag aagaaagaga gcgagctttt agatactgtc agaaaagcat tttccgaggt     20280
     tcaattatca ccggaggaag atgacgactc ttctaggcaa aagaaggagg agctcaataa     20340
     ggtgttggcc aacctcttta tttggttctg gttgaaggga acccctccag cggacaaaag     20400
     aattaatacc ttcaaagggg cttacgaaag caatcaagat attaagaaat atcttctgga     20460
     atatctagac gaggaaaaca aggaggttgc aaacgcaaca atatccgtta gtggagaaaa     20520
     cgaagtaata cccgtaattg atcatatact actttctata ttcaatgctt caatatacat     20580
     gggtcttgga ataagtccaa ccgacatacc tgcagcaaca gctattttag cagctggagg     20640
     aattctagaa aaggaaggtg aacaaatcaa aaaggggttt ttccagggac ttcaggattt     20700
     cttctttggt tcaccaaagc aggaacaatc cctccaacaa agcgagaaac tagagaaaaa     20760
     tgatgggtaa aaaacaccta caacaatcag catctttgag accaaaaata aatttttcat     20820
     tttgattcag ttttctaaca acctaggaag atcggataga aggagtcata aaggtgaact     20880
     gaacttctta attggcaggc atttttcgtt tatcctaagt cccttgaaag aatatcgcaa     20940
     aaacaggcat gagacagatg gttttccgtg ccaaaaacac aacatcctgg atttgtggtt     21000
     cctgtaaagg taggatatac accttaagtt tatagtatca gactgatatt ccccttaagg     21060
     aatattctgg aatataaatt gcagaaaaaa tatcaacccc gccatgaagt caaaaaaact     21120
     gggctttttg actcttattt ctcttgttgt ggtaggattt gtgacctggt atgttctgta     21180
     taatttatac tatctattta tgagtgatga aattgcaaat tcaatctttg ataagtcaaa     21240
     actcagaggt aagttcgagg acagcggaaa ggtcatagag ggaacggttt tcttcagttt     21300
     cctatacaag ttcttgacaa ctcttgacga gaaagttata ggcgattctt gcattgaaga     21360
     tgtttacgac aagagtatcc tttctgggaa agaagattat ttaaggaatg gacttgagat     21420
     ggtaactagg gctcttttca aaaataggaa cgttgaaaag gacttgaaag aaatattgga     21480
     atcaagtatt tccgatattg ttgctccaat caaaaggcat gaagttcagt atgcagagga     21540
     ggagggcaag aataatggtg aagaggacca aaagtataac gaagatgtta ctttaatggt     21600
     gtctaaggcc tttgtctata ttcttctccg ggaaagatta gatcactcca tgtacaagaa     21660
     atatcttgat aaggtaaagg acgacttcaa tgaaaataca aaggatcact tgaagaaaat     21720
     tggaattagt gaaagaatct atatttttga aggggaaagc aacgtaggca tggaaatata     21780
     cgattatatt cgtgttgtaa tgtttgcaac tagtaagctc atcccggatt ccttaactaa     21840
     aaactaatta aattattaag atccatttct gtgatgtttg atcatttaat taatgtttac     21900
     ttctccctta ttctaagaga gatgtcaaag gtactaacag agcgttcagc agcaatgacg     21960
     atggtagcgt ctatgctggg tgcaagcata tatttcacac caattgcatt tagatttgtt     22020
     ggatacattt acggatggat tatcatcttt ataattgctt cgctcacatc gttttccctg     22080
     tactgcatct catactctgc aataaagatc gggaaaggcc agacatattc gtcgctgggg     22140
     gtttatatat ctccaagact taagcatgtc cttgatgggt ttgtcattgt aaatagcttg     22200
     tctgctaatg tctgtcttta cagatatctt tccgagctgg ttgtggcagc cttccccgag     22260
     ctgctgctta cttcctttag ctatgaaact accagaaaag gaattgtggc cgttctctta     22320
     attccctttt tcgctctttc ctcccataaa aacctttcca gcctcagata cgtatcgctt     22380
     gcaatggttg tttccattgg atattttatc tttcttctaa tctcctacaa tctttttcta     22440
     tatcccaagt atacctccta cgaggaaaca tctttccctc tctccaatgg attttctttt     22500
     tcgattccca ttttcataac agcaatggca tgccaatcga atatggtaaa ggttctggac     22560
     gagatggcaa gtgactccat gaggaaggtt aagcttgtgt ctgtgtggag tggtgtcggt     22620
     ggaggactaa tctacggact gatagggcat cttggatatt ctctctttgg aaacacactc     22680
     aatggggatt tgctaaggat acttgcagac aagggttctt caattaatat ccaattagca     22740
     agtactgtcg acaagtatct catatcctca agagtagcag tgtatggatg catcttgata     22800
     tttatcggaa gctttccaat ccaattgaat ccactgataa ctactttatt caacattctg     22860
     cccgaggaga gaagaacaaa cactacccgg atgtttctaa tggctgccct gatcatgctt     22920
     tgcttttttc tagtcctggt tgaggatttg tctgcaggac ttgtgataag cataggaggt     22980
     gcaacagtaa caaacttcat atcatttctc tttccattta tttttttcat atcagtgaga     23040
     aaaagattct ccctcagtac atttctggct ctagtttgca ttgcggcttg tgtttccagc     23100
     tcggtctaca tgttagctaa tatagtaact ggaaggaata agatcatgta aatccaattt     23160
     cttaataaat gaaatcagat ctattaggaa atatataatt atagacactc tctctagctt     23220
     ctaacagcag aaggctctct gaccaatatc ttttttggtc ttccaggacc acgcttaagc     23280
     aagttccgat ccgactggca cttcaccggt agatcggcca ctggtattat atccttgagg     23340
     tcctgaagtc ttgtctttga ataaagatcg ctaacataca agtatggatc ctctccagaa     23400
     tcaagtattt ttttgcaagc atgtgggcac ggaattagaa actcctggaa cttcccacac     23460
     gtacatgtct gattctgtaa atcaacatcg tagaaagtat ccgctgtttc tacagacgtg     23520
     ttcttctcta ttcttcgtat aacattgttt ccgaacaacc cctttccttt cccttctcca     23580
     aagctagcct tttttctttg gctcagattg tcactggaaa gttttagaat cgcacagaca     23640
     caatcaaaaa acggaagatt gaagattccc agcccaataa actctgcatc acactcactt     23700
     gtattctgca tcccaagcat ctccgtttcg cagcagctct tcaagtagtg ttttctttcc     23760
     ataaagttga gctctggtgt gctccattcc ttggaggtgt tacatttgtt ccagatgtct     23820
     tctacaccat caatagactt atttttgttg tagtaaaact tgcatatatc acgggttttc     23880
     acaaaaaaat ccctctcctt tctcctgaga atgtttataa gctcgcaatc aaagtccaca     23940
     aggaagaata atttaggcat tgaatcaata aaatactcaa atgtgctttc tcgacttccc     24000
     gtgtccgaca ccgcgcagga gtaaacaata ggtgaccatg taggatctcg gagaactccc     24060
     agcatcgcaa atccctccgt tctcttgtat attcttatct ccactattgg aacaagtaca     24120
     tcaagatatt cgggaaaaga gaaaaaaaac atctttttct tctgatgagc aactgcacaa     24180
     ggattaagct ccaagaactc ttgggaaaac tccttgagtg cccggccaaa cagctcatcc     24240
     tttcctccct cttctccgca gatcatctcc atattctcct tttctgtctt atcattttgt     24300
     ctcatggcct tccatacaga aaagtatccc atctttatgt tcatgtccgc caaaacagat     24360
     agaatctccc ctattcttgc atatctatct cctatagctt tctgaacctc cattcgaacc     24420
     atttcatccg gcgatccgta tttggatgtt actaccgggc atttatggga cagtctaatc     24480
     cttttaacta caaacacccc atccttcttc ctcaactgtg caacaattct ggcatcacat     24540
     ccaaattcct ctcttccctt acacagcaca gaaatcgatt tgggcgtctc ctcaagatca     24600
     tagttgagat tgtttcgcac tgcgtgatct attaaagcct tctcagcctc ttctcttgtg     24660
     gaaagtatgt cattaacgga cagccctttc attaaggggt ttgttattca acagctttta     24720
     ttctttacaa cagacagatg ggctatagct ttgtttctca gcctcccaga aacaccaaca     24780
     ataatgccat taggacttcc taaagacgct catacttatt tttgtcccta tccttcccct     24840
     ttgagcagta tatgcagcat attttactct tcttctttcc taatccctca ttgtcaacag     24900
     tttcctttgt ccaagtcaca cgccttgttt ttatcagctt tagcttcatc ttggttactg     24960
     tcactgtgct tgacatatcc tagggtttgt tttctataga atataaatgg atcaaagcta     25020
     cccataacca tccttcttat tacacattgt ctagccgtaa gtgcactaat gtgttgtagc     25080
     tataccattc cagtccattt ctttattaaa caaaaaatta cccacgaaat gagagagtac     25140
     aggctgaagt cagtaattcc aacggaatcc gaatcaaggg gactttacta tgatggagaa     25200
     gtctattttt cgtccaataa tcatctattc aaggcttcca ggggaagata taccaagata     25260
     tgtgatgttg ggggaaccat cattgacttc agtatatcag agaaattctt catagtcaca     25320
     gaggaaagga tgtacatgaa taacgaaaac agaatggttg gatctctcaa aagaaggttt     25380
     tcctgcatgg caatcaacaa aaatctgatg gcagcaggat actccaacgt cctagagata     25440
     tggaatgttc ctaaggaatt caagttgccc ttgtttgatc tccattcaag acatcttggg     25500
     cactttctag aaatcacaag tgttaagttc ctgagcgata atctggttct aacaaccagc     25560
     agagactgca ctgtaaggat ttttgatatt cttgaaaaca aatctagccg actgtgcaat     25620
     acaatgagtg ttccaatcgc ggcatatacc atgggtggag aaaataagga gctaattgtt     25680
     atttgcgagg atggaacttt attgtatttt gagattgatg gagaaaacat tatttccaaa     25740
     ggaattgtgc atcacaattc gaaagttttg gcttccagta gtagtttagg ctttgtggct     25800
     atttcccttg ataaggagtc tggagagaat ctgcttatct acaatggaca agaaatggtt     25860
     tactctgcat cagtagaaca taagattctg agtatttatc tccatgagga ttctattgca     25920
     gtgaagggcc ctaagtttgt tggaatatac agcctatcac tcaacctgtt tgtatttgag     25980
     ttggatcttc cccgaataat gacgatggat gtaaaaaagg atatgatagc tgttggatgc     26040
     tctgacaaga aggtaagaat ctacgatgga gaaagatgca tccacacatt cttcgactca     26100
     aatgccactc atgcagtttt cggagtgcat attcttcaaa actctgttct gtgtctttat     26160
     ctcgatggaa aagtatctat ttgggatata aagaacggaa tttgctatag atcatttgaa     26220
     attccagtaa gaatatcggc ttcagaggtt agtgatgata atcttctact gtttattgca     26280
     gacttcaata actattcagt aagggtgata gatctccaga gggggaagga gattgatact     26340
     cttcagggcc atgaaggtcc tatatttagg atgaaatggg atggggattc tttatataca     26400
     ctgtcctatg acaacacaat caaaaaatgg aatgtttatt cccaaacggt tactgaactg     26460
     cagtccagaa agatggccac tggattttca gtgagaaatg gcaagctctg tgtggccacg     26520
     gtggacgagt taagtatcta tgactctggc ttcaattatg aaagaggaat caaggtatct     26580
     ttaaaggcta gaaagagaaa tgaaatattc ataagcgaga agcctgtgga aagcctagat     26640
     ttcacattcg acaacagatt tataatctcg ggaggagaag caaatacaat gcagatgata     26700
     tccacagaaa caggcgacgt tgctcaggtg cttcgagttt ccgacaatag agaatgggaa     26760
     aactataaag aagttcttgg gaaggaatct tctaaatcct ttgataagac aaagatcatt     26820
     gaggttttaa aaataatgca cagcagcacc caaagggagt tctatgtcct tacacgagag     26880
     ggagtaagca tctatgaacc ttcgcttgtc aaatttattc cacttcgctt agatgtgtct     26940
     ttaacaccag agtcgatcaa agagtatttg gaccatggag aatacttgaa agcagcaata     27000
     ggatctttga agatcaacga atacgagatt gtaaaagagg ttttgctttc ttgtccatac     27060
     aaccgaatag agggggttgt taagcatttg gatgcagtat tggccgaaaa tctaaggctt     27120
     gtagtatcaa aaatgcttga tagcccaatc caccattcga cagcaatcaa atggctgaag     27180
     tccattgttt tttattttgg gtcgtctaaa acacaaggca cagaactgca taaacttagg     27240
     agagaaattg acttgacact aaaaataggc aagttgaaca agtcaatgct gctcaatatc     27300
     atcgagaaat gactttctaa acactatcgt acaatatgat tggtcaatag aatgcctgtc     27360
     aaccagtgga gtcgaagatt ttcaaggtaa aaagaatatt aaagaaagag acaaatttcg     27420
     aaatgtgttg cggcaatttt tactgcttta cgtttggatg catcagtata ccggaaaaga     27480
     tcgacgtccc agagggatat ccagaacctg caaagaagtt cctgtgtccc tactgcggat     27540
     gcttaaccga ttctgtatat aggaaagaca aatacttttt tagcatatgt tttattccat     27600
     gtatcccgtg taaagagagt tctccatatc tctcctgcac tagttgtaaa agaaatctgg     27660
     ggagtattgg agactacaga tgtaagaaat gtggagtggc cacaaccttc gaatcaaata     27720
     attgccctaa ctgcggagga gaaaaaaccc agtcaagtgg cggatacaga agactggaca     27780
     tggtctaagt aggcaattaa gataattgat taaaggtttt attgtcttgc tcgttttctc     27840
     gagccttgcc tgcaaagggg cttaattctt ctgtagaatg tctatcagcg tccttatggt     27900
     ccccaccaag gctgcacttg taaatatcat tgcgaggatg cagacggctg taaagaactt     27960
     aatcttctta gatgcaaaga tatagcatat gaacgggtga tatactagca gaggagtcat     28020
     tccaatcaca aaaagcacca catagaaatg gaaaggcccg atgatctcgt tgaaaaggac     28080
     ctggatgaac actatgctta gcacaaggag agataatagc cacaacctgg tgtctccttc     28140
     tgcattcacc aagtttttaa aagactcaac aaaagaatca aattgtatca caaataacga     28200
     aatgcatact attggaataa gaatgcacat cactttggtt gtgatacaat acttatcaat     28260
     tgtagatgtc ctcaggtagg tgttcaactt tgatgaccta aggaacataa gattcagaat     28320
     gtccaacgag ttgtagctag atcttatcca ccttgccaag tgtaatagaa ctaaatacat     28380
     tccagagaca gacaatgagc tcgtaatagc aacgtatttg gcactttccc tatgcatgga     28440
     ttcccctatg attttgactc ctccagatat gaactccgcc gtataaaatg ctatggtggt     28500
     tacccaaaag aacgacggta ggaggcttcc ttgagaatat gatggctttg gaagtgccga     28560
     gtttattcct aggaagtacc ctgcgattat ggcaactata aaaaggatac tggccgatgc     28620
     agagataata agaaatatct tcctactgaa ggtggaaaag acatatagag tcagccccac     28680
     cagtgccaat cctaacccaa ataatatctt gtatatagcc atcgactttc tgatttcgtc     28740
     caggaaggga aagtagataa acagtacgtt gaaaaagacg tccactgtga taagaagtgt     28800
     tgtgtatttc aaaacagcag aaaacacatc aacagttttc gacaagggcc cgcaaaatcc     28860
     cctcgaaata tctcccaagg acttcaactt ctcttcgctt ctctttttcc ctatgtactc     28920
     cactatgtat agagatagtc ccataagtat tccagatgca attattccgt aggtatagta     28980
     ttctgttttt actccttttg taaagtatgt caaggacaag aacacgggaa ttataggtga     29040
     ggtcccaatt atcttgtaag actgcccaag tgtagagcaa agacgatttc ttggttcttc     29100
     catgtgttta ttcggcgaaa acaataataa gaaaaacatg aaacacgtgt cactagttca     29160
     acctctctgc ggtttcagaa gcttccaatc ttggagccct tttttggatt agatatcaga     29220
     agtaaaacga tcagatttgg ttcatctttc aaagatggta aatccaagaa gggtagagta     29280
     aatcccatcg atggaatccg agtacttctc tgtaaccttg tagaccttat ccaagacttc     29340
     actgctcatt ttccatcctc ttctaaggct ctcctctata agccattgta tgacaacaca     29400
     gttcttgaat gtcccttgtt ttagaataag gtcaaagaac attttatgct tgtcttcaaa     29460
     aatagtgaaa atttcgttgg atctttctct atggcacctc actatcattc taaataattg     29520
     tttgtaatcg tctgtcctag agagtatttc aacagctttg acattaagat tatttcgaag     29580
     gcatctttcc agctcgatgg tttgcatttc cttttcattc ttctttgcaa tggtcctgtt     29640
     taacacttcc tgagagtcgt cttgaaaaaa agctattagt ccgtttccag atgttatgag     29700
     aagggatcca ctgataaagg cccatacccg gtctctgtga acatcaatgt tcatttcaca     29760
     tgttctcttt ttaacattcc aaactttcat ttccccagta gcacatccgg aaataaacct     29820
     ttcgtcattt ctgtagaact gccccttcag aacagcgctt ctgtgtgctg taagcacccc     29880
     aacacactca aaagtctcta tatcccaaat ccttactgtg gtatctgcag aacatgttgc     29940
     catcagattt ttgccaaaac tcacactcca tacacccttt gtgtgccccg aaagcacctg     30000
     aaggattctt ccttcaaagt taaaaacctt tgccttctta tcttgggaac atgttgcaat     30060
     gagtcttctt tcctcgttga tttcaacact gttaatctcc ttgtcatgga ttctttccat     30120
     gaacacatta tctttgtagt cccatatctg cagaatctga tcgcttccaa caagtacaaa     30180
     aatagaagct ccaagaacac atccgttgag tcctccaaga ccattctcaa gtgtcttaat     30240
     tctcttcaaa accacacttt tctcttctct gttttctgta tctttcaaaa caatcttcca     30300
     aagaatggct ttcttgtctc ttgaggttgt catcaagaag tttccattga ttgagagtga     30360
     cataatggct tccgaatgtg ctggaacaat atctccattg aatgcatagc ttccttctcc     30420
     cccatctaca aatgtgtatc tcaaccttcc actatttgtg gcaacaaaca gtacgtcatt     30480
     ccacttcttc atgtccgtta tctcatcatt attcccaata ataacagaag taaccctcaa     30540
     actttcgtca acaagaaata tttcctgctc gcttgttact ataaccccct gagacatccc     30600
     ttcaacaatc acctcatcgt ccactttgat ttcttcttcc accacagtat ttctcatatc     30660
     agaaacatgt tttcttttct tgtatccgtc atctgttcca ctttcgtctt cgtagcaatc     30720
     gtcactgttc tctccgtaaa tctcacaccg ttcttttcca tttggaaacc cattctcttc     30780
     actctcgtct tcaaaacttc catcttcttt cctaaaccga agcatactct gcgatgatcc     30840
     ttctctttcc gcgagaatgt cccttttata ttgaatcttt ccatcatagt catatacatg     30900
     gactattaag cctttccata tatacaaaaa ctgcccatct cctaccataa agtcacactt     30960
     tgtgtccaat gccaccttct tagacttttc caagatcttt aaaacccctt ctcgcgtgac     31020
     tgcacaaaca tggcgtccat tatatcctat tcccactacc tccggctcat gatacttcaa     31080
     aagctcttct cctcctttat aaatccacac ctcattagca tctgcagaac acaccatatt     31140
     tccaaacctt tctagctttc ttatcatgct gtccattcta taagaccata aaggtgcctt     31200
     gctaaccaga tctatcttgg aaacggatcc gtcaaccctt ccgaccacaa cagaaaaggc     31260
     actaaatcct tcatcagaaa ccactagctc atccacaacc atactgcaca cctctatttt     31320
     tgaaaactga acaacatctt ctacaactcc ctttgcaaga ttatagataa ctatcccttt     31380
     cgaacatgca actatgtatc catcccttac atcaaagcac ttgagggaat caaacggtat     31440
     ttctctaaga atttggaatg tcttaacatc agtctccact attagatcat tgaattgtgt     31500
     atacaatatg tctccttgtc tctttggaac tcctgttgtt agtattggct tcatctgttt     31560
     cttcaaatta aaatgcacct tcatatgctt cttcagtggg ctagaaaata tttctgaaat     31620
     tcaaccgcga actacctcat tgttgaaagc cctttcctaa ccttctttca tgcaccggat     31680
     gaatctaaac cgatcaaata ggaggaagat ggcattgtta tatttgtaga aaatattgct     31740
     ttctgcgctt tgaatgtctt ctaggacata gatcagatca tgtcctttga aagcctcgta     31800
     tatttcctcc ctacacttgg aaacatcgta cacaacaaaa acttcttttt tcacaccaac     31860
     gaacagcttg tgcaccagcg gaatctttcc acaaaagtca aaaacagcta tagtcacacc     31920
     catcctcttt atatcctcca tttgcattct aatctccttt aatttcaaaa tttcaacaac     31980
     tctttcgaca tagtattcat atatgtccac cggtttcata gggactatta cagcttcaaa     32040
     tatctccttg ccgtctttta tacccctttg tccccatccc tagatgattc ctattctcta     32100
     tggctcccaa actggaactt ctatctatgt cagcaacctc atagaaagag cacttttgta     32160
     cggatacgac ccaaaaacaa tttacaacct ggattgcttt ttcaactccc gagatcagga     32220
     aaacctatcg tcagtaatgg aaatggatct ctttgatata gaaaaaattc ttgacataga     32280
     ctttatcata tttgtttgtt caacacatgg tgatggaaca gagccattta acatgactaa     32340
     gttctggtct tttctgtcaa atagtgatct accaggcaat ctattgtcgc atttaaactt     32400
     tgcagtcttt ggccttggag actcttcgta tgaaaagttc aactactgct ccaaaaaact     32460
     ctttaacaga ctcaggatgc tgggtgcaaa gcctgtggta agaagaggag atggaaatgc     32520
     ccaggataaa gagggatttc tctctgatct tcgcccgtgg ctactagaac tcatggctca     32580
     ttttgatcct ctcaagataa agcacattga tattctctct cttaagcctg agaaatatac     32640
     ctcgagattg gttgggaaga gattgctgac acccgaaggg catttccaaa agataataga     32700
     attggtattt gaaattccag aatataaaga attctcgccg ggagattgcc tgtccttttg     32760
     cccagaaaat tataactaca aagagtttat gaaatacaac ggcatggaag aagatgtaga     32820
     tgggatatca tcgtccttaa tgatgaagca ttcaatagac tttaactcac aacctcatca     32880
     gccattcttt tttgcactga ggtatttctt ggatagaaaa ggcggtatcg aagacgaagt     32940
     tcttttaaag atagaagaga ttgcacaaga ctatgattta tattatgaat atatagttaa     33000
     gcccaaaaga acaatattcg aggttctcca ggagttaaga gtgaaggttg atgccaggtt     33060
     tctcaagaaa tttgtaccta ctatataccc aaggtttttc tctgtaacaa agaagaaagg     33120
     tctatatcat gttactgttg ctgttgtaaa ttacaagact atcctttctc aacctcgaag     33180
     gggagtctgc tcggaatatt tgatgggcct cagtctaaac gataaagtcc ccataggaat     33240
     tggaagaagc aatctatact ttggatccaa caagctattg tttatatgca cgggtactgg     33300
     gataacttta ccaagagctt gtatcaacga gtttaaagac aaagaaattg ttgtgtttta     33360
     cggattccga tacagagata gagacttcct atattccgac gaatggaatt gcaagaatgt     33420
     gagaatgctt actgctgcat ccagagatga taagatgtat gtgcaggatg ttttcaatag     33480
     aaaccccatt gaagacattg acgagtattt aatatttgtg agtgggaatt caagattaaa     33540
     caaggaggtg aggaaattgt tccagaagtt gtatggaaga acaattgcat tccagtctga     33600
     aacatggtga gtctttccct tgattctcct gtaggtttag tgtcggtagt aaaagcaaaa     33660
     atttgcatca ccccaagaaa tggtaagtga acaatcatgg aattgatcta acttttaggc     33720
     aatacaacca ccaggatcat atccacaagg gaacaagaag ggaaaagcca aaaagaaggc     33780
     tgggcaaaat acatttgaaa ggaaggagtg gtataacctc cgatctccat cgatttttcc     33840
     ctgcaatatc agtggaaaga cctttgtagc aaagtccacg agcaagaata ccaatttgaa     33900
     gcttatagga aggaggtatg acgttaacca tgcagacctt acgaaaaaca atgatttcac     33960
     acatcggaaa ttcatattca aggtagggga tgtcaagggg gccgattgca ttggattctt     34020
     tgatggaatg gagttaacat ctgataagca caaagcaatg atcaagaaat ggcatactct     34080
     tatcgaagct caaaaggaca ttgtggcaaa ggaccggagc gttttcagag tgtttgtcat     34140
     ggcagttacg aggaggccgc aagggtatac caagaagaca tgttatgtca agcattccga     34200
     agagaaaaag atcagaaaga ttatgtttga tgtcattgag caggagcttg gaggacgtag     34260
     tgttgatgaa atcatgaaca agctttctaa cgagacagtt ggaaagagga ttgaagagtt     34320
     ggggagcgag atattcccct tgcaaaactg ctgcgttaga aaggtcaaga caatcaagag     34380
     ctatcaagga gtaagtattg gccaagagga ggaagttgga gccatagcta attaaagcat     34440
     tcttttttcc ttttcggccg atatttcagt gtgtctaaat agaaagaagc cttgaaaatc     34500
     accaccgtgt tgtttaatcc tcgtctatat ccccaagccc cagatctttc agcttctgcc     34560
     tcaccttctc ataggtgtcg tcggggtttt tgacggttat tccatggaca tccttatgga     34620
     tgtagatttc gtagtcgttt cctccctctt gggtcatatc cccgaagaaa tacacattct     34680
     caattccctc cttctttatg tgcctcagac agtatgtctt gtcccagccc tttgggaagc     34740
     agtcaattga tatctgtcct ccaatcgaga acaccataca gctacctttg aatttttccc     34800
     tcatggctgc aaccatcttt tctcggaatt tctccttctt atcaatctca aaaaactcct     34860
     tgcgctcctc cctactgcaa ttccttccta tcgggcttat gttaatcatg gagttcctat     34920
     attcaatgaa gttacccctt tttatgggaa tttccagctt gctaagatac tctaggacaa     34980
     agttgacaaa ctctttgtaa aatttctccc caaggacatc gattatcttt tcctgagact     35040
     ccagagcccc tttcttgtag aagctgagac cgttttctgg aaatccataa tcaaatagct     35100
     caagaagatc gtctccaatt tgctcctttt gcttttcaag gtctgatccc cccacaaacc     35160
     ccaggcaaac cttcttctta agtttcctta ccatcttctt cattttctca gtcatctgag     35220
     cccttgattc cgaaagcgtt ccgtccacat caaacaaaaa gattgtcttc tcgtcttttg     35280
     ccatggtcca tttcgtttgc attcctttta ttacattttg tttcagatgt ttaattcatt     35340
     aatgggtatg tcaatcaaaa atcattggaa atattccaat aggtcctggt cttcgaagaa     35400
     ggcacaaaca caactcaaga ttgatttcta tactctaaag gaagctttac ttttattgtt     35460
     caatagactc ggaagaaata cactccaaaa tggaatcgta tcccttatct tcatagcata     35520
     ttctgtacac agtgcttatg agaggaaact catcagttct cttttgtctt ttcaggtaat     35580
     tgtatacaat aagagctgtg tttggcccct ggagctttgt aaaacacatg gtgtcctcgg     35640
     cctcttttaa gctcattctt ttttctgcca taagctttgc acatttgaag tttcttcccg     35700
     aaatgcatga tacaagaaga tcccccactc cagatgactg aaacagggac tctattgttg     35760
     ccatcgggta gaaaaatttg aagaactttc tcatttcggc aaatccgttc ctgaatatgg     35820
     cgacctttgt attgcagcag taacctagtc cttctgcaaa gccatatccc atggaaacaa     35880
     tgtttttcaa ggctccagag atttccactc catagacatc cttgattttt gtgatcctgt     35940
     atgtgtaact attaaagagt ttgtaaacta tgtcggctgc atcctcatct gtatacccca     36000
     atgtcccttc gcttatcatg tctcgtgcaa cttggtcggc gatatttgct cccatcacca     36060
     cgcttacatt tatgtttaga atcctgtgaa tagacctact caccagatct atgtctccat     36120
     cttctgcgcc aataaatcct tttgtcaacg acaccccaat gcagttgctc ttcaccaatc     36180
     cctttaaagg ttctatggcc tttatatatt gatggggaag agcaaaaaca agcacatccg     36240
     agtcagaaag ggtgcatatg tcttcaacag ccttaaggtt ctcgggaaga tggattcctg     36300
     gcaagtactt cggattgttt ctctcgctgt ttataatgtc gcttaggatt ctcccctcaa     36360
     attcctctct atatccccac atcctgacgt ccttttcaaa tatgctgctt tccatcgtgt     36420
     tgcttgccag aagcctgcct attgcagtgc cccagtttcc attacctatg atagaaacct     36480
     tcttggacat tgtattattt gtttttgggg tacaagttat tttgttaaat atccttccat     36540
     agctctgttt cacagtcttg gcaagttcgc aactttcata cacttgagca gagtctttct     36600
     taaattcctt tagaataccc tctccaatgg caagcacaag gaaggtggaa gtaaactatg     36660
     tgggaaacac tcgcaacaca atagaattga agatcgatgg agagacacac acactaggaa     36720
     gtcttctttc ggaggagctt ctcgaagaca agagatgcct cttcagtgca tatagggttg     36780
     agcatcctac cgacaatcat gtcttccttc gcattacagc agacaaggat tgtcaagtaa     36840
     aagacttact cctggagaca cttaagagaa tcgaggaaga tactgtatta ttgataagtc     36900
     aactcaaagg attctaaaaa gacagaccat cctatttatt cgataataaa ccagtagatt     36960
     ttgtccaaga tactttataa caagtttcaa gctaaagaga aggatcataa tcgcctgcct     37020
     ccctgatgtt tggggttatg atttcgcaaa cagccatttc ccctatctcg tctcctttct     37080
     catatacaaa ttcctcgtcc gagtcattgt agacaataac acatacctct cctctgtaat     37140
     cgctatccac aactcctccc aacttcttta tccttgttga ctggattttt ccaaagtatc     37200
     tctttgggat cttcatcatg aatccagcag gaatctttgc tccacatcgt gggtcaactt     37260
     tacccgagca attcgagtaa agcttgtaaa ccccatttat aagctccggt acctttgctc     37320
     catctagaac tttcaccgag aaaccctctt cttccatgtg ggattaacga gaaaaagata     37380
     ttttatcccg gaacattttt ttctggcttt tgatagaaag aatttgttta ttcaataaca     37440
     atttcatcct ctcttactcc aacgtcccag ttggttttga ttagatatgg atctgatatg     37500
     tgaactcctt ggctgtcggc atatccaatc tgcacctcat tcgacgcatt acagtcccta     37560
     taacaaagaa tctccatggc ctcctcaaca agacggattg cctcctctct tgttatctct     37620
     tgttctcttc cttctacctt actcctaaga aacggaagag ccagatagct tcctattcct     37680
     gtacatatta catccgaaaa gtagaagttc cccagacgat ctacacatcc aagtgtcttc     37740
     tcattggtct caaattcctc ctcggagttt cttactgtct tcactcctcc cacacagaca     37800
     cttagattta acgggctgat cctacttcgg gctgaatata gtattctttg aaccattttg     37860
     tgataaccct ttggatctat ttctctgttg tcctcctctg tcaggatatt taatgttttt     37920
     atcaagtact gcatatcact cacctccccg gaaattccca cgagtgtcct gcttccaaat     37980
     ttaaacatcc tctgaacccc attgaacttt gttaggcgcc cgtaagatgc cttggcgtct     38040
     gctcccatta tgattccatc cttatatctg aatgagacca cagaggttcc tgttacaaaa     38100
     tccctcattt ccggggcatt tctaaggaac ttcataacat tccgatgttt atggtttgga     38160
     atcagggact aaacaccctt caaagggacc tgaacaaagg aatccttctc aataagacat     38220
     cccttctcga tggaaataaa aagattgccc aacgacgtga tttccaggat ttctgcagga     38280
     gaagtcatta caagacccta caacatccta aaagaagtca tagaaaattc actcgatgca     38340
     aactccactc acatagcaat taagattggg atagatggcc tttcccttac aatcgaggac     38400
     aatggagatg gaatacatga agaggacttt gaacttcttt gcaagcagta ctgcacctcg     38460
     aagcttacca aagaagaaga tcttttttcg ctgtcttcct atgggtttcg tggggaggct     38520
     ctttcctcca taagccgatg ttctaggatc cgagtcagga gcaagagaag agaaaatgaa     38580
     attggacatg aagctgtgta ccgggacaca gaaattgtag caataaaagg cattggaatg     38640
     aaggacgggt ctgttgttga aatcaaagac atcttctaca ataataaggc aagggaaaag     38700
     catttttcaa agaagagaga tgagattcga gaaatgatgt ggctagttgg aatatattct     38760
     gtattcaacg aagatgtttc ttttgatctg ttttatggag gaaagctaca ggaaattcca     38820
     aagtccaaga tgtattctgg gaaggacgga agttctaacg aagatagagt aaaaatgaag     38880
     atcaagatgt tggatgagct ttataaggta gatggggagc ttctcttttt gtttgatgaa     38940
     ggccatcttg ctatattttc aactcctcaa ttcagtctaa aaaaaggtgt gtttattctt     39000
     tttgtgaatg gaagattggt tgtaagccaa gagatgaaag aagctttatt taaggtgtat     39060
     aggggcctaa tttccgacga aagacaacct tttatatatc tagagctgaa tatagaaaag     39120
     agtatggtcg atgtcaacat tcatccgagc aaaagggaag ttctctttac aaatgaggaa     39180
     tctgtaattc agaggctata cgaatgcatt gaaaacaaac tgaacaagat gaattacgag     39240
     caaaagacat tgaggccgct tccaagggaa agtagcttcc aaagcccaat taaagtgtat     39300
     tcagacccag catcccaatc tattggcgag tgtttggaga aggagaaaac ggaaagacga     39360
     gagttcagtc ttttttctct taaaaagctg aggacagaga tagttgagct tgattcctcc     39420
     ttttttaagg cactaaacta tgttggagcg aaggatagag atactatttt ggttcagcat     39480
     ggctcatcac ttttaaactg caggactgct ctgcttctca aggaatatct ttaccaaact     39540
     ctgataagcg atttcgggaa cttcgaaaaa aagaagacgc ttattccaat tgaatcggat     39600
     atagaagata atatgagagc gttactcaac gactacttct ctatagagat agttgaaagg     39660
     aatattgtca gcgttcctat aatatcaact atttgtatag acctccctac gttatgggcc     39720
     ggattggatg tcaaaaaaga ctctgagtac gagacattga aaaatattat caacaccata     39780
     tctacgcttt actcctcggc ggaaatgtct ccaaagcttt ttaacgtcat taaaagaaag     39840
     attgttggaa cagaaaaggc attggagtgt ttcggacttg tggtgacact caaggaactc     39900
     tacaagaact tcgaaagatg ctgagtgttg gatggaaaca aaagttggaa aacattaaaa     39960
     attttggacc ttaatatgaa ttagccaatc taggaaggat ataacctcgg aagtgcggtc     40020
     cccttacaaa tgaacaaagg agaatatgaa gcattataca agagatctat tgaagacaag     40080
     gaaagttttt gggaagagca ggccaaggcc ttcttgaaat gggacaaaat gtttgataag     40140
     gtttataaca ataattttga gagctccaga tggtttgagg gagggatgct aaatgcgtgc     40200
     tataattgtg tggatagaca cgcagcttgt aatcccgaca aagttgcaat tatttatgat     40260
     aggaatgacg gagagtcgat ttgctataca tttaaagagg tgcttgacga ggtcataaga     40320
     atttcggctg tgcttaaagc agaaggcctt aaaaaaggag acactgttgc tttgtatatg     40380
     gcaatgtctc cttatgctgt gttttctgca cttgcatgtg caagacttgg ccttgttcat     40440
     aatgccattt ttggaggctt tagtgcaagt agcgtggctc tgcggcttga cgactcaaac     40500
     gccaagttct tgatggtcca ggatgttgtt gagagacaca gctcgaccat aaacttcctt     40560
     gggaatgtaa gggaagccct taagggaaga tccattcctg ttttggtttt caatactctt     40620
     caggatgaaa agaagatact ggacgaactg aacggagttg aaggtaagat tttaatctgg     40680
     tcaaaggtca tgaagaggga aaacgaattt attccctgtg tgcctgtcgg agccgaggat     40740
     agtcttttct atctgtacac aagtggaagt acaggaattc caaaggggat tgtgcatacg     40800
     gtaggaggat acctagtgta tgcagctctt acttccaaga catgttttga ccttcgaaaa     40860
     gaagatgttt ttgcttgcac agcagacata ggatggatta caggccatac atatgtaatt     40920
     tatggcccgc tgttgaatgg ggtcacaaca gttgtgtttg gggggacgcc gttctatcct     40980
     tcgtacttca gacttttcaa aatggttgaa aaacacaaga taacacagct gtatacagct     41040
     ccaactgtaa tcaggacatt aaggaagtat ttttcgacga atccgctgga tcatgggtgc     41100
     gatctgtctt cattacgaat tcttggttct gtcggagagc ctataaacaa gaatgcttac     41160
     ctatggttta aggaaaactt taacaagtgc tccattgtcg atacttattg gcaaactgaa     41220
     tctggaggga ttctgattgc tcctattcca tatgttgttg acggaaagcc tgaatgtgca     41280
     tgccttccat ttttgggcca ggaagttgtt attgcaggca aggattcgaa agaggatcat     41340
     gttattgaag caaaacctta tgagcttggg cgtgttcttt taagaagatc ttggccagga     41400
     atcgctagag gaattctagg agatctagag aggttcaaaa gagtatactt cttctataag     41460
     gggttttact ttactggaga tgagggatac aaagatgctg atgggcacgt atggataagg     41520
     ggaagggcag acgatgtgat aaatgtctcg ggacatcgga tcagcacagc agaggttgag     41580
     agtgcagcat gcatggatcc ctacatagcc gaggcagcag ctgttgccga aaacgatgaa     41640
     atcaccggcc aggcgctttg ttttttcgta gttttgaagg ataaggaaac accacaggat     41700
     aaagtaaaag cgtctctgaa ggaaactctg cgaaacaagg tcggaaagtt tgttaatccc     41760
     aaggacgttt acttctgcga ggggattcct aagactgcga ctggaaagat catgagaagg     41820
     gttttgaaaa atatcttggc tggagactca cttggagata tgtcgacctg caccaatgta     41880
     gatgttatcg agggtttgaa agatctcgtc tctccaaagg caaattaaac ttccatcaac     41940
     tatttggaaa agtcttgatt gatagctata ataccttgat ttgtttaggg catgaagaca     42000
     attaatgatg tagacatcga aggaaaatct gtatttctcc gagcagacct caatgtcccc     42060
     ttgtccaact ctacagtttt aaataatttt aagatagttt ctgtgctacc aacaatccgt     42120
     ctcctttact ccaaaaaccc caaaagggtg atcattggaa gccatttcgg aagaccccgg     42180
     gggaaatact ccagggatct ttctctccaa cccgtgtacc gggcactaaa agaacttctt     42240
     agtaaggagc ttggaataga cctgattttc tgcgatctat gggatgttgg aagtatagaa     42300
     gatgcatggg tattggtgga gaacctaagg ttttattacg gcgaggaaga aagtgatgac     42360
     caaaataccg tccgttgcta caggaatgtt tttgtgaaca atatggacat tgcagtcata     42420
     gacgcatttg gatgtcttca tagaaagtgt ggatctatac aaaggacagg attgccttcg     42480
     tactcagggc ttttagtcca gaaggagctg gtctctgcaa gagaaataat gagagaaaat     42540
     atagatctta tgatactagg agggaaaaag gcgtctgata agatcaaact gctcaagtct     42600
     ttgggagaaa ggactaggag cttgtttatt actggaggat tggcattccc atttattaaa     42660
     tatatatttg gaagggaagt tggaaagagc atctgctcag acgtttccga agaagaagta     42720
     aagagtatat atgagatctg tagaaagtac ggaacaaata tagtccttcc cattgacttt     42780
     gttgttctct ctggcggaaa gatatgcata accaatggca taccttctga gggaaatgca     42840
     atggacatag ggcctgggac tgtggaactg ttgaggaagg aagtatctaa ggctcgggta     42900
     gtcttttgga acggacctcc aggagtgttt gaggaaaaag acttttccga agggacaaaa     42960
     gctctagtga gcattctgga gagtctaaag aaagaagaga agaaatcctt ttgtggagga     43020
     ggagagactg taggtgcaat taagttgttt ggaaactatg acaactttac ttatgtgtct     43080
     acagggggag gagcactgat gaagctgctg agtggggaaa atcttcccgg ccttgacttc     43140
     ctctcaaacc aaccttgagt ctaaaatcaa actaagtagg ctatcccaag acattcttgg     43200
     agttaatgat ccaggcatcg ttctgagaaa gatcatagga tacgaaagac atttcgtccc     43260
     taaagctagg acaggaaatg aataatgtac cttctactgg cacaacaaac ggatatagat     43320
     cctggcctac aacaaacaca tcaggaatgg tatcaatgtc tagattcgag atcccaaatg     43380
     gattgaagct gtattgcgac agaacaactc tggcaaaaga atctacataa ttcttcccaa     43440
     taaaagttcc tttttccttg tatctaaaca aatcatctct aataactccg attgagaaat     43500
     tatcggtctc aagtttaaat gggttgcttg ctgccttaat aatcttactg tattcctccg     43560
     gcacctctat ctcctttgga agaaaggaag gatagacatc atcggcatct gggcacagaa     43620
     tgatatctgg aatggatcca agtgcgttgt tcggcctaag tccattcata aagctggtgt     43680
     aggaaatacc agatgatttc ccagaacaaa gcttccccat tagcacaaca acacctgttg     43740
     gaatcttgtt tagaatcttt ctcaaggttg ttccgttggc ttcattcata tggaagtctg     43800
     aaaaaaataa caccttaaga tctctcctct cctctttagc tttcttcgag gtcttctcta     43860
     tactggggag atgcactcta gacattacaa atctgtctcc tgtttttctt ccctccatag     43920
     ctacaaagat gttatcacat agaaacacat cttcatgaca ctcgcttgta tcgataggaa     43980
     ttatgtcccc atcatcctcc aaaacctctc ttccgtttct gtccttgtaa taacatccaa     44040
     agatagtggc atggtcctcg tccaacaaat atataggcgt gactactctt tctatcttct     44100
     ggagaagatg tctatacttc aatagatcgt tcttctcctt gaaattctgg cttaagacat     44160
     tatagacgtc cttccgggtg tccagagact cgataatctc tcggattaga cctaggtctg     44220
     caagcttcgg tccgcttctc ctcttgtact caatcgatat gttttccagc attgaatcat     44280
     tcttgatatt gtgttccaaa tattccaacg tctcagaaga aagcattatt cctttcttgc     44340
     aggtaaattc cttgtagata ctttctctca ttcctccagg ggaaattttc tcagtccttc     44400
     acaatcttgc caaatagttt tatttagatt tcttagactc catttgcatc tgctccctca     44460
     gtccgttgta tttgtctaga aggctaaaat actcgttttg gttgttcttc agctgcttta     44520
     tcaagatgtc tccagacaaa atctttttct tcagatctcc aatctctgct tccaattcct     44580
     ctatcttttc gcttttcttt gtattttctt ccaaaatctt ctcaacatat ttcttctgat     44640
     tcatcgactg cttcctgagg agatgtgcag actcctcttc tttaaagagc aggcacatcg     44700
     ttctagtgaa catccgaaat ataattccca gaaacaaggt aaatcccgtc agatacatgt     44760
     ttctctctgc ctggtatagt acgaaaggat tgatgtgatc ctctcccgta tagatcttat     44820
     atgccgagtc cacaaacatt atgagtatca ttgcaaacag aacatagatt atatgaagaa     44880
     accctctgta aagcttcgac gttggaaaaa gccttatcat tctctttttg aggttctttg     44940
     atatcggaag cagcataaac gtgaacatgc acatttctcc aaaaagaata ctttgcacaa     45000
     gttgtgtggt aatccccatg ttgtttaagt aatctggaaa aaataaacct ggactatgaa     45060
     acatctcggc aaacaaatag tttaatactt cactcatccc ccgtaaggtt catgtcttca     45120
     ataagacctc ttcttaatgc aatcagttcg ttcctcactc tttgtgtaga taaatacaag     45180
     tccttatagg ctcctatttt cattttgatc ttattcagta atgcctcgca tattacattt     45240
     ctcaaccttt ctattttctt tgtttccaaa tccttctgct ctcttgcctt ttcctttcct     45300
     gcgtctaata tacgctgaac aaccacgtct tgtgagcatt ggccgatatc cttgatagca     45360
     atccgtgcac attcagatgc aacctttgga tggacaattc cacatatgaa ggcaataatg     45420
     cacataatcg gattctcggc cgtctcaaat agccttccaa cagaaagatc tgcctttgaa     45480
     aatgtgttct ccagtattgg aagccgaagg aaatgaaata tacattgctc ttttgtcttg     45540
     gtttctacat gctgacttac caaattccac tcatctccga acttattgat tccctccaac     45600
     agaagaaact cctctttttt ggaccacatg tttttaacca gagattcggt aatggggaga     45660
     aagtccgatc ttagaatagt tgctgggtag actccattat caatgcattc cgagcatcta     45720
     aatactaaag accttgtgaa aaatgatgcc ttttccccac agttacacat agatccttcc     45780
     aaatgtcttt ttatatccac aatctcttcg gtgtctcctt ctttagaagt ctcttgcaca     45840
     gaaatgccat cctcaatctt gaaagactca aggtttttga tctcctttac aatcatgctt     45900
     ctacaattga ttaaacccca cctctctgaa aacgaaaaga tcttaagcat ccagtacaga     45960
     tctatatcca ccagtgtcag ggctttccca acagtcatcg gcctgcaccc attttcataa     46020
     ctatcgatta ttctgtctct actctccaca tatttttctt tcccaacagc ccggataacc     46080
     tcatccatgc ttggaagttc taattgactt acttcgccct tcctaaacca gtcggggtgc     46140
     ttcatctggt atgtttctgt gtctacaaag tccaaaaccc cgcttttcat cccaaatgct     46200
     ttggatgttt tcgggggatt tgcattgggt ctcttccttc catagatctc ctcgatctca     46260
     acactttctt gcaatgggaa aatgttttcc atccagggct acacccaagg gagttaaaga     46320
     ataacagagt aatttattct agcttggcta tgggaagaaa cattcgcttc aaaatatttc     46380
     cgagtcgtcg acagaggaat agtcatcgtc catatgatct tccatgtcaa ttctatatct     46440
     taagatccct ccaatccctc caaatccttc ggcaaattgc gttccctccg cgctcttgtc     46500
     gcttacaaac atcaaagtgc atccaaagct cttgtagttt tcggcaatcc agtccacaaa     46560
     cagctcttcg tccttgacat tcgttagatt ctcatagact ataagcgtct ccacagcccc     46620
     catctccagg cattgcattg tttccttcat cgtaaaacaa aacttaccgc tctctgtgtt     46680
     gatctcatca aagaacttct gaagcacctt cttttccttg gacagcttta cgtctttaag     46740
     aatatcctcg catagctcga tggcttgatt cagtcctccc tctcccccat agttggtatc     46800
     aaccgtcttt atcaccttta tacggttgtc caatgcctga gatagctcgt gcttgagatc     46860
     agactgccct gcaagtacaa gcccctccac attcataata cagttcgtca gaaacagatt     46920
     ccctgctatc tctgcaacct ttttgacata ggcattcctc ttttcaactc taagacgtgc     46980
     aaatcttact gacgattgcc ctcctcgtcc atgttttttt ggaagatcca catgtatttg     47040
     ctgcagaatc gtcttcacat tcccctgaag agttgcaaac acagtagaat gcccatccat     47100
     cacaataaac ccgtacttgg cctcgtcttc aaaaagtgcc aagagatcgt ctacatggaa     47160
     cttcgagtca cacatgtaca aggatgtgtt cacaggcttg ataggctcaa tcccaacact     47220
     gaccttcttc tccttgttct gatccataag aacagttcca acaaatatcc caaggccgtt     47280
     cggaggtgtc ttgttatact gcttcagctt actttgagca gaggtgatag ccccaagaac     47340
     gcttagcctg tttactcttg acttgatatt cgatgcagtt ccatactcat ccgtaagcat     47400
     cttcgaaacc ctggatatct gatccctagg aggaatgatt atagatatca tcgatgtccc     47460
     gtttccccga ctgtcgcgaa ggttcttcaa tagcttcttc atcctccaca tctccacttc     47520
     atccagcatc tcatgggcag ctgcaaatat ttttatgctt ggaaaatact gctacagaat     47580
     aatgaaaaca cactattttt tattacgttt acaagcattt atatcgatga atacatcatc     47640
     cgattctggc tcgtcgggaa ggtccacatt ctcaagcttt tccttcttat acttcaattc     47700
     agttgccttt tgcaaaagcc ctgttatgac atcgctgatt tcatttttct cctcctcaga     47760
     ctccttttgc tcttgctcag ccctgtatat ccctattgtc ttgtcatagt actctttgct     47820
     tctttcaaag tcctgcagaa actcataaca gtttgcgagg gacaagtaca catcagcata     47880
     cttgaagcag tctttttcat atatcttgtc cataactgca acacactcaa ccaactcgtg     47940
     aagtgcatcc cgaaactcat tgtttagaag gcagatctct ccttgaagaa accttgtccg     48000
     tgccagcatc gagtagtctt tcaatatatt gaaggcattc ttgcatatct ccagaagatt     48060
     ccatgcaatc tccagatcat cttctgctcc ctttctctct tctagattca gccccttcct     48120
     tccactgatc ttggatatct cctcaataaa aaacatatcc gaactcttga taagagcatc     48180
     cgcatactcg atataaagat aaggaacctt ctcatcatca ggattcactc cttcaaggat     48240
     ctcactgtat attccaattc catgctcaaa ctcgccctgg gctatagatg ctcgagcctc     48300
     cgaaagcaat ggaaaggctt cagcaagatc ttccatacaa gggagaaaaa atttctttat     48360
     atcaatagct attgttccgg aagtattctt ttggatcaaa tcggtggaag tcgcaatagt     48420
     atctccatcc tagggtaatg acaagtcttt cctcgtctcg gactgcaaag agataccctt     48480
     ggccctttgc ccatctcaga aactcggaaa agtcatcttc gctctcaaaa acttctgtct     48540
     tttgcagaag aaaccatagt ctagatatct cgactgactt ctgttctagt acaacaaaag     48600
     ttagcactag aattagtctt cgaaattcct cggtcggatg tggatctaca tcatttgaag     48660
     gctccagtct tctaatgaaa tacttctctg catccatagg atcaacaatc tctactttgc     48720
     taatcccaac gagctcaaga cccaactttc tcaaatattc tttggaggcc tctatgagga     48780
     ctatcacctc ctttattcca actttaagct gtgctcgaac actctgcttc cttgttggaa     48840
     cagacttcct atgattttct atcaacatcc ttacaaactc tccaaccaag gcttcattgt     48900
     tgttcataag aaaggacgaa gcggttattt tcctagccat ttttacccac cgaaaatgcc     48960
     ttccagcttt gtgagcctaa ctccgctcat aagaacagaa actgggatat actgccatct     49020
     tctggaagta gataatgtaa agattctgat aaattgtgga gcatcttaca caatggacat     49080
     gtctatctat gcccctatcc ttccccagat actttcctgt gatgccatcc tcttgacaag     49140
     cttcggcatc aattgtatcg gaggcctacc ctatatcctg cagaacaact attataacaa     49200
     agtcttttct tcggtaccgg ttaaggttct tgggaagata tgcctggacg agcatctaag     49260
     aggaatgggg ttggaggcag aagtagacat tggatgcttt gaaaggatat cggagataaa     49320
     gtattcgcaa ccaacgatgg taaacgatgt cgagatatgt gcatacaact ctggaaattc     49380
     cattggagga tgcttgtaca agataagcaa aggcgcagag aaaattgttg ttgggttcaa     49440
     tgcaaaccat cgaaaggaga accatcttga tgggatggga tttgctggag tgggagattg     49500
     cagtctgtgt gtgtttaatg gaaatcacgt tctggccgag aacatctcga ttgcgaagag     49560
     agacaatatg ttcagagaag cgattggaag cgcccttgat ttgggaagaa aagtgatttt     49620
     gccagtgaag tattcacgat ttcttgaggt tgctttgata ctcaacagtt ttatggggca     49680
     aagaagtgaa aagattgcat gcctgtcata ctttgggcag agatttgtag aaagagcaaa     49740
     gtcgatgata gagtgggctg gagagaaggt ctcctccatg ttttctgaag agaagatcaa     49800
     cccatttgaa tttgaaaaaa tcgagtttat aggacattat cgggatgttt ctgaatttga     49860
     tgttataatt gtgattgatg agtatgtgca tggaggaata ctcacgacgg ttcttcacaa     49920
     gtttaatgat gagaacaatg ttgtttttct cacagatccc aggatggaag ccattatcaa     49980
     aaaagagtcg ttggggatga agtggtatga cttcaggctt gtggaaaggg taaatgagaa     50040
     gaaaaggggg aatggagaca ttgaggcctc tgtcattata gacgatgcac ctgatgcaaa     50100
     tggagccgag acacattggt ctgaaacgag atatgaagta tggtgtgaag gaggagatga     50160
     agtcttcccg gcggtatcaa gaaggagggc atatgatgac tatggggagt acatggacag     50220
     atcattgttc gtaagtgaga ttctctctgc agaagaaata tctgaggaaa agatggagaa     50280
     ggaggtggta gtagaagaaa gagaggttgc aggggaagga attgttttga aatacagagt     50340
     tgaaaagatg gacttgatgg gaatctcgga tttgaactct tgcaagatga taatagaaac     50400
     catctctcca aagaaacttg tatgcattgg agaggatgag gatacagagt gcttcttcta     50460
     ccatacgttc aagtatatgc cgtgctttga ggatgtatac atgtgtagga gcaagataat     50520
     tctgtcctcc gatgtttcta tgggaatggt gaagctagat gaaggattcg acagtctgaa     50580
     ctaccagatg atagggaatg acacggtggg gagtttccga ggagtcaggg atggagatgt     50640
     ggtgagatgc attggaaacg gccccggggt gatgataggg catgtagaca ttaatgagct     50700
     aagaagaatg atcatcgaaa ggaacatgag ggtggagcag gaggaaaacg ggctactggt     50760
     tgaagattgt gtgtggatta ggataaatgc agacgggcta acgatagatg gaaaagactc     50820
     gggagtgttt tatgctgttc gtgatgttgt gtacatgaac tcggccttca tatgaagagg     50880
     cttttgaaca ttaaatcctg tgaatttaga gacttacttc tgttggcccc agatgtatct     50940
     tgaactccag aacctctcaa gcaagaacag atacgagagg tatagaaaga gcgacaccat     51000
     agtgattgac aacggaacat acgaatgcaa ggccggatat tctggagatg gaccgcagat     51060
     ggtcttcaaa aacattctgt atcgccacaa gactgtgtca tcgatagaaa gcttccaagg     51120
     ggcatctcct aagacaatgt ttgatggcga cgttgtgacc aactttgaag ttttggagaa     51180
     tgtcattgac gaaattcttg agtatttgaa gccggagaag ctgaagaacc tgatatttac     51240
     agaaaagata tttaatccga cacacgagga ccttgtgaaa ttcttgttcg atgtctatgg     51300
     attcgagaag atacagattg gggtggatag ctactattcg tatctttgga atatgagtgg     51360
     ggaagactgc atggttgtgg acatggcaca ttctgcaacc acatgccttg tcatctgcgg     51420
     agggcggatc atggacgtct acaagatcaa ctttggagga aaggctgcag gagattatct     51480
     ctcggcactg atgtttaaca aatttttcaa tgggaagaag aactataagg gtctaattcc     51540
     atatttgaga tgctctttgg actataggag agagacagtt cagatccttg aggaaatgaa     51600
     ggtgggaaac tattcaagaa attactttct ggatgaggag ctcgagatgg tgaaggaaaa     51660
     gcctgtagat aagaaacaga agatgtgtgc tgcacctatg gtctctacct ccatgcctga     51720
     gatcgatatg tgtcttctta acactgcaga tgttgatctg gatccggaag agattaagga     51780
     gaagaagaaa cagaaaatct tgtaccactc cactctccat agactcaaga cccgggtcga     51840
     gaagtgctta gagaaactat cctctcatat tttgtacatg gaagacgaga gagagaaact     51900
     agaggatctt gagggattca ttagcaagaa aaaaacggag cttcaggcac tcaagaggga     51960
     gctggagata aggagtaggt taagaagaga tgttaagaac agaaagacat atgagtttca     52020
     ggttaggttt aaggaggggg aattgactgc cgacgagaag acattggttg aaaaaataag     52080
     agatgccgag gacttagaca aggaaaataa gattctggaa tctttgaaga gcctcatcca     52140
     ccagataaaa gaactagatc cctactttga accatataca gccgacacag ttgaccttct     52200
     tagcggccat ttcatcggaa gaatgaacgc aaacgtggat ctcctgaaga ttccagagat     52260
     agttttttct ccttcgatca taggactaga ccagatgggg ttaacagaga taatggaaga     52320
     tgttagcaaa aaatatagag tgaagaaggt gctattaaca ggaggtttct ctcagataaa     52380
     ggatatcgat gtccgcataa gaaatgaaat gacaagcatg tcgtttgtgg gggagatcga     52440
     ggttataaag gccaaagatc ctataggtga ttcgttccga ggagcaagga tctgcgaagc     52500
     attccccaca tatactctgg aggaatacaa ccgttcaggg attgtcggag tatgtaggat     52560
     tcctggggaa aaatcgactc tgaatcccaa gtcttgaaat aaaacacatc ttgaactacc     52620
     tgaagataat tttattaact tctgcctcaa actcgtccct tattgtttga agccttgatg     52680
     caaagctatt atctacaatt gtggtatagt cctttgagca cagaagaact ccccccacac     52740
     cctctggaac catttccctg atctccgagt ttttacactc cttttccacc accttcctgt     52800
     ccttcttgtt gcaatataca atgaactccc catctatttt cctagcacat tcagctatca     52860
     gagaaggatt aaggggtctt gaggagcata tcttcagtgt ctccccatag atttcatcta     52920
     gaattttaac tttttcttca agatacttct gattgtacat gtttatcagc gaattctctg     52980
     ccattacttt tttcttctca atttctttct gtttcaacaa aaattcattc tctattcgag     53040
     ttgtttcctc tttaattatt ctggccttct cggcattgta ctcctgtgta gcctttatct     53100
     tcatttccct gatcttctcg tctgcctcat ggttgatgaa tgtcatcatc ctctctatgt     53160
     ccttactcgg aaccctgtcc atctcctctg ttaaagggta ttgttttcac cctatttcag     53220
     ggacagaaca ggagttctat cactcatcat ccctaaaatt gatagcggta ctccaaaaga     53280
     actgcttaat tagatttaaa catttattct actatcctca gacacccttg acaatctgga     53340
     ccacatcact atcgtttagg atgtgctcct tcccaacctt ttgtggattg tgtttgaccg     53400
     aggtccccca taccaatgca tgtttaaatt tggcaagaat ccctctatgt attgcattgc     53460
     agaagtccgc cacactcctc ttgctactct taagaataac aggctcttcg tagtcgatag     53520
     gctccccttt tggctttggg tatatcctta caagatcaag atagtcccac atcttggata     53580
     gaagtgagtc gaagttccac cccaagtttg cacacactgg gacagaatgg gggatcttat     53640
     aaagtagatc caattcctct acactgatcg agtcaatctt gttcagtaca tatatgcaag     53700
     gaacatactt cctatttcct tcaatcacat caatgagatc atcgattgtg cacggcccat     53760
     ttgttataac ttctgcattt gacattctga actccccaag aacagctttt accgtagcag     53820
     catccaggct gtctccaatt aatgaaactc ctcccttttc tttctttgtt atcttaattt     53880
     ttggaggctg cctattgagt ctgattccaa ctccttcaag ctccctctca atcaccgcct     53940
     tatgggacac aggcttaaga acatccaggc atactataat caacgaacat gttcttgcaa     54000
     cagccaaaac ttgctttccc ctaccttttc cgtcctttgc cccctcaatt attcccggaa     54060
     gatcgaggat ctgtatcttt gctccgttgt agctcagcac tccaggaact gttgttagtg     54120
     tagtgaattc gtatgcagca accgcactga aggtccctgt tagcctagac ataagagtgc     54180
     tctttccaac actcggaaat cccacaaaac cgactcttgc tatccctgtc tttccaacgt     54240
     caaaccctcc ttctcctgac gatccagact tcggtgcaga tattagctct cttctcagct     54300
     tggccagctt tgccttcaga atccctaaat gattgcttgt ggccttgttc ttctgggttc     54360
     ttgccatctc agcctctatt tccctaatct tgtccaagac gttcattaag ggccataagc     54420
     tttctgtata tatccagaga tttataattg tccgttagat ccttcgaatg aagatagttg     54480
     ccgagtacga cataagactg tcgaaagaga cagagcctat agcattttac aaactaccat     54540
     gtacagaaag aaatcttcgg atccaaacag tgcgctggaa gcgccaattc aagtacttgg     54600
     agatggatat gaagttaccg aagccgggac gaagaatgcg aaggacagaa gagaggaaga     54660
     caaatattat tacctacgaa agctatggat tcacaccatc ctctattcaa tggtatggga     54720
     agatagacca cctcaagaaa accatcattc tgcggcaaat agaatgtatc cacctattca     54780
     atccgaagtt tgggagttcc gaaatagaga aagaccgcca ggaggccgat ggatatcagt     54840
     tcaagagggc agagacacgc gaagaaaagg agcacagaag aaagaacata aacttctaca     54900
     ttaagaagat gaatctcgag gagtttgtta caatggaata cagcaggaag gagatgtccc     54960
     aggagtgcag caattcccac gacctatctg cggttgaaga cgatgtgaag cctggaatga     55020
     aaataaggag ctctataatt aatgctaaag ttgtcaattt ttctgagctt gctctacttt     55080
     acaaggacca gaacgcaatc aaggcagcat tatcgagata caccaacttt attaatggaa     55140
     gatacatact ttccaacatg ttttatgaaa agagtctgca ctgtattcga gatgggattc     55200
     tggaactttt caagggtagg gaaagagtcc tgtgtaaaga tgtgtatcta cttgcaggag     55260
     aggagaagtt cttggttgaa gagctctgca gaagggatgg gaaatatttc ctactcagag     55320
     gttttagcga ggacacaaat aagtgtgatg atggcagcat agggcaagaa atacgcttta     55380
     tagtggaaaa gcacaagcct tgttcgatcg aggttatcca agaggagatg ctgctggacc     55440
     ctgatgctat aaagaggaat ctgccgggag atgtggcggt tctggcaaat ggaatgcttg     55500
     cggtctgcaa gggagatgat aaaagaaaaa gaataataga aatgctggtg gaaaagaaaa     55560
     gctggaagaa gagcgaagtg ttaaggattg cacaaaacga gtctgggggg attgaagatt     55620
     tcttctctgt gttcggtgag tactgtgagc tgagggggaa tgtgtggagc atcaaagaat     55680
     aatgttctgg gcccttggca aactattcgg gacttgaaaa caaaaatttg atccctgcct     55740
     ggatagatta tgatggagtt ttgtaggatt aatgaattga acaaaaggat ccaagagctt     55800
     tatcatgcta tgcttgcagt ggttccgctt gaagggattg gagagcatcc gtttgattac     55860
     ttcaagggag aggttgggcg gataattgat tctgtagatg tggttcttaa ggagatggtc     55920
     aataaaaagt tagaattgca aaaagaaatt gatggaatgg tgaaggagat gatgagggac     55980
     tgtacagaca ttgaggtgtc tgttccctct atccctaatc tatgcaacct gtatgttctc     56040
     aaagaatatg tgaggaatga agcagagggt ataatgatac taaagaaggc agtggaggga     56100
     cggatggcag cgattataga agagatggag ctggaggcct ccaatgttgg gatgaaaaaa     56160
     attgactgga tggatatgga gtgtgctgga gataagaagg gtgtctcact aatgaatctt     56220
     cgggagcttg aaatgcatcg ggatgttttg aggaacaaaa gagagagcat ggagagaaat     56280
     agggataggt tgtacagaga gctttgcgtg tttctatcac agttgtccag aagtgatccc     56340
     gaagtgacta tagatcagaa gatctttatt cttgaaagac ttcatagaag atacaaggaa     56400
     gaagttgaaa aaagggacaa agagtttaga ggacttgaga tggagataag aagaagagaa     56460
     gggtatctcg ggatcgcatg caaggatatt gaaatggatt tgagcgaggc aaatttagag     56520
     atgatgaggg actacgaaag gtatcttctg gaagaacagg aaagacaact tgatgagata     56580
     tacgagaaga aaaaaggctt gctcaaggag cttctggaag tttttggaga agatatggag     56640
     gattacaaga ggactgaaaa ggacattgaa gagatgtcaa agatgattga aaagctagaa     56700
     tccaagaagg atctcttcct gtcgataagc tcactgatgg agaaaaggtc tgagcttatt     56760
     agcaagatga atgaatttga gaagatagcg tcggatccaa agaggttgtt taggtcgtct     56820
     ttgcagctct tgagtgagga gaagttcagg aacagcgcat atccaaatct aataaggatt     56880
     gaggagacga tgttcaagct tctggacgaa tatgaaaata ggtttggaaa gttgtttaag     56940
     gatggagtag acttcaaggg atcgctaaga gaagagatag aaaatagaat tgtaaacaaa     57000
     accgtgttta tcaacaggtt ggattcgcct tccagaaaga ggagatagtg ttttcagagt     57060
     aaggcccatt ccttttccct ggacaatagg ttcttggccc caatctcaaa tggtggaata     57120
     tatcgacgag tattggcgaa gaacatatgg ctctaccttg aggcgtgtac aaaaaaccac     57180
     caggagtaca taagtgatta tactacagct aggtccctgg attccccact gtgtatagac     57240
     aggagcagtt atcttaagat taagaagact ctgtcttatg ggaatggtcc ctacaagaga     57300
     tactatttcg ttgtatttat ctgtcttgtg gagggccata aagcccggga tgttgtctcc     57360
     tcctaggatg catcttccaa cttcctttga aattaattcc ataaagtcct cctgagactc     57420
     caagacatca tttagattcc agccgattac ttcggaaagc ccccttgggc tttcgaaaag     57480
     aaggcttttt gagaagcgaa gaatctcctt catggtttga aagattctgc tttcgatctc     57540
     tgccaacctc ttggcctcgt cctgtgactg ggctgcattg cgttttccag atgcaagatc     57600
     tcttatggtt gtctttagat actcttcatt gtctataagg atctcgaaaa ctgtgttaac     57660
     tgcggaaaag tacatttctc cggtgacagg cttgtcttct ccagaaacta tgtttccaag     57720
     tctgcagttt tgaaatgcaa caccggcaac ttgtctatcc atttgtccta tttcatacat     57780
     tccgtgattt atctttccaa aataaaaaat atctatgttt ctcattatag catacagagg     57840
     gatcaatctc atggatctgt ctatttgtcc agtaatgttt atttactttc tcaggatgga     57900
     tgatgcgatg tcatttaaga tgacggatga agggattcag ggcacatctt tctgtttggc     57960
     aatggagagc agtgaataaa cagagaaaag ggatccctct gatggacatc aggcaaatag     58020
     agctccggag acagcaggca aatattttgt tcaaggaaca acggatcggc gaggcactgg     58080
     acatttacca gaagtctctt gcagaagcta tgaaatgtgt agtgccaggc actaggaact     58140
     atccccttga ggaacaattg tctctactga cgtataatat ctgcatagtt tattacaggc     58200
     aaaagaactt tcccaaatcg cttgtatttg gacttgaatc actaaagtat cttgaaaacg     58260
     acaagactcg aaacaagata tgtgcagtat accttcggct tgggatgata cgggaataca     58320
     aggaagtcta tgaaaggata atggataaga gttctagtcc tgagatttcc tccctgctga     58380
     gcagaatgaa gctggacaag cagactgttg agaagtatct agaaaggtgc ataacactga     58440
     aaagactaca ggagctatct aaggaaatat ctgaggggaa ggtcataccg acggacatat     58500
     tggaatctat acttgagcaa ggagaaagtg tttttttagg ttgcgaaaat gttgtatatg     58560
     ttgaaagcga taaggaggtt ttggtttttg gagacacaca tggacagtat tttgacattg     58620
     tgggaatcct gaacaaggta tttgatggag acagggtgtt catatttaac ggagactacg     58680
     tagatagagg agcacattcg gtggagaatt ttgttctcct gctctcgtta aagatcctct     58740
     ttccaaagcg tttttaccta acaagaggaa accatgaact tttggatata aacaaggtct     58800
     atggctttta cgacgaagta agaaggaaat atccgttcag cagcagttct atataccaaa     58860
     agtttcagaa tgtgttcaaa gcactgccca tttcggtaat tgttaatgaa aaggtcttca     58920
     taacacacgg gggactgcca ggagtgccga ccagggtgga agatctgcag aaagcctaca     58980
     gaatgaccga ttcacatgca gatgagctgt tgaaagggtt tttgtggtcg gatccagagg     59040
     aaatagaagg aatagaagag agcaaaagaa gagccggtgt ggttttcggg gcggatgtga     59100
     cagagcgctt tttggagatg aacagattgg atttgttgat tcgaagccac caagctgtcg     59160
     aaaatggata caaggcacac cacggaggaa gacttgtaac tgtattttcg gcaccttact     59220
     atgaaggcag tgaggaatta ggttcctatc ttattctgaa tccttcggaa agagaaggag     59280
     accaaactat cagtgtgtct ggtttcacaa gatacagagt ggaaagattc ggaagatcca     59340
     gccacaaaga agtattaaag cttctgtgcg attaaagttc tttatttcga aggcatatct     59400
     cagacaaaga aaaaaagaca accagtgatt tgggattggc aaggctcctc ttgtgtgctc     59460
     ttgaataatc cgaaacgtgt tttgtattag aaaatgtatt taatttaggg aaacagatga     59520
     ttgggaggat gaggaatgag tatgacttat tggacgaaag aatcagcaga ttctggcacc     59580
     aagccttcaa gggagcagtg gaagagagaa tactcctgaa ggacctgaat ctaccccttg     59640
     cacggataaa acggctgatg aagattgagg agggggtcag gatggttgct tcagaggtcc     59700
     ctgtcttgtt ttcgatgata acagaaaagt tcattgagga gctcactctt cgggcctgga     59760
     taaacaccga ggaaaacaag agaaggatac tacagaagtc tgatctaaca gctgctgtga     59820
     agacgtccga gatgtttgac tttcttgtat atattgtccc aaggaatgat cttttgcatc     59880
     ctttcaatca tctagtgccc aacaaggtgc atcatggtgg agaagacttt tccgccagag     59940
     gagatgcata tgtgaagcag catgtgcttg gagaaaggca gatgatggaa gacatggccg     60000
     agaagatggg gaatccgcac cagggctttt atccccagga gcatcgggta ggggatgagg     60060
     ttgctaaatc catggccaac tctcatgcgg atgactatag aagagggttt gatattccct     60120
     ttggtagaga catgtctgca gatatagcac caagttcctt cagatgattt tttattagaa     60180
     agtttgtaat aaacttagtt atagttcttt ccaggagcat cattattgcg aactcttatc     60240
     tttcttcgag tcacctatgt gcttgtcaat tatcttaatt atctcgggaa caagaatctt     60300
     ccttgtcagt ttcttgcttg cagaatagta ttccaggcct ttgtactcga tgctcttcat     60360
     tttgttcctt ccgacaatat ccttcagaaa aggaaagctt gaaaagatta tgttcctaac     60420
     acctttgatc ttggttgcca caaagaagaa gtccaggccc attgcctttc ggaagctttc     60480
     tatttgaagt tgcaaggcca tccctgtctt tccctcgggg agtcccctaa tgttctttcc     60540
     ttctctatct gcccaatcct caaatgggta ctttactgtc gatcccccga aaaagaactt     60600
     cttgtgatgg aaggccttaa agtccttctg aagaataaga tctgttccat gttcgctatc     60660
     atttctcctg gcaagcctta aagcccgtat cgtcttcttc agctccttct tcttcacgcc     60720
     agccattctt ttcagctttt tatattcggc tatatcgaag atacttgtgc gcctttttaa     60780
     gaatcctgta tccatcagaa tcggaataag taagagctta gcaaaagccg agcaaagcgc     60840
     ctctttctcc tcacctttcc ggcgcttgtt caccagctct gcacagtggt tcttttttgt     60900
     caggtcctct ccaagatatt tggaaaccaa tgttgttgca gacccgacgt ccagatcgat     60960
     atacattctt ttcgcaggag gaacatgccc cgaaagcatg tggtgatcaa taaccagctc     61020
     gacttcacta tcatcaaaca cctcggcagg tttgttatga tccgtgagga gaagcttgat     61080
     cttcttccca gatatcggat actgctttcc ctctaagtcg aaatacgctc ctacttttct     61140
     tgcctttggt gagaaatgta gtgttggttt aacaaggaat atcagatcgt ctacatctat     61200
     tccaaattcc ctacacacac acataatttc tccttttgcc atgaagacct cctttctcat     61260
     attgacaaca tgaatagcgt cttcagcata cgccaccacc aatgaactta taaacgagtc     61320
     aagatcacac gcctcgtttc ccatggcaat cctaagttct ccgtggagaa ttcgttcttt     61380
     gttggttgca aaaaatgatt tcagcctttc ttccagtaag gtcattgtta cttcttctca     61440
     aggacctaat aaaaataaat ctgaaacaag aagcagctct cgaaaaatgc aggtttgtag     61500
     gattcctttc tccttaatcc ttcgatttct cctttatggg gtgacagact cctttattct     61560
     ccttacatcg ataaaagatc tcaaggctga agagactcat gagttttctc acagaggaag     61620
     agaaaagaag aatgttgatt atgcagatag agaaaacagc tgaagaaatc agaaagggac     61680
     aaaaacttgg catttcacca aactacacac atttttttgg cttgagatca tcagggatgt     61740
     actcgaaaat ctcggtaaaa tccaaggaag gaattgtgtg ggcttggttt ttaattgtaa     61800
     tgtttttggt gtgctccaca gccatactga ttttcatgaa aaagtttgat atcatctagt     61860
     ggaaagctgt ttatgaaaat tttgctatcc ctgagaatgg gagctgttac aaagaagagt     61920
     aaggaaaaga agcatgcaga gcttgaaaag gttggaaagt atgcagagga ataccccctt     61980
     gttgcagtga ttgaaaaccc aagcatatct aacgtcatac tcaaaaagat tagagaggac     62040
     ttcagtggtg tatccaggat tctgtttgtg agaaagaaga tggcaagagc ggtgtacaac     62100
     atgccttcta tgccaaaaga ctccttcttc ttgatgtttg gggacacaga agccatcgaa     62160
     agagccaaga cataccagta cgaggatttc ctcgagaaag gcgatgtttg ccctgctcgg     62220
     gttgtcatag aaaagcaagt gataagaaac aaagagatga ttgagattct tcctgtatcc     62280
     atgaaggacg agcaaatgca gttgaaagag gactatgttg cttgcgaggc tggagaggag     62340
     gttgatgagg tgaaggcaaa gatcttaagg ttctttggga agagattgaa aaaaaagaac     62400
     ctggttgtat tcgatgtaac cccatcctcc agtcttctaa aaaaaaccac aaacgattaa     62460
     aagatttatt gcattccatc tccaaagaag gatctttcaa tttcaagctc gacttccttt     62520
     tttgggattt ttccaaggag gttctgtcct ttgaccttga agtcacttgc ataaagagaa     62580
     ttaagaggct ttcccttgta tccctgaaga aaggcccgga ccagactttg agctcttctt     62640
     gtctgcgact tcagtacgtc ctcctttagg tttatgcatg tcgattgatc tattcccaag     62700
     gtctcgctga aggcttttgg cccgtcctcc tgctttatgc ataaagtaag agatgacaca     62760
     atcgaggagt gtgcattctc gagggctcct gagttgtatg ataccataaa tagataaaca     62820
     gccctgtatg tgtcaaatgg cccggtatgg atgttgaatg tttcagacac cttctttacg     62880
     actgtcggat catctatttg gagaatttca accaactcgt tgatgtaagg gcacagtttg     62940
     tgctcccggg aggggcccga tgcgtgggca atcacatgga ccaaggactt cacacagaca     63000
     ataagatctc ccggatcctc cgagaccccc cattcattta caagtcggcc aatctccttc     63060
     tgaataaatg ggccttggtt ttccaaatag cccaggagat ctctgttaaa gcaagaagta     63120
     tctataagcg aataggtgtc caagtcagaa tagattcttt gaagtatctc ctcaggaaca     63180
     tctcccaaca tcctaaggat ggcaaaacat ctatcaaacg ggcctttctc caaaaacgtt     63240
     ctgtagtagg agcttgaaag ccctcggaac ttctcaggac ttcttttgag atagaagaaa     63300
     aatctcataa gctcgtcata tgaccagttt cctgtaaatt tctcctcccg cccaagtctt     63360
     ataaaacatt ctacaataac ctcgttggtg taggtcttgt cagatacatt gcatctgctc     63420
     agtatatgtt caagctgcgg agcagagaga gggaacagct ccagaatcct aatgaccagt     63480
     ttgcaaggct ctttttcgct aaggtcaaaa tattggatat agtcgacagc agaaaagtct     63540
     tttctataga tcgccagtga gcagcacaga acagggtcac tgaatgttag atcttgggga     63600
     acatttgatg aatgcgaagc cccaaaaagc ttcttcagga agtaaagagc cagctttctt     63660
     ccaatgcaat ctccattgac acctataaag cttatcacag accttggata attcctgcag     63720
     atggcgttga acaacccaaa cacttctcct tcaatctctg tcctttgtct ttcgtcgatg     63780
     ctaatgtaga tcgaaacaac ctccgctaga acatctccaa ctatttcctc cgatccgtcc     63840
     cgcccaaaaa gctttgtcca gaactcaaca gatgcagaaa aggtgatcaa atccttccga     63900
     aggcccttaa aaacatactc gtacatcttc ttgacattgc ttactcgagg cgccttgtcc     63960
     ttcagattat taaaacatat tatcattcca taggagatgt ccatcctcga cgcaagatca     64020
     atgacacttt ctatatcaag catttccatc ccgtcattga gaaactcgat agtcttttcg     64080
     ggaaatccag cccctcttct cagtattatg ctgcagtcaa aggtccgagg catcatctta     64140
     agggactccg tcaaaatcgg aatgatgtgc tctgccatcg agtcatcaaa caagggcatg     64200
     tatgcatttg acataacgcc acatcctctt ttcagctcgt cttttctttc ttcgttaatc     64260
     tcctggctgt agttgcacag gtagagaaag ttttccagaa tcttatatcc catttccttc     64320
     ttgtgggaga gaagatcaat aatgatcgag aaaaactggg gaaaagtaga aggccactca     64380
     taaatcccaa gaagggcaaa tacctgtgcc gccttatcag actcgttgct ttggacaagg     64440
     ccggccataa agcccatctc ctcttctaga gaaatccctg ccatcttctt gcttctaact     64500
     cgctgctcaa taaccttcag agcataaaac ttgacctctg gaattgcaga ggccatcagc     64560
     tccttggctg gagcgagatc ttccgagctc acacatctct gtatttccct ttctatctct     64620
     ggcattgccg atggatcgtc ttttagccta acaaacaggt cttctagcct catttcttga     64680
     ggagggcgac ggaatagtaa attttatcaa tcacggacaa tcattcctcc aaaagagttc     64740
     tgtgcacctt tcagagccgt catccctaat tggaaagtgc cgggcgccaa atggaccttc     64800
     tccgacaaaa acgtcatagc ttccaaatcc agctcacaaa tctattggac catctgaaca     64860
     gaatggtttt aagtgtttta gagtgcttcg caaatgaaca acgacgtcct atacgaggtc     64920
     atcaagtatc tagactttcc tgtgagagac agaaaggtgc aggaagcaca attcagcagg     64980
     attaattcca gaagaatgat gagatttaat agaaacctag ttgagaaaaa gctatcagac     65040
     cgcccccata ttaacgattt aaaaacatcc aacatatata aggagagtgg agtaaacttc     65100
     gcaaaaatac acagggtgct gtcggatgtc ttcggccgaa gaggatctcc tccatttcag     65160
     aacatatctt ccaccttggc aggacttgta aaggtaatgg acttcaagtt gaagaagata     65220
     atgctggcat caagaatagg agggaaaagg tagagttcca aagatttatt aaaagctttt     65280
     atgtaagcta gccactgtcg gttattttgt gaaaatgttt ccaaaaagcc caaacaagat     65340
     taacattacc accacggctg caataagaaa gtatttgaag ttcttccaga acagcttctt     65400
     tttggcttcc tctgctgcag ccttatgctc ctcggtagtc ttttccagtg tgaaggtttc     65460
     cgatcttaag tttgtttcga ggtctccgag atctctttgg gcctttaact gctccttgag     65520
     agctccctga aggtcttcta cttccttttc tattttttga gtaacttcgt cccccattcc     65580
     aaacaatcct gttgtttagt atatttttcc ttaaagcccc ttttgcttca atataaataa     65640
     acctgcggca agacaagagc ctgggccttc aaagcactca attagttagt ctccttaact     65700
     ccttacagct tatcaaaaat gctttcgatt gcttggtagt tcaactttcc ggaaatcctt     65760
     ttgtccaaac ttctgaacgc ctcaacaata gatccaaact cctcgttttt tcttcttctc     65820
     ttcccctttt tgacactact tttcgtcctc ttctctcgct ctctcatgaa ctctccatac     65880
     atctcttccc agacaatctc ccttctcttg gtctcctcag gcgaaaggat gttcctctcg     65940
     atctcctcgg agtcagagag aatttcgctg tccacactgc tctgtggtgt cgaataagga     66000
     atcacctcgc tacttcccga ctcacactcc tgcttctttg ccatctccat tctcttcatc     66060
     ttaactgcag gcggatcctc ctccttctca atccatgttg cattgaactc ctcgatacta     66120
     aggttggcac tctctgtatc tcctatctcc ttcagcctct tgttgattgt actcacagag     66180
     acatggacta tctttgctat ctcgtatata cttctctcct ctcccactat ccgagatgca     66240
     atcaggagtg ctgctccgca caagttgttt ggccttcttc caacaacaat ccagtccctc     66300
     ttcatcctgc ttatcagcct tagggaaagc cccagcacct cggtgctttc aaaccgcagc     66360
     cgagacacaa accgtggcat atacagagat ggatcgatca acggaatgtc aattccaagc     66420
     atgtttgtta tcttcagaaa actctttcct atcttaaaca catcgatatg cagtgcattc     66480
     gaaaaatcca tcagcatgtg tggtgtcctc tcctgtctgc agacaatgta tatgcaggca     66540
     ctcagagtgt acaaaatcga tttccccttg cttagattgt actggagaag aagcttgtac     66600
     cacctgaacg agcattccac gtggtcaacc ccaagcccca gagatgcaca tataccgctt     66660
     attgtgtttt tgatgtagta actggaatca acaaatccgg tccccacatt tcgggaatcc     66720
     atcccgacaa tctgcccgtt caatgtggct ttcggtccct ctgtgttgaa gttcagagat     66780
     gcaacaattg cgttctcctc ctgaaccata ccacacactg tgcagtagac agctccttgt     66840
     gctgtgtctt ccgcaaaatc cccagaggaa caattagaac atatacccat gggctactcg     66900
     aaagagaaga actaaaaatc ttgtcttgcc catatcaatt aagaagtaca tttaataccg     66960
     aagatacagt ctgtcactcg tattctttaa agacatataa gttgctccac acacagaagt     67020
     cctttacaag tgccctgggc tcctttagaa actcaacctc tctatgcttc ttctccaaga     67080
     tctcgttcaa ctccccatct ccaatcctta ttcccttccg agcctctcct ccaacaagat     67140
     ccacagattc aagcttatac tctacctctc ccttcttgct ttccttctcc aagctcgact     67200
     taacaaattc tttcgtaaac tcatcgaaca tcacatcgtc ctccaccacc tccttctcaa     67260
     cctcgttcat atcgctcagg ttgcttccgt ttctcatcac catcctcagc tgtgcattct     67320
     tcggaaggac tcgaaggatg tgaagaatag actcttcgct tcccatgctg tatctatcgt     67380
     tcaagtagtt tttcatcgtg acctgatacc tcagaaacga caaaagctca ggaatttgat     67440
     actcatactc ctcataaacc tcctccacaa gaattctgca cactagctcg ggaacaatct     67500
     ctcttccatg tctctttttt attcgacatc ccagttgctc aatatagtat ctcaagatgt     67560
     ctgtcagaac atttagtgct tggtctgccg tcttatcaaa tccactctgt gacagcacct     67620
     ccacaactgc aagcttcagt atcttagtac tcatgtttga tttcatctga aatccgaagg     67680
     agtaattttt tatccgacaa atcatgtgtc tatttaccca tcaattaacc aaaaccttgg     67740
     ccatggaaat ccagtcattt gcccaactat ttctctcccc ttactcttct cccaggctct     67800
     tcttcatggc ctcaagctct ttaagtagga cttcaagttg taactcaaat ctcttttgaa     67860
     gaatcggatt caatgcactt tccatctgct ttctcttctc ctcaacactt ttctctagac     67920
     gttcaagctc ctggttcttt ggcttctctt ccttttcatg cttggtctcg gcaaagggga     67980
     ttttggactc ttccgaacgt gcttcagaat aatccaccag ctttttctcg atctctgcag     68040
     ccagcatgtc caggtcatca gacgtctctt tctcctcctt tgtgatgacc tcaaccagcc     68100
     gggccctcat gtccttttct agaagctccc caactttctt ttcaatctcc tcaacatact     68160
     cgatcttgct atttttcttc cggaatcttc ttgccttcgc atacttcagc ggtgggcaca     68220
     acccactcag ctcatgaatc tcccgctccc tctcaaagtc aaaatctcca tgcgggtata     68280
     caaccacaag agtggatatg tctgccacct tgtagtgttg tctattatcc attgtctttt     68340
     gtgattcgac tatacatggg agtcttacaa ttatccccgg atacttctgt ccaccatacg     68400
     acaagacaac agacttttca ttgcaaacct ccagtgtcga gttcttgaga tcaacctcat     68460
     tctttatcga ttcatgaagt cggagaataa actgctgctc catcttccag ggcctttatt     68520
     tatgccattc gaagaagttc ccacatccat tgggagcccc gatgaggtct tatatgaagg     68580
     acggcctgag aataggattc accaaggaga cttctacaga tcatatcgag gctctacctc     68640
     tggagatagc taggaagttt gaactactat cgggaatctg cgacaacagg tccatacaag     68700
     agtttcctgc tgcgataatt aaagagatag tcgaaatgtg caatgattta agagacctcg     68760
     ctcctcacta taacatgcct gaggaatatg ttgagtatgt tagagagaac aaggatgtcc     68820
     tgggatactt tgaggaatcc gagaacaatc ttaaaggaga ggaaatgagg ataatcaaca     68880
     agagaaggat attcgatgtc tttaggagta tgatggagaa aatggaggag atgtagagtg     68940
     tttgattctg atgaaaggct tcccgaggtt atggttacaa ataaatcttt ttattacatg     69000
     ataactggga ggaattctgt gtttcctctg tagacaattt tttcagagaa gaaagaaaaa     69060
     aaggaaaaac ccatgatgaa ggaccttttt gtaggtagtg aaccaagcga ggtgaaggcc     69120
     aaccggctca agaagtacat ggaaagcgga agattccttg aaactctttt tttcccacat     69180
     gagtttttgg agtcactagt tttatttgct attcagatac tcaacagtac ggaacctgag     69240
     aaaaaatcgt catttgtgtc tggagggaat gaatctcgct acattgtcct caggcttttg     69300
     aacaagtttt cgctgaaaag gattaggaat acaggattag tgcatgcact ccattgtgtg     69360
     cttagaaatg acaatctccc aaacgtgatt ttgtcactga aggcattagg ttctctgagc     69420
     agatcggggg tcattgcagg agatctggtg gaggtgcatg ttggagtcct tcttgggatg     69480
     gttcacaacc tctttacaaa cctggaaagt ggagaagaag ggctcattga gatatcgcta     69540
     tttactctta cagagatgct gacccatgcc agggtttttt tccgtgggtt ggagtaccat     69600
     gctgtgaaga ttgatcaatt tttggcctgt gtgtatggaa acatcagaag agcttttgaa     69660
     aaccggagat tcatggatgg gatgatgcat aaaaggacgt cttcaataag catgtgttct     69720
     ggaatctgta gtctcctcaa gctgacatat gagcagcttc ctattgtgtc gaagtcaggg     69780
     ccttatcatg tgtttgcttg tgaggcagca tttgttggga tgtattactg tccctccgat     69840
     ctcctggacc ttaggaagga gatctacatg ctgtttagca agatgtgtat aggagacaaa     69900
     gagatggttc ttcctatgat ggacaaagtg tatatggttc catttctttt ttctccagat     69960
     gcacagccaa tgagcgtcaa ggggattgga atgctctctg aaatgctcgt gcatgttaag     70020
     gagaacctta gcaaggcagc atacatggag tttgggtcga aggtattcaa tgtgcttttt     70080
     tcaacctgtt cttcaataag gaggctatgc aaggaagttc atgagggagg agaagaaaga     70140
     cagaaatatc ggaggaatgc aagcgatata attagccagg atattgaaag tctcatagta     70200
     tgtctagggg cggtagagaa cacatgcaaa tgctttggag gcaggacagg agattccgaa     70260
     gaactcagcc acatttatct caagagcttt tacgatataa ggaatggatt tgaaggaatc     70320
     cagggattag taagactggg atgcgcaggc aaggaggagg agttgaagaa ggttgtaaag     70380
     aaatttgtct ctggatttcg agaagtgatt ggaagagcgg gaatccttga aaagtctgga     70440
     aatgggattg tcttttctgt acccgagatc aatatcctgt atgagatatt tgagaggtct     70500
     tttgatgtat ttttgcatga gtgcctgtgc caagagcagg acattgaaga gtttttctct     70560
     gtgctgtctc ttgttagaga gcacattgga agcgatatag tcaaatgcct ttcagaaaga     70620
     attgtggagt acagcaagaa aaacggggag ttctttggga tatggagatt gatgagcagc     70680
     tctgtaattt tgggaaacac attctgtgga tatgtacttc cacgaatgat cgaggagctc     70740
     gatagagagg gatttgaatt tgtcaagagg gcaatgagat atattgttcc gttttttgga     70800
     aacgatataa agaagataaa gcgagtcaat acattcttca tgcacaggat aatatcaact     70860
     ctgttggcag ccaagaggat ggaaaacttc gaaattttgc tggagatctt caacatgttt     70920
     ggatcgatgc ctgagaagag cagctttttc cagaaataca tcttcgacaa cttctcaagg     70980
     atagtttctc atcttatgaa tctttatgaa gttgagggaa agagcatatt tatagaaatg     71040
     atattttcct tgccaataag tatcaaccta cttgaatcag atatccaatt tctcatgaga     71100
     cctattgaag aggccttaat gcttcatggg ccagtaagaa ccaaggcgct gtctattctt     71160
     gtgtatgttc ttgacttttc aacaccagat aagatttcgg gtcttgagaa gacatggcaa     71220
     aacattttaa ataacgtagc agagggcttg aaggatagca caatgctgtc gttgtgttcg     71280
     agaatactgg ggaagctcaa gagctatcac aagacgtttg tagtagatgg gaagatgttt     71340
     gaagagacaa acgaagattt aaaacttatt aggatagtgg tggatggaaa gcatgcagtt     71400
     cctgggcatc tcttgttttt cgatgcagtg cagaagataa ggggggcctt tgagctgtct     71460
     gaaaagagct ttgggccttc tggtgttctc accaggttca ggagtctagg gccccgatgt     71520
     ggagatggag aagccaaagg cgcagcattc agactagtgg agaaggtggt gtgccatctg     71580
     atgggatgga actcctctgg aaagaacttg attcagaatt attacgagtc tcttctggag     71640
     gagatggaag agataggaag cattccagac acattggatt acatacactc ggttcatggg     71700
     gttatctctt cgttaggcgg gaggaaatgc tcggacagtc ggcatttggc ccagtatgtc     71760
     tacgatgcaa tcctcacgct cttcagttgc catggaaccc cttttgaaaa gaaagctctg     71820
     gaactccttc attctatttt tggagtcgtg atactccaca agatatctac tcttcacagg     71880
     cccaagggga agagatacac gattcttctt gacacagaca cattccttga tgcacttgta     71940
     gagtcgtttt gcgataccga gaactcgatg cctttcaagg tactctctgt aatgtttgtc     72000
     cagatgtacg agatgtttgg aaggaaatgc gaatacttct gtgttgagat gtatagggct     72060
     gttttctcca agctcaaggc catgtgcaag tcttcgaaca agagatgtag agacgctgga     72120
     atcaatggaa tcatatgtct tgcagcaaca atgcctattc gagagcttgt gatgctccga     72180
     gtcccggaag attcgttttc atgtacatac ctttatcttc ttcctcgggg atccgaagat     72240
     ttctctcttc ccctccggct ggttgtcttt atcttgagat tcagatacaa gggaattagg     72300
     aattatttgc tctcctctgg aatggagagg cacttcatga tgtcgcattt cagaccgttt     72360
     gttgcaggcc tctttgatgg gagaaaggat gttatggact tttcccaagc tgtgttgaga     72420
     gaagtgttcc agagctatgg gcctcgccta ctggaaagac acaaggacat ggtttttggg     72480
     tttttcaaga aggaatatgt aataggaagc agggaaacaa tgataatgca cttgaaagtg     72540
     tttattttct gcgttcgaga gggcaagtgt ccgtttgacg attgcgagat gaagtatctt     72600
     atcgagaagt ttctggatgg gattgcaagc aacgaggagt ggagaggaac tggaggggtt     72660
     tatatgggct ttgaccactg tgaaagagac gaaagcacaa acaacgagga cttttgcaag     72720
     tgcaacagat gcgggaaggg cgaagaagac acagagattg ttctaggagg gatccataag     72780
     aagttatctt cgctatctat gagggatttg atggaaattg cgcttaaaaa caaaatggat     72840
     gtggtttgcg gagattgcaa gaaaaagatc tacagacata aggaggagtg gtctcctaga     72900
     ttcagtaacg agggggagga gttgatttac tggataagag agttttattt gcttgtcatt     72960
     gagtacagga agtcctttga ggagataaga acagcggttt tgtatttatt gagatatgtt     73020
     tcggacgatt cctcggatta cctgcagaag gcacacaata tacggccgca agagacagaa     73080
     gaggtaatat cagaggaagt ggagaagtgt ctgtctgaga aggtcgacta caagatcctc     73140
     aacatgttac tgtgtgcaca ttcgatatcg gggattcggg agaatccaag ggtagggatg     73200
     cttgttctga agattctgaa agaattcagg attccgaaag agtttgcaat aatagcacag     73260
     aatgacagat actcgatgct ggcaaaggcg tatgaaatag gaattagact gaaaaaccag     73320
     gaggggctgt gcaacgagat tctggaaaca tactttgtac ttgacggata tgccaagagt     73380
     tacacttcca ggatgtatcc tcgaatgatt aagtatgtag aggatcttgg atcacagttt     73440
     gtaagttgta tgttccgaag aattcaagac ccatcggctt acgagttgtg ttcacagctc     73500
     tgcaaggact cggccaagct aagagaaatg gtgtttggaa tgaaggacag acttgcggag     73560
     agaatatcgc aaatatattg cagactggaa ggaaatgact ccatagaaaa ggatgtgttt     73620
     gtgtattcgt atcggtttct tgatcttgca gggtatgaga tgaagcctgt cgacattcag     73680
     gttattcttg ggatttatgc tgatgtgaag acaaagccca gacatgctgt tgaaatgagg     73740
     gggctgataa atagatgcat cgacaggttt tctccagaga acctcgagac actgttcaac     73800
     atagacccat ggtttatgtc tgtggatggg atagacccgg gatatcttac agaggggctt     73860
     tcacccttga ctcttagggg gattatccgg agtattgata agagaaacag acccatgatt     73920
     gagaatttga gcctatctct tggagaaaac agacacatgc tgattgagat gtttgtggag     73980
     atggggatca ggtctgagaa gcttattgga tactgcaagg agaatctaca catcacgaac     74040
     cttagagggc tcctgctcta ctatctatgc acattcgagc ccttgcatgt ctattttgaa     74100
     ctcctgttca agctccctta cgaagacagg aagtacacgc tatactgtct agaaaggatt     74160
     gtcgatgttt ttgatcctct tctctttgaa gagataattc tgattgtgct gcgctctgaa     74220
     gtaaggttca agacaagtct ctgtattctg tttcctctac ttctatcgag gcccagtctt     74280
     atcagcaaga agattgtgct tgagcttaca gggtcgatct ataagcttct tgattcagag     74340
     aacttccccc agcagagaat ggggtttaag ctgtttgaag ttctatacaa caggtgtcta     74400
     ttaggagatg gatcggggaa tatatgcaga gagtatgatt ggatcataag gaacatatac     74460
     actctcatgt ttgtgaggtt tattcatatg gatcaggact tggatggaga tcttcttgaa     74520
     aagtacaatc tggagcttgt ttttgagttg gtggagtact ctcccaagga gctaaatctt     74580
     aacaacatgt tcagctttct cgaagcggag attctgagca agaagaatga ggagtacaag     74640
     atatggtttt tgaaaagcat tggaatggcc atagcgccgt atttccgatc aagggctttg     74700
     ggaatcaagg ttattgagta tctggtgcgc attgggatgt ggaattacaa gcttcttcgg     74760
     gaggagctgg gggttgttgt gtacgacccg agcctactgt acaatctcct ttgcatgctt     74820
     tgtagcaaag ctggtgaaag agctggtttg ggatgcaagg ctcataggga tgatgtagaa     74880
     aacatggaga tatgcttgat agtgataaga catttatttg cagagtacaa tagagagaga     74940
     ggagaagcca accagaaata tgtggaggaa ggacttgaga agctgttcta tgttttatct     75000
     ctatactctg aaatgaagaa tattgtgtgc tcggtaacta ggctgttcgt ggaagcattc     75060
     aaggacaatt cctctcggat agatccatta gtaagcaaga taagtttctt gatgtctgat     75120
     ttcagaacgt cgcttgcaga caagattgaa atggcttgtc tcttgagcaa tcgagggcat     75180
     gacaatgagt ttcttagtga gatgctgctt ccggccttca acaattatct ctactctgga     75240
     gttacctttc cgtcaggcct gcagaagttc tttatgaaag gagtcagttc gaaaaacagc     75300
     atcttgagga atggatatct agatctgatg aaccgcattg ttcctgtaag caagtggatg     75360
     agacttaagt atctgctgga aatggaatgg aagcacaacg caaagatagg atacacaatg     75420
     acggcgatga tgatcctttc ttgccacaca gcagaactgg aggcagaaaa gtactcggaa     75480
     ataagaccga gcaaggatat tgaatatcct tggtcacggg aggggatgag atgcaaggga     75540
     aatgtgagca gatgcagtgg acttgttgcg aatcttcttg aagatgttgg cctatacagg     75600
     tccaaggcgt cgaagccaga cctcctggaa attctgtacc acttcgacga ttccctactt     75660
     ccggtgctat ctggagtctt aagaactact gtatgtggat tggattccga gaaatgtaaa     75720
     agcatattcg aaggctttgt gaagttctgc tcggaggtta caggagaagg gaaacttctt     75780
     ggagcccttg ttaggggtct tgggcctata tatagacatg cagatctata tgagcttatt     75840
     aaggtattcc gaggaggaga gggatggtac acgctactgg agtatgcaga tgataggcag     75900
     aagacagaga tatacaggag attgatgaac ttggatgaat actttggaat gtcgcggtcg     75960
     gtgtgtattt ttcctgagac gatgcaggca tatttccttc agcaagtggg aaagaccaag     76020
     gaagcacagg atctctatga ggagatccaa gccagagcag gaaagcacaa gatatctttt     76080
     gacgaaaggg agtacaagct gtggcaagat gagtgggtgg catgtgcaaa agaactgcag     76140
     caatgggatg tatgctacga tgcaggagtg gagatcgggg atggcttgct aagtggagaa     76200
     tcgttgtggc atctttcgaa cttcacaagc cagaaggcag tggagaaact caaaagcgtg     76260
     attggcaagg gagtaggatt tgaaagagaa ttcctcgatg tatttgcaga tatatttatg     76320
     aagtattcgg cagagaggat caagggaatc ctaacaaaga acattgcaga gctcaggagt     76380
     taccccgtag gaagtggagc aaacctaaga aatcttatgt atctgcagat catcatagaa     76440
     atggttgagg cagagcctat ttttaacgac aagatagact cgatagaagc attgacatcg     76500
     atatccttcc gatggaagga caaggagccg tccatctaca gctcttttgc agaatggagc     76560
     ctcttcaaga catggagaaa acatgtatat tcgagattgg gaatgggaga gaagatgtgt     76620
     ggcagagaga tgggatacaa gcagccagaa agaggttaca cagaggagat gggaaattcc     76680
     ttgggtagaa agcctatagc atcgcatttg ttttctccaa aagagatgaa tgagaactat     76740
     gcaaagataa aaaaggaact ggtggcccga ggaacaaacg aattggcaaa gactctgaac     76800
     atgttttcca aggcagccat cgaccatgga tactatgatg tggctctatt ccatcttaaa     76860
     gaagtctttg acctaagcag tgtaaaggta ggggatgcct tccagaaggt tgtttatgag     76920
     ctactttgct ttctcggcaa gaaagagtac aagataggag ccgagcagtg catgtcggca     76980
     aacatacaac atttcagtga tacacagaat tcggtactat tcaacatcaa ggggctgttc     77040
     aatgagaagc ttggaaaggc ttcggatgcc gaaaaattct atttgcagtc tgcacagata     77100
     tgcaacacag ttggagaaaa ctggctcaca tgggcgagtt tcttgtttgg taggatcgat     77160
     ggagatgctc cagaagtaaa ggaagacgtc tttgttgctc ttctacaagc cattacctac     77220
     tgcaacggcc caaatgcaag gaaaggaatt cttaagatga ttctacttat gggagagcat     77280
     tcctcgctct gtgatgtgga gttgttccac aaggttcttc aagagattga catctctcga     77340
     tttatatact ttattccgca actgattggg ctactggaaa aggaagactc aaggttggtg     77400
     caagccatac ttggcaagat ctcggaagag tatccgcaag cagtgatagg gccccttaag     77460
     gcagctaagg aaagaataag aagaagcttg gggcttggaa aggaagatat agaatgcaag     77520
     gtgggggaac acaaggtaga aggtagaagt agcgaagatt caaagagtct tgggactgga     77580
     ctggtgactg gagagaagaa catgtttttg gagaatgtta tgtgtatata caaccggata     77640
     aaaaacgccc aaccagggaa agagttctgg aagatccttc actatcttca caattcgctg     77700
     aactccttcg cctttaagga ggaggagctt gtgtatctgg agatcgagaa gatcttcaac     77760
     agtgctgtgt cgcatgttgt gcatggggct gttccatcgg gccttggcca tgctaagatt     77820
     ctgaacgagc ttattttcca ggtttctgtt tcttccctaa gccggaaact caaggaagag     77880
     cttacatctt ccattctcaa gatgaggtgc atctgccctc ttgagaacat cgatgaaatg     77940
     gtacggttca aaagtaaggt gcagaagatt gtagaagaat ccttccatag gatggacaag     78000
     tccgaggagt ctgaggtgaa tctactgcta tacagatccg actacaagca tcgagtattt     78060
     ggacaatact cggaaataag aagaagttac aagagccttg cgagcataga gatgtttgag     78120
     cctcggcagc cctacatgta cagaaaaaga atgggatgca atagaattca cctgagagga     78180
     agcgatggga agatgtacag atacgagatg aaagagttaa ggaagatgag gttctctgag     78240
     tttgtccttc cacagatatc tttgatgatt aacgaggcga tgggcgagga caccaacttg     78300
     cgaaggagag gtgcggagtt gaggttgttt gttcccttta ttgctagtga agttcttgca     78360
     ttgaaatgga tcaaggagcc tgtctattac atggatagta tattggaaga ggggctaagt     78420
     agatacaaga tgaacattga tcaatgtgtg cttctttatc ttgatcactt tgcaactatc     78480
     tacgatgggt tagactcaag tccagggcat ttcgagaaca gatatcagct ggagaaggga     78540
     ctcactgcaa gcctaaagcc gaggattcaa ggagacgaat gccccaatat aaggaagaaa     78600
     aaaggctttc ttgaaagcaa ggagtcgcag gagaacctca taaacaatgt tagaatggtt     78660
     attgagaggc agagggagaa gtacacaagt ggtttgagac agaacgaagt cgagtgtctt     78720
     ggatgcaatg aaagaggaga ggggatttct ccatgtacct atagatatga aacctcaaag     78780
     cggcaaagat acatggctta cgagaaggta tacaacacct tcaagaaaac tagctttgtg     78840
     gatgattact tcaagcttat ttatggaaac ctgggaggat acttccgatt taaaaacaaa     78900
     cttctttcca gttattcagc caacagtgtc tttttgtaca cgttctctgt tgtagacagg     78960
     aggccaagaa accttgccat caccaagact accggctgtt ttatgaatag agacgtctgt     79020
     tgcgaggaag ctgagatatc gagcaaagga aagggaatgg gggccatagg accaggatac     79080
     cagaagctct ttgggaaaga agggatagaa ggcacaatgg tgtctattat gtatcattat     79140
     gccgggatgg taaacaaggg agattggagt aaggatctgg tgaaagctct acttgaaggc     79200
     aggtttatag acatgacggg aaaaggactc aagggagctc acaaggaaat gctaagtaga     79260
     gtctctgaga tgattggaaa aggcgaggat gggacccata atgtgattcc gatggttagt     79320
     gagtggatgg acatgttcaa gctagcacag attgatccaa gacatatgtg ctggatgtga     79380
     tgaccaatta aagtcgattt ttgttttcta ggattcttca tccaaaagaa tgggtgggtg     79440
     atgacccatg gatactgttc tggtgaagct tgtggataga aaccatgatg gggctgaaca     79500
     caatcccttg catgtgagta catcctttac caccgaggat cttgagcgct atctaagatc     79560
     tgtgcttggt ggagatggag gctatcgatt ctatatagca gggcggggat ttgaaggaag     79620
     tctcctgaag gaaatcagct caagggctct agaggtcgaa gaaggactga ctattgagta     79680
     cgagcttgat cggaattata cacctgatgt tttaatagaa cttgaggatc tggtgtcgtg     79740
     tctaactgtg gtgaaaagca ggcagccgga agtatggtgt gggacccatg gggggaggct     79800
     gaagatatat gcttatcagg atggagtaat caacctgatg aaaacaacag actacagtag     79860
     agttcggggt gtttcccgtg aagatggtct atatatctac aattctgcag gagaggtagt     79920
     ggagtttgaa tcgggagatg ttctgttcaa ggtggatgga gatataacct gcatagcctc     79980
     ttcttccaat gtggtttctg ttggaacaca cgagggagag tgctatgtgt tcaaagaagg     80040
     acttatgaag gtacataagt ttaaggcata catatcgtct acggctatga ataaagatga     80100
     ggcgatgttt gtgtgtgcag atggaaatat aggggtcttt ggaatctcta ccaacacgtt     80160
     caaaacaaag gaccttgggt atggcgtaac ttcttcggat atgggagatg gcaaatatgt     80220
     ctttggaacg tcatgctccg gtctggttgt ggaaaataaa gaagaatcca cgtttgtgag     80280
     tacaggcatt agatttagta acaggatagc aatgtataac ggttgcatag ttgctcaggc     80340
     ctcccaatat acaatatctg tggtagatat tggagaccac cgagaacttc ggagaatcac     80400
     tgtggatgag tgtatctcgg acattggatg gatagagaat cttctgattg ccggtgtcgg     80460
     gtccagaatc catggatata ttatacacaa cttggaatag aaattctagt ttattttgaa     80520
     ttcctagaga gcagctggaa caaacctctc aataaagcat ctttggcctc tatatgttat     80580
     caatgggact cctggaattg tctttattct ctgcctcaga gccgtatccg aagttgctac     80640
     aatatagcat cgatgtgcag aaactctgtt gaagatgcag tcgtctgcgt aagtcccctt     80700
     atggtcgcat tcgagccttt ggacatcgtc ccctctgatc agtgcgagtg caacacggaa     80760
     gggcctccca agcttctcca gttctccaac cacacattct ggaacacata ttttgatgct     80820
     tgcattcact gtcttcatta gctgttccct gatgttgtac ttctttctta cacagtcgtt     80880
     gatgaagttt gtatcgagaa tgatattata aggaggcctg agcctgtggt tcagtagaaa     80940
     tccttctgtg tttcttggat tttcaccgcc atcgtgaaga ttctcaacag gccttgtctt     81000
     tgccttcttt ctatccaaaa tgttagcaac tctcttgctt tttattgcat gcttcacccc     81060
     catcggtctc gagaatacta agttttttat ctaaatcgga ttccccttcc tcctccgctc     81120
     tgcatctgtc ctgatatata ggctcaaaat gcccatgggt gtagaaaatg gagatctcgt     81180
     gaggatggtc tccataaaca tcctcattgt cttttgtgat atctacaaca tgaattcgaa     81240
     caggtatact tccagaaagg gcacatatct ccacacatcc ggcctgctgg tagaagggat     81300
     ctacaaatct tgtgcagtac ttacccacgt ccatctccgg gatgtagggc tgatacttgt     81360
     ccggattcga ctttatttct gttgaaacaa taagccttag gtatgcaaca caatcatata     81420
     gtgagtaaag aggaacatct tcgatctttt ttgtcccatt ggctatgtcc accaagattt     81480
     cgacaaacga atcataaaac cctttgtatc ccagctcgtc tatattatac aggcagaggg     81540
     cttcattcgt cttatcaaat gcatcaatca aagttcttaa tagaacatcc ttttcagcag     81600
     ccaggaggtc tgcaagcgca actgcatagg agatgtacag gcaattccca tcccggatac     81660
     attctcggaa cattgtgtat gactccatga ttctctgaat ccgagctgtg tacaagggat     81720
     cgtggaagta cttatgttct ataaggttct tcttggcgct ggtggatgcc tccgtatttg     81780
     ttttctcggc cattggaaag gggtagagga aagaaggaaa attgttgatg atctcggcat     81840
     agggagcatc tccaagactc caaccagcag aatacttcta ggagttttcg ttttatcgga     81900
     aatatatgaa aacccttgag gcatgaaagg aaacaaactg aagaaggagt gcatttccat     81960
     cttcatgaat ctggcaaaga caacccttgg atctgggata ctaagatatc cgtttctctt     82020
     caagacatat ggagtttggt acaccattct tctaacgtct gtgtctgctc tggcatcgct     82080
     ttttgggctg tggctgtaca tcgacttgaa cgacttctat ggcctggaca actcgatgtc     82140
     gacaatagca agatacatat atcctccatt gcagccgatt gtgaatataa ctgtatgtct     82200
     caagtgcttc ttggtatgca cggcatacct tgttctactc aaaaataatc ttccaggaac     82260
     agtaaaaagc atttttgggc tgcagagcag ctaccagacc ttgtgcatgc tcggggtggt     82320
     tctatgtgtg tttccatttg tgtccatgca caagatcgat aagctgaggt atacttcttc     82380
     gtttgggctc tgtgctgtca taggtcttat gctgttgtcg gtatatagat atgcaacagc     82440
     cgaggatgtt cctgtctttg aagagacaaa gggaggaaac tatctgggag agctggggag     82500
     ctttgtgttt gggtttactt gccatcagaa catattttct gtgcagaacg aaatgaaggt     82560
     gaacaacaag actgcgttga agatgactgt gtttcttatg ctagtggcgg cgtcctctgt     82620
     atacataact tttggactca ccaattatct tgttcttggt aacgggatga aggagaactt     82680
     tttcgaaaat atacccgagg gcatgaagag cataatctct atgttttatt ttcttgttgt     82740
     gatgatgtcc attccgctgc agacacaccc gtgcaggaag tacttcctcg atctctttga     82800
     cacaagatac tctacagatg gaaaatactg gcacttaagg tttgtaacca gcctattcat     82860
     aatactacta tcgtttataa ttgccatgaa tgtgtcgaag atggaaaaac tatgcgagat     82920
     tgtgggagga accttctcgg ctctcatgtg ctttatattt ggatcgctgt actactttat     82980
     tgccttctgg aacagaggat ttgaggtgaa gaaaatactg gcgttctttg tcctggcata     83040
     tggtgttgcg gcatttgtct ctctgttcct tgcgccatga tatgtccaaa gcatttacca     83100
     gaggccggtt ggtaggggag gcccttcctt ttgatttgtc tccagagagg tccaaagcca     83160
     attcaactat caataaacta gtaccaggtt ttttctgata atacaatatg ccaatcctaa     83220
     aagtacttct tcctcgaatt ctaaaacact ctgtttcaga acaaggcctg aaaatataaa     83280
     ttcgccaaga acactactgc agacatgaat ggcatcttaa gcttagttct atttgaatgg     83340
     gccatgtgct tagaaaaggc ttttaaccct gttctcccat cgaccgactt ttataaacca     83400
     agcacaacat cttctgataa tggacttctt gggccgaaga ttgagggatc ggctggtatt     83460
     catgatccag tggcttttgg agaaggaaac ttctacaaac ttctgcatcc atcgatgact     83520
     cgactaacca gctatctgaa cgaccacagc tcggagttca gcgaatggta tcgctctcct     83580
     agcttgatca tgggcgagga ccttaaggaa aagatcatct ctggtctgta caaggcccaa     83640
     cccaaggatg acaaggagct caaggagttc tggggtctga taatgggaga gcttcttatc     83700
     agagaccttc cggaactgaa gtcggacctt tcgagcctga aggaaatcca gaacgaagag     83760
     gataagaaga agagcatagc cgagttcaag gggatcaatg agaagaggat caacgaagaa     83820
     aacaacttct ttggaacagc attgtttatt ctagattgtc tttctctcgg agtaaccaac     83880
     cgaaatgcag aaatctatcc cgatgttatt gggccgttcg tggatgcagc aattgccttc     83940
     aagactcttg agcatagctt ttcaaacata attggatctt ctaaatagct taatttgtgg     84000
     gaagcaaata ggctctaatg aagaataaaa tgtatatatg tggtttcgtg atattagtgg     84060
     gtccctgcgg ccggcccgtc gaggtggcgt ggccgagcgg tctaaggcgg cagacttaag     84120
     atctgctatc ggaagatgtc gtgggttcga accccaccgc caccattctt ttgtgttttt     84180
     cctctcctca gagtcctgtc tctggacaat ctgccaaaga cttccaagtc taaaaaacga     84240
     aaagatttaa tagagagtta ttggtgatgt ttgattggtc ttgatcatca ctcccttcaa     84300
     gctttgcgag cccttcttca ggtatgagat gagcagcccc atccctgtct tgatgttttc     84360
     atatatgtgg tctgtttcca ttccagtatg gcccacagga aacgaggtaa ctgcaaagtc     84420
     cttgatacgg agcttgtaag acctttttgc cgtctcaaat accgtcttga tatcgtcgtc     84480
     gttcttaaga atatagggtg tctttccaca ccgaagaatg ttcttgagct ggaagacctt     84540
     gttatatcct gggcagagga taaaatactt gttcctcttc agcacctcgt ctctcttggc     84600
     tttcttgttg tctccgctga tctcttcaat agacacatac ggtacctctg catcaacaca     84660
     tgtctgaaca tgtgcctcat cggcaatcac aattgtcttg tcgagtcttc gcaccttgta     84720
     gggaaaggcc atgtccttcg acagtttatt atctttcctg gcatcatatc ccttgagatt     84780
     cacttggatc tggatcgtag ctgtcttctc tgcatcctcg ttttccttca gacggttgat     84840
     aaccgagata attctcttgg cctcaagaaa tgcaagttgc tcctcgcctt gcttgctcat     84900
     cttacccctt gtaaaggcaa aaatttttaa atcttcttca ggatccgaga aagatccttc     84960
     tatttaaaca gctctatggc attctatttt attatgtctg tgttcttgga aatgaacata     85020
     gcccatggca taggccctgg tcacttgtaa ttactgtagc tacagtggat cttgtagtgt     85080
     tgtagcatat tgtcttttct agagaacctc ttgttgcagt ccttgttcaa gcacttgaac     85140
     ggcctcaatc tggtatgaac tatgtagtgc cttttaattc tactcaaggt aggcaactcc     85200
     atagtgcatc cctcgtacgg gcagacgtag gactttaccc cattcttgga tttataaggg     85260
     aacatcgatg tttcaaagtc tgcaaagctt tctattcctg ctttccttgt atcggaatcc     85320
     tcctgagata ccgacagcga ctcagaatcc ctggacttcc tgcccgcctc aggctccact     85380
     ttatttacct cttccagcac ttctctcttt cttcttttta tctccctttt cttctcgttg     85440
     gcctctctgt tcatctccag gtgtctgttg atccttcccc tgacaatcct cctcatctct     85500
     tcctcggcct caagaataag aaaccttaag gacattagct tctcgtcaaa ctcctccgaa     85560
     tcttcactat gaactgacca ttggctctca accgacatag gcgtgttcaa tccgtcgctg     85620
     ttgtcgtttc catggtattg ggtgcggcac ttctttttgt ctctagggtc tatgtcttta     85680
     ttataaacac ttccccatgg gtagcctaga gaagaaaagt ctctgttccg ctttctcttt     85740
     tctcctcgat atctgttccc tcctcgtccc agctcataga accctagata attgctatcg     85800
     ttttcatctc tgcttgattc ctcgctgaag tcgagccttc ttcgattcat ctccactctg     85860
     ttcttcaaca tttcttcctt ttccctctat cgattatatt tccgttccat gattaaggag     85920
     ttgtactcct tatctgctat tgccaatggc agggctcgga acaaccatat ttccacccat     85980
     cctccaaaga ctcgtaaaga gtgcagccgt aaaaatttgt agaaacaaag gcctcactca     86040
     tgatattttc aataggagac cagaaaaaga aatacgagac aagggaggat gtctcagggg     86100
     tggtacaaga aataaaaaag tctctggacg agcttgtgga ggttgatctg tctggaaacc     86160
     atttttccga agaggcaatg gaagaaatat gccatgtcct cagggatgcc aagaacctcc     86220
     acgtgatcaa tctttccagt gcgtttctgg gccttgacaa ggagaagctg tactctaatc     86280
     tcgccatgct ttcaaaaatg cttgccaatc acaagataca gaagattgac ctgagcgaca     86340
     atgccataag ctcggagttt ccccctgagc tcggggagtt tatttcctcg tccactgatt     86400
     tggtccactt gaaaatgaac aactgtgggc ttgggaagat cggagggggt aggctgggag     86460
     agtatcttct caagatagca gacaagacca agctggaggt ggtggatatt gcccagaaca     86520
     ggtttttctc ttttccaaag gagctttccg acgcactgct aggattcaag aatatcaagg     86580
     agcttcgaat ccagtacaat acaatcgagg aagagacaat gcttgagttc ctaagggcat     86640
     tccagagcca ttctcttgag gtgcttgaca taagagataa cttcctgtct ctagaagggt     86700
     ccagatacct ggggagtctt tattgtgaat ggaatctgag ggaactcagg gttggagact     86760
     gtatgatggg aaacgaagga gtgaaggatt tcctcgaaag agcaaacaag aaatttgtgc     86820
     caatggccct tcctggggat tacgacggca agagggaaag aattgccctc gatatatcgt     86880
     acaatgagtt tgagcaagat gctgttgaaa ttctcaagga cttctgcagt cggaatatca     86940
     tcaaggagct cgttgtgttt ggaaactact acgacgacat aagcgatatc atcgatattg     87000
     ttgaaaagca aggaggagtt gttataactg aggagcatac agatctgtcc agcgactctg     87060
     ggatggagat agatgagtct gtgattgaag ggattgcaga gatgtaggcg gcagggattt     87120
     ggctgatcct ctacaggaat tccttagtct acggtgttgg aataaatggt tgttctgcct     87180
     aagcgcttct tgtgttgact gggagtaata tctggaaatg tttggaaaat tggacgatga     87240
     ataaaatgaa aacccgtctt tggggtaaga agaagatttc tggatgatca aaaaagacgc     87300
     agaagagatt cttatggatc ctcttgcagg aaacatcatt gatgcagagg aaatagttgc     87360
     aaggagcgag ataagggatg agcaagcaag agttttggaa gaggaaaagg aagatggaag     87420
     aaaaggatcc agatataaaa ggctgcagac tgtcttggga gaagggacat tcaagaaggt     87480
     ttacaaagca gttgaccagg aggaggggaa ggaggttgca tggaatgaga tcaaaatcaa     87540
     cgagaagggg caggacagca aagagagggc attatttgcc aatgaaatag cactcctgaa     87600
     gtctatttca catcctaaca tccttcggat cctcgactat tggtttacgg ctgacagctt     87660
     tatatttatc acggagctga tgagtggagg aacactccgg gagtacatag cagagatagg     87720
     ggatctgaac gtcaagctta taaagaagtg gggaaggaac attcttgagg gacttgtgta     87780
     tcttcacagc caggatcctc cgattatcca ccgggatatt aagtgcgaaa acatctttgt     87840
     gaatgcagct cttggagagg tgaagatagg agatcttggg gttgccaagg aaagaaggat     87900
     gaaaagatat actgttgttg gaactccgca gtttatggca agagaaatgt ttgagggaga     87960
     aggatatggg gagaagatag atgtgtatgc atttgggatg tgtttgattg agatggcaac     88020
     gggggcgtat ccatataggg aatgcactac ggctgcagag gtctacaagg caattataca     88080
     aggggttcct cctgttgtct tgaactctat caaggacgta tgtcttagga atctgattat     88140
     gaactgctta gtctctgaaa aagacaggct aaggagtgtg gattgcttga agcaccattt     88200
     ctttgacagt agtagcacat gcaatggaga atgcattcct gctgagtgca tgtctggagt     88260
     tcctctgaca gcacctgcaa atgacatgga aataagtttt ctgtcattca aggataatgt     88320
     aattacattt caattgtttt tcatgagcat ggcaaggttc atcaagtttg actacgacct     88380
     ccagtcagac actgttgagg atgttgcaaa tgagatgctg gaggaggagg tagtatctga     88440
     ggatcagaga gacacgcttc ttgggcttct atcacgggga attgaaaagg caaagcagcg     88500
     gattgaagag atggagtgta agaatacaga agaagagatg aagaagttga gcatagatac     88560
     agagaaggaa aagagcaagg cagaagggcc gaagaatgat ttcaacaaaa taacggacag     88620
     aaatctgagt atagaggagg ttgaatcgat gctggagata gatgtgaagt tttgccagga     88680
     tgagaccagc cgtctgtata cctggtccag aacggtaaga aatggggatt cgaaagtggg     88740
     ggtggaaatt ggatcttctc cagaccattc gccagaacta ttacccagcg aaggaataat     88800
     ggaggaacag aaaaagactg ggggaggaaa gtgcttcgac gaactggagt gtcccaatag     88860
     aaaatacgat gaagatgtct ctattgaaga gtttgcagca gatgtttcgg ttgcgacaaa     88920
     gagatcatct gaaacagtta ccaattggat aaaggcattc aagtcgaatg atatcgacag     88980
     tgtgtttgaa ctaaagattc ttgtggacga ggactgggac aagcttgggc tcactgtttt     89040
     ttcgagccga gccatgaaga acatgctcta tggagttggc aagattcctc tgaaggagaa     89100
     gcagcttcct accaacacct cgatcaagga ctatggagga ggggttgaga tcaaagagtt     89160
     tctccatgag atcggggcta tagttggtaa ggacaagtgt gtgtctatct gggaaagcaa     89220
     acttcttgca caggatatta ggactgtcga ggagctccga tcgctgcacc aggacgactg     89280
     ggatagactg ggtctatctg tgtactcgtg cagggtgatc aagaatgtta tttacaaaaa     89340
     aggaagagta gtgctttgct gagcgactag ctggctcttt acgatattaa agaacgggtt     89400
     tctccataat ctatcttggg attttcgcag tctgttatgt gggagggatt ttggaacttt     89460
     ctggagcagg gaagttaaaa gaaaagaagg gtagcccatg agaaggatga gcaagagcta     89520
     tgatgttatt cagattccag gaagtatcaa gcactcagac cttcccgaga gaatggagat     89580
     tggaaagccc tttgagatta acggagactt gtatatatgt gagaagaggg gcgaaggaat     89640
     gatgaaggta tgctctgaga gcgagggaag gacaagcacg cctgtcttga gtcgggggtt     89700
     ttatgtagtc cggaggatgt gaatatgtca aacatatttc ataaatgatt gaagtctata     89760
     taagaaagct aaaagaataa acaacaatga agacagaaat taaagacttg tttgagaagg     89820
     acaagaacag agccaagaag ctggccagaa aagttgatgt gggaaaggag tttatatact     89880
     atgacttctc gaagactcat atcacggagg aaatcattga cagatacttg gaaaagatgg     89940
     atggatttgg agaaaaaata gagggaatgt ttaatggaga aaagataaac tataccgagg     90000
     accggaaggt tctgcatgtg gcactgaggg ataaggaagt gctgaggggg atttctggag     90060
     aagatgtgaa gctggactcg gatcgtaaga tggtttatga cgagttgatg aagatcaaag     90120
     gatttgtaaa ggatttcgat gaaggaaaga tatgtggagt aactgggaag aggttagaaa     90180
     tgattgtcaa cataggaatt ggaggaagtg atcttgggcc caggatggtg tgcgatgcac     90240
     ttgagtacta tggaaggaag gggataaaga cttactttat ctcaaacatc gatgcaacga     90300
     acacaatcaa ggtttttgag aagattgacc ctgaaagagc tttatttatt gtggtaagta     90360
     aaacattcac gacgcttgag accatcaaga atgccgagct ttcaatgagg tttctggaga     90420
     agaggcttgg taaagacaga gctgagattg caagtaaaca ttttgttgca gtgagctcga     90480
     atgtagacga agtcaggaaa cacaacattt cccgtgtgtt ttcgatgtgg gactttgttg     90540
     gaggaagatt ctccctgtgg tctgcagttg ggctgtcaat agttctctac attggatttg     90600
     ataacttcat atgtctactt agaggagctt ctgttgttga cgaatatttc cgaaagagcc     90660
     ggggaaggtc aaatgctgag atgatgcatg cgattgtgga gctgttctat tcggagaggg     90720
     gatacaacaa caagtgcctt gtctcctatg acgaatacat gaggaaattc tatctgtatc     90780
     tccagcaagc ggagatggaa agtaatggga aaccatcgca aaaaacagac acaggctata     90840
     ttatatgggg aggaaaaggg acggatgttc agcattcgtt cttccagttg ctgcaccaag     90900
     gtaccaggaa gatcttgacg gagcttctga tgcctctcaa acctttacat tcggaggagg     90960
     agtaccatag gatggttgtt gcaaattgct tggcacaaag cagaggcctg atgattggaa     91020
     aggaagatcc aaatccagag aagtcatttg aaggagacaa accaaccgtt acagtctgct     91080
     actctaagct cacgccggag acacttggcg ccatgatagc gcattatgag cataagatat     91140
     tcattctggg gctatactgg ggcataaact cctttgatca gcctggagtt actctgggaa     91200
     agaagatagc cattgaagtg cttgagtcct ttgatgagaa gaaagagtcg gagaagtttg     91260
     atgagtcgac aaacgagatg ttatgcctga tgaggagctg caagaggtga tctaagatgg     91320
     gctcacgagg gtactacctt aataaaatcc tctctttggt ttgtgttctt tgagatttgg     91380
     tgaacgtttt ttggaggaga ggaaaaccct taatgttttc attcaaggaa aggatgaaga     91440
     catttgcttc atggcctgag aactacggtg ttgcaacgcc ggagggtctt tccattgcag     91500
     gatttatctg cctatctacg gaagagaaca atctgacggt ggagtgtgtg tattgcaata     91560
     agacactgga atgctgggaa aggacagaca tgccggcaaa ggagcactac ctccacatga     91620
     acagctgtcc acttttcaat gtgaacagat tggagagcag ggtaaagatg ttcaatggat     91680
     ggagtctcaa ggaggcgaag gcacttgcaa gaatggggtt tgttaagtac aaccttggag     91740
     agtcggactt tatcttttgc tataaatgcg gatcgatcaa cagaagccat ttgtgtgaaa     91800
     gaaagagagg gcatccatac agcttggaga agcgtgggag tgtatttttt tacgacttaa     91860
     tcgaaggcat ttacaacaaa gagctggtga agcttacaga gtacaatgta tatattccac     91920
     agcacaccaa agagtttctg aaagaagtta ccggtggttg tttggggtcg gtttttcgaa     91980
     gtgtcgagga tgtgatagaa gaatacatgg gaaacaagct gtttgaaata gacaaggcta     92040
     tgagccatga tatcgagaga gctcttgatg aggtggtggc gggaattgga aaaaaaagcc     92100
     tgggatgagg atgtaggcaa tgatacgatc ttggcctggg aaattagagg taaatttttt     92160
     ttcgagtcta cccttgtgaa tgaaggtaag tggactttga aagactaatt tcagttaaac     92220
     atagcatatc caacgaatgg tacacagaag atgtttgaga ttgaaagaaa ggtggaatca     92280
     aggctttacg acaagaagat aggagatcag tttgatgggg gaattctcgg agaagagttt     92340
     gaaggaacaa ttatggagat cacaggagga gacgactatc agggctttcc catggtaggg     92400
     gggcacttga cgaagaagag agtaaggcct cttctatcga agggggatac aggataccga     92460
     tgcagacgca agggagagag gcggcgcaaa agcgtccgtg gatcgattgt ttctgagcag     92520
     acctgtgtac tgagcctgat aattctgcga gccggggaga aggagataga tgggcttaca     92580
     aatgttgtca atgacgtttc ccatcttccc aggaaggaga agaagcttag gaagatgttt     92640
     gggattcctg cagaggaaga aaacgttgtg ggatacatca ggaacatatt taagtctgaa     92700
     tgtgaagatc caaagaagat acccaagatt cggtgcaatg gaaagaaaat aaggaaggaa     92760
     aaagaaagaa gagaggaggc taggaagatc agaggagaaa gaagaagaat attggaggag     92820
     gaaaggaaag catatcttga gaagtacttc aataaagcct gatttatttt ctagcaattc     92880
     tgtctatggt tccaggcccc agtccttgca ccattctggg aggttggcta catactctat     92940
     tccattatat gtgtatttcc aagcatgaag gcagatatag tagtccttag tgacgaaaga     93000
     cctattgttt cttcctttac aactccttac cacatattcg tattttcttt tatcctcaaa     93060
     gccacttatc tctgcattgc aggtgctatc ccaaagtggc tgtggcaact ccccatcccc     93120
     atacatgatg tcgtttacaa ttggaaatcc tatactttgg agatgaattc taatctggtg     93180
     tgtgcgcccg gtaataggcc tacattccac aagcgaatgc ccatctttgt atgctagtct     93240
     tctgaacagt gtcaagcatg cctttccctc gtcgctaaca tatctgtgct ttccttcggc     93300
     acatgagatc ttcttatcta catctatgct gtcaggaaat agtccttgta cctttgcgag     93360
     gtagatcttt ctggcttctc tgattgcttc caagcattta gaatggtttt tcactgcaac     93420
     aatcaagacc ccggacacag gcatgtccag tctgttgatg caggccacct tcttgtcccc     93480
     aaagagtgct cttgtgaccg agtattctct ataacctccg gtggggtggc atggcatccc     93540
     cggaggcttg ttcacgacaa catagtcttg ctcctccctt attatatcta tttccggatg     93600
     tgccggctca tgaatgtgga ctgtatgcct tatgacatct ccgattcgga gtattcttcc     93660
     gggttccaca atctcttcgt taactgttac tgccccgcat tccaacgcag acagaaaata     93720
     gtccttggtt cttgttctaa attccgaagc aaggacatct atcaccggtt tctcacacca     93780
     ccgtccctta acgttggttc tgaatgtgaa gaagtattca gcctcccctt ttgccatccc     93840
     agggctgtat tttcggcttc aagtccttgg ccttgcccac atgtctattt aattcttgga     93900
     gaaaaaagcc tttcccatga ggaacacaaa cgaactggag ctcttgcaaa taacaagtat     93960
     aaccgctctg tctctggttg tctattcgtc tggatacaga aaaagcatac tcaacgactt     94020
     tttgttctac atagttcccc agtactgtgc cgtgatgttc ccagacagaa tctggagcac     94080
     gtatctttgt ttagccatgc tcttcagata ctcacaaatc cagaaatcta caaacagcag     94140
     tgaaaaaact acggtaatcg gatatttaag attcacaata tctcttatag ttgtgattgc     94200
     aatatacgga gtggacttct cgatatttga cagaagactt gggaagtcgg atttttttgg     94260
     aatccaaatg atggacatag gtgttggaag cttcatttat aatagcgggg ttgtgggctg     94320
     gaaaggaagg cctttaagaa ggtgcataag gtcctaccta gttcttgtta tccttgggtt     94380
     tgtaaggtac tttgttgtta agtggtttaa tatccacgta aatccaagag agtacggaat     94440
     ccacttaaac ttttacttta tacttgcagc tgtgagactc atatgttcac tgatagggtc     94500
     cagatacaac tttcttctgg gactcttttt aataacaatc tacgaagtcg ttctcaagtt     94560
     ctctgggttg gtgggcttta tcttttctga tcagaggaaa acattcctgg agatgaacaa     94620
     ggaaggacta gtggcggtta ttccatacac atcgatattt ttgatggcat cggagattgg     94680
     aagaatatgc tcctccaagg acaaggtaag aagcaaggga tttcaagtcc tgaggatgtc     94740
     gggtatattt ggatgtctct atgcagtgtc gcagctctcc aacgaaggat ctagaagatt     94800
     gggaaatgcg gggtttgtgt tctggatact tacccttcac accttgcata tggggatata     94860
     catgcttttt gaaagtgtga ttgtcctaca caatccattg acatctatgt tctgtagttc     94920
     caacatgatg tttgtatttt tgttttcaaa cctgattgtc ctacttggaa acttctttta     94980
     tgatcttggg agcttttcac ctctagttgc acatctgaac attctttcct atctggtgct     95040
     tgtgttttcg attccagctc tgttggcgag taggtttgac ctgcgctgtg tggggctggg     95100
     ataccggtcc tgaaaagaaa taaaagctta ttggaccctt ttgttggtat gaataaagaa     95160
     ggccatcgaa tggaactgga ggatgaaaga catgccataa tattggagaa tgtcttctat     95220
     cttctttgtg gggttgacac cacccactta aggataggag tgaaggacaa gaggtatgca     95280
     ttgataggag acccgacata tcctcctcag cttattcttc cgtttgaatc gctagcaatc     95340
     aatgtaagag ttctcaacaa gtttatattg aagtcacagt attcatccga tacaattcga     95400
     gaaatggtag gagactactt tgaggctaag atcggcaagt acttgaagga tcttatgggc     95460
     cttcgatgcc aaacacggag tattgagatg cttatagtga gccttggaag ccgagtcgag     95520
     gagtttgatg agatgaagga aattgtagac gacattaggg acatgtcggg agttcggata     95580
     ctgaaccatc ttaagaaaag aagggataga actgtacatt ttctaggtct ttatgatgat     95640
     ctcattaatc cttgcattca ccgaataaga gaagaggtgc aaggttgggt tacagaaggg     95700
     ctgatgccga gcagtgagtt tatggtgaag aaaaacgagt gcttgaatga atttacggat     95760
     tgtgtgtgga cacattggta taggattgcc caggataacg tgccatactt tttggaagat     95820
     cacaagaacc ttatctacaa ttgtggaagg atagtcaatc tcggacggat gatccatggg     95880
     aaaaacatat tccacaactt ggcagaggag tatgggaatc ttgggcttac agggttaaat     95940
     tcatatctga acacacagtt tttagagtca cttcgaagta gccttgaaag ggaattggat     96000
     gtaatgtata gatatcttct ggtgaatgag tcgtctctgt acttagacat tttcgaagag     96060
     ttaggggacg agatgttctt cccaaacgaa agaacggttg ccaagatgaa tgccattcga     96120
     gagtcgaaga atgcggaggg ccttatcttt agaagatcgg atgtgcccac caacaagtat     96180
     atcctggaga ttttgaatac caagatggag gcctgccagg aaaggcatct tactatgcta     96240
     cagctcctga ctgtcgaata cactccatcg atcctcagga atttcttgtc accaagaacg     96300
     gtttctgagc tggagataat ttttaggttc ctatttacac ttactgggtt gtcatactac     96360
     atgagcagat tcaaagggtt ttggtttgca aggatggcgg caatggttgt ggacaaattc     96420
     aggttttcga tccattcaag aatgaagcct gttagggtag aaaaggatat ggattacata     96480
     agagactcca tgctctcaag tactaagaag tggcttcgag acatgtatct tacaagcggg     96540
     aaggcgtatc atgcatggag caattttttt gatctttgtt tcaacttctt ggacgtcgag     96600
     tacaagtctg cccttagcaa ggaagagata aagatgtttg agggtcgatt ggttggaagt     96660
     atagtacttc ttaaggatgt attggaggtt accgagcaca gtgacttgtt tgttcacttc     96720
     ctgggtagca cccaatggat agacataggc ggtggttctg tgtagaactt aaagttttcc     96780
     gagtttgtga agtttcagct actaaaacct atagaattaa tattggaacc tactcttcca     96840
     atatcaggct acttttataa atgagtgtca gtgctgtttc agattgtggt gatttacatt     96900
     cagaaataca ctggaagata aataaacaat ggagagaaag tctctaggca agccttttga     96960
     aagaaaccta aggactgtga atggccttgc agatggggac tttgagattt acaaaaaaag     97020
     cttcttcgaa tactacgacg acctgatacg gaagtacttt gggacctttg agagatttaa     97080
     actgaggcag ggtaagttgg caagggtatt cttttcacac gacaccttga agcttcattc     97140
     caaatatgaa tgggttgtta cgaggctcag ctatggaaag gagggagagc tgatggttcc     97200
     caggaacttc tacatactga cagaaacggt tctgagcctt gactgcaagg ttggagggat     97260
     cttccgggtc cgaaactcaa ttactaccat taaggaatgt gtagatgcaa tcaaccagta     97320
     tgtcagcaga aacctctctt acggggaggc tcgaagactt ctcatccggg atttcaatgt     97380
     gattgatctc acgacagcat ttaaggagat tcttagagaa tactccacca ccattattcc     97440
     agagagcttg atagacacta tgtttaaaat agcaaggatc gagaatagag acgatcaaat     97500
     cattctttgc cagatgctat ttatatcaat gccaaaaaca aatagacatg tcctggaagc     97560
     aacaatttac tttttatatg tgatgcatga cattgcaaca gacggaggaa agaaccacaa     97620
     gaataacatg aacatggagg ggatttccac cataatgatg ccaaatcttg tgatcaaacc     97680
     ccacaatgaa ctggatctag aacaagttgg agttcttgta aattttatga agatgttctt     97740
     tagagacttt gcaaagatta tccagcttga tccgaacatc atggaacttt agcagcctaa     97800
     ctattcgacc aataaattca aaaaaagtta tttatctctt tgctggtttc caaaggttat     97860
     aaccgaacaa agtagtccct ggacggatgg gattgcttcc gttggataaa agggccagaa     97920
     gaatgaatct ctttgatgtg ggaaggtgta tacttgaagg aattgaatac attgaagaga     97980
     ttcttgagtc tggaatcaac attacaaagg aactcgagaa ggatctttat gtgccattgc     98040
     tactctcgag gctgaagaca gatggattta cagaagagga ccatagaaac agcacatcca     98100
     ttgtttgctt gacgcctttg ggcccgggtt cgttgaacaa gtttctactg cgcttcttca     98160
     agggctttgc acttagtagc agagatggcc aaatcgacat tgagttttcc tcgagacagg     98220
     atgctacaaa gtgcttgtat ctgagtagca gagattttac ctttcttcgt ccatctggct     98280
     atatagagtt ccctggggat ggagaagtaa gagaggcagg aagcaagtac tgcaaagatg     98340
     ttccatgcac tgtagacaag attctgctgg gcccgctgga catttccgct tctatccttc     98400
     gggatgctct tgacgaaata tctcccttgc aaagctttag agaatgtgga aatccctcat     98460
     attttgtctt tacattcagg aacccggaac tttgtgatcc ttttgtaaag gccacaagcc     98520
     atatttttat ctcggatgtg ggacggcctt tggcctctgt aagggcttac aagggttgtt     98580
     caatactgaa tctcggcagg agcattcctt ctcttatgcc aagaagaatg gcagggccta     98640
     ttgcgctcag caaggaaaag accaggatag tagtgctttt aaatgttata ggcccgtggg     98700
     acgtagatgt ttcggaaatc atcgaggcaa ttagaggaat gtgttctaga aacgaaggag     98760
     taaaaaatgt gatggtacct cggagcaaac actttcctgg aagacagcct gggagttctc     98820
     gaatatttat agaatgcaag gacttggaaa cgtcccagag gattcacaat gagtttggag     98880
     ggcttgttta taaggatcgg attgttgcag caggatacta tcccgagctg aattactttg     98940
     ctggagaata tgaatgacat gacgtttatt aaacaaaaga catgcaaagg aatccaaaca     99000
     aaccaggatg agcgagaaca agattccttt gcatgtaatg ttggttacct atttgtttta     99060
     tcttattgtt gttttattag ggcatgccag agacacattt ggaaagtggc tttttcccaa     99120
     gatacagaaa agaaacaagc tggacgacaa cagggtgccg ttgtacagca acttcgaaag     99180
     cttcttcaga cgtcggattt tcaaacgatt ccaggactgc tgggaaaacc ccatttccgg     99240
     agtcccgggg aggtatatca ctgtcctgga aaggataata gaagactcca atgaaagctt     99300
     tcgcctaaca ggaaagaagc taaagctgct caatctcggg tcttataatt atctcggctt     99360
     cagtaacaac gagggatcta ttgtggagaa ggttgtggaa gtggtacaca agtaccctct     99420
     tgtactgacg gcacctgcaa gggaggtggg aagctacgac ataatcaggg agttggagga     99480
     ggagatggcg tcttttctac atcaagagga ctgtatggtg ttttcgattg gatatggtac     99540
     aaactcctca aacatacctg tgatatgtga ggaggggact ctcatcctgt cggacgagct     99600
     taaccatgcg tctctgataa caggggcaaa gatcagcaaa ggagttataa gagtatttga     99660
     gcacaataat atgaaggacc tagagagtaa gcttatcttc aacatttccc aaggccagcc     99720
     cttgacacac agagcatgga ggaagattgt tgtgattgta gagggaattt actctatgga     99780
     gggaactatt gccaacataa agaagcttgt tgagttgaaa aagaagtata agttctacat     99840
     atttgttgat gaagcacact cgataggggc actaggggcc acgggaagag gagtatgcga     99900
     acatgcaaat gtggatttca gggaggttga tattcttatg ggaacattta caaagtcttt     99960
     tggggggatg ggaggataca tagcaggatc gaagaagctg gtgacatggc taaggttcta    100020
     tggtgatttg tctctatatg gagaccaaat gccaccattt gtatgttcgc agatactgga    100080
     gagcttgaga tgcataaaat ctacggagct tggaaggttg aagatcgaaa agctcaggtc    100140
     gaacacggtt ctcatgaggc agaaccttgt gaatgctggc ttttttatac ttggagacga    100200
     attctctcca gtcattccga ttctgatagt gtgccctggg aagctggttg agttttcaag    100260
     gctctgcatg atggagggga ttgggattat tgttgttgga tatccagcaa ctcctatatt    100320
     gacaagcagg gttcggctat gtatttcggc ctcacacacc acagaggatg tgatgaaagc    100380
     atttgagatc atcaataaag tgggggacaa gcttggagtg aagatttgta aataaatggg    100440
     gctacaagca ataaagatga ggagagggga tcccatggag acagaagtat atgcagtgga    100500
     cttcaatccg agtaaaaaca tactaatata tggagggggg gacgagagat gcattgttat    100560
     ggatctcggg accggcgaca ttatcagtat agtagagaat tttaacgact cgataatatt    100620
     ttgtaagttt gtagatgatg agagattcat tgttggatcg ttgaatggaa cgatatctct    100680
     aatgacatta gaagatgaga ttaatagtgt tgaggtggga gaagacatct caaaaatgaa    100740
     aatagatgga gataagcttc tagtggggac agcccaagga aatgtgcatc tattcagctt    100800
     ggacctgtgt attcagaatg tctgcattgg ccagcacaac gaaatacaag acatatgcta    100860
     tgaaagaggc aaggcataca ccctcagcga ggcaaacttc atggtatttg atgccaagag    100920
     ccaccagaag cttatggact tgtacgtgag ggatggaagt gccatggaca agatccctgg    100980
     gagcgatgta gtatgcctgg ggttgaaggg atgtgctcta atacgaaaga acgctcatct    101040
     tctgggaagg atcgagattg aaggaagtcc ggaatgtatc ctgtacatga acaactactt    101100
     tattgttggt ggggattttg atcatatcct tctcattaac atgcctatgg gaatgcgcac    101160
     attcaagata ccgattgagg gaatgtcagg gatatcgagg ataagaggag atggagaaaa    101220
     tcggattgtg tttggaacgt ttggaggagt ggttggcttt ggcgacataa gggatgagaa    101280
     aagttttaag cttgtcgaag gtggagtggg atgcatcttt gatctgtgct tcaaggacgg    101340
     aatgatatat gttggaggag aagaaggatt taatgtggtt gatgtaggaa aggattacag    101400
     tggagcagca aaggaatact ttccttcgag ctaatactaa taaagacgaa tcattcaaat    101460
     gatcttgaaa acagctcttt ggatattagt ccatcggagt tgaacatgtc tatcattatt    101520
     gatatatctt cgtctgggat gttcatgtca agcttggacg tggccttttt cagtgtttgg    101580
     aaggagatgc aatcctctcc tgaggagaga aagtcaaaca caccgctaat ctctgtatcg    101640
     catgacgcaa actctactgc attatattct attctgtttc ccatcttctt ttttcccagc    101700
     ggttgtttga gtatactcag gcaatatcct ctgtattcct cgtagctcag aaaccctttc    101760
     ttaccaatat caaatgaatg tggatcattc gggaggctct tcttttccat taaagtatgg    101820
     gcactcatac tattctcccc aaatagctat agacacttgg atgaacgaaa aggagccagg    101880
     aaaagaagat catcggagta caggaaacag atgtccaagc gctagtagaa tgattcctac    101940
     agaactggag caactggatg ccgttgcaga tgcttgtctc cgggtatcca cgcccattaa    102000
     gagagaagga tatgaactgt tctccgaaga cttacagaga acaaaagacg ggtcgatgct    102060
     caacgacaaa ataatcaatg tgtacttcga gctccttgcc aaacactcga agactcctat    102120
     gtatgtcttt tccacattct tctacacaac cctgagcaag aaaggagtgg aatgggtgca    102180
     gagatggact tcaagcgcaa acatatttga gaacagattg atatacattc cagtgtatgt    102240
     tccagggcat tggatgtttg tggctttcga tgtcagagag atggtgcttg agcactacga    102300
     ctctatgggg aatgtctaca cagatgtagt cctgaggata ctagagtatc tgagaagtga    102360
     gtggaacagg atctacggga gaaaactctc tgtgtgtgtt cggattaaaa gaaaaatacc    102420
     cttgcaaaga aacgggaggg actgcggggt attcgtgtgc atgtttggaa gatacaggtt    102480
     agacggagat ggctgctggt tctcttcgaa cgacatccca atgtttagga agatgatgtt    102540
     gcatgaaatt atagatggaa ggattctgta ccagacattc cattggtcta gccagattcc    102600
     ctgtccaaaa gaagatacaa gcactgtaat tgtagatacg aagccttagc ccttcaaggt    102660
     tatgaagaag acgccaaaga ggaaagagac tgaagataag aaggagtccg tagaagaaga    102720
     aggagaaatc atcgagcagg taggacatct cagaagggag atgtgtgaaa agaagcttgg    102780
     gtttatagat aaaagtgttg cagatgaaat aagggagttg gtaagatatt ctctatacga    102840
     agatgtagag gagtttgtaa acccttgggc tgcaaatgaa gtgcatggga tttcaaacga    102900
     catagctgca atccaagcag ctctagacga ccagcaataa acattctgtc tatatctata    102960
     caaagaagat aaatattgga aagaggctct ttatttcata catcataact aggatgaatg    103020
     tggattttcc catcgctgat aaacaagaca ccttccttac ctataaggaa agacaggacg    103080
     ttttctgcct ttttctgttc ctcgattaag gctttctcgc tctctatgca tgactcgctt    103140
     tccgatagaa atgcctcgac cagctcatgt ctttccatcg gatccctcgt ctttataagg    103200
     tatatgaaag agtttgttat tcttatgtag tccttgctgt ttatcatgaa tccgggctcg    103260
     tcggcagtct tgggaactat ttctatgtcc tcccccttga cctcaacaac actgcttttc    103320
     accagcctgt acgcctcctc cacatactcc tttgttacaa actcgttgtc atggatcttt    103380
     gcaagcgcct cgctaagacg aatcagactc tccaaatgcc tgacagtcat catgtagttg    103440
     ttgctgtgaa caagactatc ctgccttatc ccaatgtact tctttataag catctccttt    103500
     gcttcatccg tcatttttgg ggtcttcctt cttgcatagc gaagatacaa ctttacttgc    103560
     tcctttgtaa agtaacttgc tagcatccct ttgtctgtaa tagatgcatg gctgttgagt    103620
     atgtgtgttg caacattcct gtcattctcc atatttgcat cgtcgatcag tacaaagtac    103680
     agatcaaacc tggacatcac tggtgcactg agatttatgt tctgtcttag agtctttttc    103740
     ttatcgtatc tacccttgat tggatttgca gctgccaaga tgctggttcg ggcattcagg    103800
     gttgcattta ttcctgcttt cgaaatggtt attgtctgct gctccattgc ttcatggatg    103860
     ctcacctgat cccgaacatt catcttatca aattcatcga tacagcatat cccagtgtcg    103920
     ctcaacatca gtgcccctgc ctcaattgta aactctcctg tttctccatc ctttatcaca    103980
     cttgcagtaa gccctgcagc actactgctc ttcccagaag tatagacgct tctaggaagg    104040
     aaggaactcg cctgcttcag aaactgggat tttgcagttc ctggatctcc tacaagcaga    104100
     acattgatgt ctcctcggag gctggttcct ccctcagcct tctttccaac ccctccaaca    104160
     agaagaagta ggattgcgtt tttgattgag tagtgcccat gaatcgacgg aaacatactc    104220
     tggctcaatt tgtaatagag gtcagatgca gatctcattt cgtttatcac agctagttct    104280
     tcgttagtaa actctccatc ttccacaaga ctgcaatcag catgtatgca cataaagctt    104340
     aacttgtagt tcagatcctt gatgtttatg ttccttttct ttttgatctc gtccagctct    104400
     ccgctctgta caggaacagt cttactctga ggcatcatca actgtatcac atcgggaaca    104460
     actatcagat atcctgtcat cacaaccttg tctccagccc ttatcttttc aaccaagtcg    104520
     tttctgacta tcacatccat gctccttgga agtgatccag gaggaatctc ttctgtattt    104580
     tcttgcacat gtatcttttg ccaattcaaa aacttacttt tgtcaatctc gagcttccat    104640
     agcctcctat ttgtgcagag gtggtttgga cataccaaag gctcggtgta cttgaactcc    104700
     tggaaaacat cactgacaac tgaattacag accttacaca caaaagtccc ctgcgaaagt    104760
     tccggcctta cttgcgtcgt tctggtaacc gtcccactaa agctcagaag ctgccccagc    104820
     ttgtcgctct tcagctctcg gatcttgtag accacctgac tgttgtggaa cgacacctgt    104880
     tcaagtgcag tagaaaactc tcgcatcgta tatacagcta tgcttctgtt aatcctatcc    104940
     acgtcccttg aaaagtttct caccaggtcc gtgtacagat ccactgaata ggaatggaca    105000
     tcctgaagat caaccaatag tactgtttca ttcctgtata tggcctgttc agcctctgtc    105060
     ctgatcttcg atgtgttgtc gaggaattcc aggaacttgc tgtgaacctc ctctgtcatt    105120
     tgaggataaa attttttcct catctaagta tctccccaga cgtcccggcc ctcctcactt    105180
     tacaggtatg acctttctgg tcagtctgcc tggcgccact cttctgatgt tcgccccaag    105240
     gagaacaaat gcataaacaa aggtgtatac aaacagagat gcaaatcgga gacatacctt    105300
     tggagagacg taaggtatgg agataaccac tggagcatga aagagaacaa aaatacatat    105360
     tgcaaagttt atcaatgcta ttcccaaaaa ccttctgttc ctctttatat tttccatcca    105420
     gggtctaatg gcaccccaat atcatgtgtt cttctcattg taatccccac aataatgctt    105480
     gtagaattcg ggggagaatc caactctatg gcttcccaca catagaaagc ccccctgtct    105540
     gtcgagactt tctggtggaa tcccaatggt gcccttcgac gtgtcagatt caatcaatcc    105600
     cgggcattct accttcaaaa caccgctcct tggccttgca acgaagtaca ccatacttga    105660
     agtgctccag aacttgaagt aaaatggaca cgcaaaaaca catccaggcc taagccggta    105720
     tatgaaaccc tttccaaaga tcacatattc ctgatcgtat ctcttgtctg gatataccct    105780
     atacacagac cctttctttt ccatgcgttc gtttctctca ctgtacagtt catactcatc    105840
     tatcttaccc tccccaaata gctcttctag cttgagaaac aggaatgtcc catcgaagta    105900
     ctcttggatt ctaaaaggag ggagaacttc atatatctcc gactttagta tcttctgctt    105960
     tgtaacctca atgccctcga actctctgta tgacaggatc cccctctttt cctcgaatga    106020
     ataggactgt atatagttta cagtcatgag gcttggcttg cctgtatgta cacagaggtt    106080
     gtcgaatatt gaatggcgac tgagacgcac aggaatgtgg tactcttcac gagggggaat    106140
     tctaattgtg ctgtggtgta ctatctggac aaaggtacaa tctggaggac agtctggaag    106200
     gaagatcatc ccctcataca acctaagcat ccgcctatgg gttaaagaat ctctggatct    106260
     atggctgttt gctcttagag gagaagaggt atggaatgtc taggcccaag gactcttgca    106320
     attttttcat tctctgaaag taccccaaat gaagataaac tttggataca taactcctgt    106380
     gccgttgaac acggagctga tagacacgtc ccttagtaaa acccagagga gaacaccaac    106440
     agtcatccac ccccaataca acattatcaa gataaggatg ttctatatga ggaaggtaaa    106500
     gcatgcagga agtgagtttg gatcgaggct tggaaccatt cttacagact ttccaaggat    106560
     cgaggacatc catccattct acagggattt gatcaatgtt ttgtacgaca gagaccatta    106620
     caagcttgcc cttgggcatg taaactcggc aaggaatgcc atcgacaaga tttcaaagga    106680
     gtttgtaaag ctcctgaagt ttgcggacag cttgtacaga tgcaagcagc tgaaaagagc    106740
     agctcttggg agaatggcat ctgcaatcaa aaggcttgga aagactttgg agtatctgga    106800
     ggaggttagg atgcacatga gcaggctgcc gtcgatagac ttatctggaa gaactctcct    106860
     tgtgtgtgga tttccaaatg ttgggaagag ttcgtttgtt aggaaggtgt caagggcgga    106920
     tgtggaggtc cagtcttatc cgtttacaac aaagagtctt tatgttggtc actttgacta    106980
     caagtatctt cagtggcagg tgattgacac gccgggaatc ctagaccagc ctcttgaaaa    107040
     cagaaacact attgagatgc tcagcatcac tgcacttgca cacatcaagg ctgttgttct    107100
     ttactttatc gatctgagtg agacatgcgg atattcgatc agcgagcaga tagacctatt    107160
     caacactctg aatccactcc tgaattcgag catggtgatt gttttgagta agagcgatgt    107220
     ggtgaaattg tgtgatctgg aggataaaga aatgatcatg gagtttctgt ctgggaagaa    107280
     gtacatggag atgagctgtg aaaaggaaga aaacatagat gtggtcaagg ggatggcatg    107340
     tgacctcttg ctcgacgagc gatttgagaa gaagatcaac agcgacaagc tctgcgaata    107400
     catcaaccga atcacgattc tcaggccgaa ggaggtccga gaaaaggcag aatcgtttgt    107460
     ttgctcccgg gagataacag agattgaaaa tgagcaggaa aggtatcttg tcccttccga    107520
     gtacaagtac gacatcatac ccgagattat agacggaaag aatgtagcag acttctttga    107580
     cccagatatt gaaagaaaac ttgtggagat tgagaaggag gaagaggaca tgcttccgat    107640
     gtactgcaag acttacgatg tgttgtctcc tgaagaaaga gctctgaagg aagagattac    107700
     agtagggata gaaagaagga ggattatcaa caggcttcgg gaaaagaaaa gacttccgga    107760
     ttcatggaag ctgaggacga agaacagtgg agaggaagtg gaagtgagtg tgaagaaaga    107820
     caacaagaca cagatagtgc agccacctcg gcagccaagc aagaagaagg ctaggtttga    107880
     tgacaagcac tattatgaca gaaagccaaa gcatctttat agagggcgaa ggtgagctat    107940
     attattaaaa gatactagca atttgttggg agcctggcgg caatttttta ataaaaaatc    108000
     cttgatatgg gtaataacaa gattccaatg tgggagcagt gcaaagcctt tactcttgag    108060
     tttaattcct tggagaataa ggaaaggaca acctctatgc agtatgggga gcgcctatac    108120
     atagggtgtg gagacggacg tgtggaatgc tatggagaca agaagctgta ctccttccag    108180
     ggatttgagt tagagttcga ctatcttgag agctgtgatg tagccgagaa agtgctggcg    108240
     attgaaaagc tagattgcgg agggcctgag gagcttcttg ccgttggaaa cgagcgaagc    108300
     ctgaagatat ggaggatcag gaacaagggt cctaccaagg aagttgtgga aggaagattt    108360
     tcggaagagt atgattacac atgtgtaaaa gagtgtaaga atgtgcatcc gtgtattttg    108420
     aatagcttga gtcttaataa tgacaagcag tatcttctgt cctccgacta tctaaagata    108480
     aatctgtgga agcccgaaaa gatcgaagga tgcttcacga ttgtggatgt gaagccacac    108540
     aaatacagtg atctgatgtt tgtaatcaac tcaacgaagt tcagtagcga aatgaacatg    108600
     gtgtttgggt attcaacaag ctctggagta atccacataa acgatctaag actctcctcg    108660
     aagtcgttgg aagtcctaaa aatagacggg gtggatgtgg atggaattga aggggcagtg    108720
     aagtccattt ccgacttcca gtttgttgat tcaaacctga ttcttgccag atgtctcaac    108780
     tctgtcacac tctatgacat gagaaatccc aaggatagtg tttttactac tgtactgtgc    108840
     gacgatacag acgaaatcag ttctgtttat gagtctgatg cagtgtatac aaggttcagg    108900
     atttcctgtt caaacggcta tgggttcaca ggaggatttc aggatgcagt ccatatcgtc    108960
     aatctctcgg acggatcgaa ggaggatttg gaaatacctt gtgagccaaa gaatacagag    109020
     aagaaagaca agctcaagct agtgtgctcg aatggagaga ggtttgttgt tgcttgtgag    109080
     gacaaactgt ttgaatacaa gcatgtttag tcaagctctt gatgtgccga gagtccagct    109140
     tcttcccaaa gcaacacagt agcaaaccag atgttttgtt tatataaaaa gttgtttaga    109200
     aagaggcaag aaatgccaac caccaaaaac agaaccttat cctttaatta attatgcaaa    109260
     gtcatcttct taacatccaa aaaaccagtg cgagcaccat ccagaacacc atgaacttga    109320
     ttattgcagg gcgagtgcca gatacattct tccaagtctt cctcataagg tccaggcctc    109380
     cgaagataag accttccgag gtctccatga ggtcgtcgat tcttctgaag ctttcctcct    109440
     gaagagatat gtgcatgctt atctcttcca tgatctgacc tatctcgctg atctgcattg    109500
     atatcttctg cctctctttg atcctctcag ttaccacttc gctttccatt agcacagcat    109560
     tctgttgctc ttgcgagcac tctgaatcaa actcttttct cctctcagac acagcctggg    109620
     cccgagcatt cttttttctg gtaagctcct ttaatcttat atggtgtcgt gtcgccttgt    109680
     ttttgattat tccatcgaga tttgcatatg aagaagcctc ctggtcattt tggaatctta    109740
     tctccagccc agaaatctct tgcatctctc ttatcagctc ccgggcccta tctatctttg    109800
     actgcagagc aaacgactcg tatactctcc cattctccag cattctactc acctcggaaa    109860
     gtattttctc caccgtggcc tctatctcga atgcctttgt gtatggggac gaagaagaag    109920
     gccttccctg ttgaggaatg agtgtggcct ggataacctt cataaactcg ccggttctgt    109980
     ccatgcaggg ccttgcctat gaaatttaat gtatttgttt atgtcttctg ggccttgaaa    110040
     gtccctcgga gatgtttgaa tactatgagg aaccggttct caccaacgat cttctgtcgc    110100
     tggcgtacat tttggatggg aatgtcggga agattgtctt tacatcggag atggatccaa    110160
     aagtttttcc tagagatccc attgttccct cgaaatatgc agaagccctg tcctcgtttg    110220
     aaagctttct ggacttctac agaaatctga aggaagaagg ggactattca gaaataataa    110280
     cctactataa actcaagcat aggaagctgt cattcattgc cttgcatttg aagtatgtcc    110340
     acctcaagaa aggggcagaa aagatagatc aaggagaaga tgccggctac tacaacgagg    110400
     atctttataa aactttacta gagtgcaacc agtatgtctc caggagagaa tccaaagata    110460
     tgttcttggc tcccctttac atgagccgat tctataaaga gaatggggag cttgtgaagt    110520
     ctagaagact gaaaaaagaa gcacaaaaga tggctggggc ctcaaggaag ttggacgttg    110580
     tctgggaggc agatgacaaa acatacaggt cttttccgtg aaaacgcctt ctcgaagcct    110640
     ttctaaataa acactaacca tcaagctcgg gatctttacc ttgtatgaag tctacaatgt    110700
     ctgcctctat ctttccagag gcttctctat ccgacagaat ctggtcgcac acaaacttca    110760
     tgtagattgg aagcattctc attctttcct ccacaacatc cccactcatt ttgttccacc    110820
     tctttcttgg aaactccgga agtactttca caaggcatct gagcctggag tgaagtttgt    110880
     agaaatctct gtatcgctta aaaacctttg tgtaacgctt cttgaagctt ttgttattag    110940
     tgacacatac aacctcatac tcggtatatt tgccctcgac atttcttgtt ccgggaatcg    111000
     ttatttctag aacactctct tcttccatcg ggtttgtttc ctcatctagg ctttataacc    111060
     tctgtttcaa ttgttttaga tctgaatctt gtccttcagt ttctcctggg cacgtgtcct    111120
     agacctcaat aacttcgttc tgagcactgt aattttgttt tgaggaaagg taatgtctta    111180
     cagatacaag catcagaact ccggcataga agtccccgtc ctcgctttcc tttgcctctc    111240
     cagaaatact tttttcactg cttttcagct ctacaaacag acgcttcttc aaagattcaa    111300
     gctcttctat gccacagctc tcaaagtatt ccttgaggac agagaacgaa aaacattcga    111360
     aaagccccga ggaagccaaa ggtctttcct ctttgaattc tttaagtctc ttcctcagcc    111420
     tctcagactc ccatggaaat agtttcagga agatgcatag ctcctgccga accatcgatc    111480
     tgaacagaaa ttccctgttg ttctttatgt acacagactt ccggagacat tccacctttc    111540
     tcgactgcaa aatcttcacc tgtgttctgt aaacaagatc ttcttccagt agccggacaa    111600
     actctccaaa gcttggatcc accatcagcg actctacaga cctgtagatg atctcgttca    111660
     atctaagaaa tccaatcctc cttattttct tttgcaggcc tttgcatctt tccagatact    111720
     ctgccgagcc gtccttctgg aactggcggc tggcagacat aacatccttc attgtggaaa    111780
     caaccatgtc aagccccatt gaattcatgt ccacagcctc atcactcaga aagtccacaa    111840
     gatcatatcc caccatcaat gtgtttatag tctgtatccg actattcaaa gcttccagcc    111900
     tctccatgta ttctcttatc cgggtgctta gaatcttaaa accttccgac ttcctacgaa    111960
     gttgctcggc tcctgaaagt ttttcttcca gactcttgat cttttcctcc atggaaacta    112020
     acaattaggg ctgttcttat gtcttggaag acaaagtaca aattcaggtc cttgcacccc    112080
     attgatggag atcgggttaa ttggcctggg agttatgggg cgaaaccttg cactaaacat    112140
     tgccgcaaaa ggatacaagc tccatgtttt caacagaaca tcctcaaaga cagatagcct    112200
     tatccaggaa agaccggata tctgccctca ttattctgta gaggatctgg ttaaagggat    112260
     gaaaagctca ccaaagatca ttcttttgat gttgacctct gggaaagtag tagacatttt    112320
     tctggaggag cttggaaaac acctgagcaa agatgatatt gtaattgatg gaggaaactc    112380
     ctcgttcaag gacactatcc gaagaaacag ctatgggttt gagtttgttg ggtgtgggat    112440
     ctctggaggg gaaaaaggag caaggaatgg agcgtccata atggtaggat gtggcagaga    112500
     aacctgggag aaggttaggg ggtttctcac agacatttcg gcaaccaaca gctccacggg    112560
     agagaactgc tgtgtatggc ttggagaaga tggggctggg cactttgtta aaatgatcca    112620
     caatggaatt gagtatggag atatggcaat aatctctgag acctacctta ttctaaggtc    112680
     actggggctt gataacagag agatctcctc actgtttgac aattgggaca agaaggagtc    112740
     ggagagctat ctcctccgga tttcatgcag catcttaaga atgagaaacg agaaggggag    112800
     tgtgattgat cagataatgg atgtctctga gcagaagggg acagggaagg agacagtggt    112860
     gacttctatg gagatggggg tggctgttcc tgcaataatg gaggctgttg catctcggat    112920
     tgtgtcgcat atgaaggata aaagatgtaa actctcctca aagctggaga gtattaaggg    112980
     ggagaaaaga atatcaagcg atgctgtgag aaaaggattt tatcttgcaa ggatagtttc    113040
     atacatccaa gggcttaatc tgctgatgga agggaaggag aaatatggat ggaaatatac    113100
     aattagggac atttccaggg tttggagcga cggatgtatt ctccggggaa agcttataaa    113160
     tgcaattgaa gagatgggaa gggggcagga gggagatttt gaacttagcc cgggatttgt    113220
     gtccttgtgc aacaagaact ttccgtatct gaaggagatg gtgttatact cggtcgagaa    113280
     cgaggtggcg gttccaacga ttgcgtcttg cttgatgtac ttgagcggaa tcaaggagaa    113340
     agagggggga ggaagtatga tccaggcgat gagggattat tttgggtcgc acatggtaac    113400
     gatggagggg gaggctaagg ccgagcacat tgaatgggct taggcggggt tatgtttgat    113460
     taaacctttg taaatagaat taacaagagt ttataaagaa ttgttagatc ggtacccgtg    113520
     gaaatggaat gtccgaagat tgaattagaa acgaattcag atgcgtgcaa ttggactaaa    113580
     gaggttaaag gaggacctcg ggatgcagaa aaagatagat cagaactgcc tcagatactg    113640
     tttataacgt cgagtctcta taagtacaat gcatttcggg ggtttttagg agttcctgtg    113700
     aaactggtca gcttagagat ggaggagata caggggagca aggacgagat aatcatggac    113760
     aagcttcaaa aggtaaggca tcttgtcacc aaatcgaact ttgtgtttgt agatgacacc    113820
     agcatccaca tggatggact aggaggattt ccagggcagt atgcaaagga ctttctaaag    113880
     attggaattc caaaagtatt ggagattgcc tcaaaggttg ggggaggatg tgtgtactct    113940
     actattattg gagtgatgca tatggaggaa gagaagattg ttagcaaatt gttttctggg    114000
     gaggttacag gaagcatcat acagagggag ggatttgagt ccaatgagtt taaggatttc    114060
     ttccttccta agaaggaaga gtgtgaggga attccaagct cgataggaag ggttaacata    114120
     ggaagataca aggctgttga aaaggccaag aaatatttaa ttggaattgg agtgtatggg    114180
     ctgttgggtg gaaattaaag gtattttgtt aagtgtgtct atttagctgt ataggctcta    114240
     gtgtgaaggg aaatggattt ggaaaaagaa gcccttaaag tatttttgca ggatgcttga    114300
     ggatttggat gggtttattt tcaggcgaaa tggcaggcag ggaactaagg gacgaaggct    114360
     cttctctgaa ggaaaggggg agttggaagt ggctcgggga aacaccgatg ggatcttcag    114420
     ttttaaattt gtccgggaaa agaagagaaa ggtagacttg gaggtagaga gcttagggaa    114480
     gaagtccaag ggaaaagatg tggtatggac agaagaaaag ggcaaagaag ggatggaggt    114540
     atgcgaggaa ggagatatat gcagcagcat agtaattagg gaagtgccaa agaagagaat    114600
     gagtgtttcc tctttgcatg aaaaacttga agaaggaggg acactagggg gcttagttag    114660
     attatgtgtt gaatatgtgc ttgagaagaa gaaaacaggg tatggaatgg atttggggag    114720
     gaagctccat cagaacgaag acttgattaa gaagagggat gttgaaaagg aagtcgaaga    114780
     ggcagagaaa aagattgaat gggcttcctg cgaagaggag aaatggaaca gcttgagaaa    114840
     tgaggtggag aactctaatt taatcgagat tcgggagccc aaaaaaagag ttcgggattt    114900
     tggatatgaa gagaagatgg aaggggtgcg gcgagagttt tcagcaaaga tagaaaggct    114960
     tgagtttcta aaggagtctg ctttggcctg tgtttcccgg ataagagagc aaagcgagga    115020
     tcttcttgga cggatcttaa gaatcatgtg taaagaaaaa gaagtggata cgcttttcct    115080
     gctcaagacc ttatctagaa caagcaagta agaggttctg agggagtgtt ttatagaata    115140
     aaagtcttct gtagtctttt gagtttgtcc ttggaaaagg caaaggaggg gagtttggcc    115200
     gtatgagatt ggaaggggct gaggccagcc gccatagcta agtggttata gcgccagttt    115260
     agtaaactgg aggccccgag ttcgaatctc ggtggtggct ttgtttttgt atcccaggtt    115320
     cttccatttg gtttggccaa caaaataatc tggaagccat agccctaaat gtcacagaag    115380
     tctcagagag caagccttct atcagagtac tggagatccg tccagacctt cttaaaaaag    115440
     tgcatccgac cttcaagaaa ggaattctcg gcatcgatga agcaccatgc cattggaata    115500
     ggctttctcg ggattttggg atatggagta aagctaatac acattccaat taataacatt    115560
     attgtgagta gtaacccaaa caaggaataa aagatgtgtt tcaaagtatt tactttcgat    115620
     tctaaagtta cagcttttgg ctaggacttt gccgctcttc tgaacataag aaaaagaatg    115680
     aagaaaaatc ctattgtcag agagctcctt acagaaaact ttctgacaaa tccgtctatg    115740
     acgtctccaa aaacctcagc tatgattcgg gtgtacccca ccgatccgta tccattcttg    115800
     atcacacatt cccatttgtt gcacaactct tctattgctg gcactcttgt ggctgggtcg    115860
     catctattaa ttcggtaggc ctctcttgcc tcctctatct gatgctttat ctgtgtcctt    115920
     ctgttggtta tcttatacct tatgtctctt tgtaatccta tcaacatgta tagaacaatg    115980
     tagcacacaa atcctatcat aaccaaattc aatgccagat ggaggtatcc tattgccacc    116040
     ataggcagct gcccaatact cgaagtagaa ggccatctta tcctcttcag aaccgccttt    116100
     cttccaatac ttgagagctt gacaatctga gtatggtctt ctccagcaat agagacgtcg    116160
     atcttacgtt tcttcagtgg cgacaaatgc gagcactttg gagtcctctg tttgcttgaa    116220
     cacttccagt taaactcatg ctccacatcc ataggcgtct ctcctcccat tcgaaggatt    116280
     ccaaattctg ctttttaaaa catcggaaat ggaagggacc atctcatcat caagctctca    116340
     aagacactgt tcaataaact ggttttatta gaagatcact atatgaggtt cgtagccaac    116400
     ctcaataggc tgattgtttt caagagatat caccatttcc tttcttgggc cctcgatctt    116460
     ccttttgatt ggtggaagca ccattccctt ggattcggcc tccttggtca tctcggatat    116520
     ctcacggatc ctcttctggc tctcctcgca gcatctgctc tttctcacat gctcaacacg    116580
     tgcaatcacc ttcttgatca catacttccc tcgaactctc ttgtaaaggg caataccaac    116640
     agatctgggc tttacgtcat agacacgccc tgttcgcccg tggtagtact tgtgaggcat    116700
     tcctttcatc atggatggat tcaccaaaat atccaccatg tctcctatct catacttctc    116760
     aagatacctt gatacatgtg caaccccatg tttcctgtgg tcttgagaaa acagcgacct    116820
     ggttcctctt ctgtatccct tgctcctcat ttctagggct gtttttggag tttgaaaaat    116880
     ttgcatccca tgggcatgcc aacccaggat tccaaagttt atgaccccac cagttccaac    116940
     cattctacac ttcaagatgt ttcctccacc agcactatat cctctataaa ctctccccgc    117000
     acaacagcag agctttcgac atcatcgggc tcggtaattt cagacagtac aatattcata    117060
     aacgcatcgt atcccgccaa tcgccccttg attacttgcc ctcctccaat cctcactaca    117120
     actcttttat gcagtagtcc cgttaggttt ggaacagctc tctttcccat cggggatagg    117180
     aagacatttc atttaacaat tgatatgggc ttcttggttc cagaatggca ctcccggccc    117240
     agatacacat tcataatata ttccaaaggc acatgcagga tgtccgggcc gatagaatag    117300
     aacaaaaaat tttcaccctg aatggcaggc aagaagggca gcaagagagc aaacaccccg    117360
     agagacccgt ttgaaaagga aagactgata agagaaatcc agttggttgg tgtgtatggc    117420
     ctgaagaata agcacgagct ctggacgatg gagaaaatat tttcaaagga caaggaacgt    117480
     gcacgtacac tccttacatc gacaaatcca gaggacatcc ctatcaatgg aaggtgtctt    117540
     ctcaagaagc tgatgaagta cggaatactc aatggaatcg atctttgtga caaggaaaga    117600
     gttattgatg gtctgaacaa ggttcttgac ctcacaatca accattatct ggaaagacgt    117660
     ctccagttcc gagtgtttgc agcaggccta gcaaggtctg tgcaccacgc aagagttctt    117720
     atcagaggaa gatgcatctc aatcaaggac cagattgtcg atgtcccagg cttcatggta    117780
     agggcagata aagagccgct catcgaatac aacccatact cacgctttgg agacaaaggt    117840
     aaaaagaaag cagaggctac tgtggaaagg ggatgattat ttaataaaac ttttatcctt    117900
     ttgactttct tcccggatgc tatcaatgct tttcccatac cacttgtcca ttgtacagaa    117960
     taccctttgc tggacagatg ttataacgct tctcatggcc ttttctatct ctgcagaaac    118020
     ccaccccatc atgtaattgt tgatctccac tgttaaatgc ttataggaca ccatcatcgg    118080
     cattcctcta ttcttgtatg tttctatcca attttcatcc agccttccac ggccactctc    118140
     ctcatggtaa taaacagaag gatcaaagat gggattgatt ggaggggagt ttagatccaa    118200
     tctgatgctt tcgaccccac tgatgcgtgc aggatcgtac tcaaacggat tctcaagaat    118260
     ctctgctcca tccttgttaa ctgtgttgaa aaccatgttg aatgtgtcat tggagaagta    118320
     tctatttctg tagaatgtat ggcatttagt gtaggcattg tatgagattt cctcgactat    118380
     gcatgcatcc tctggaataa ggctgtgaag catacgcggg aaccgggatt ttaagtacat    118440
     gactttatgt gttttgctga cctttccaag tgtctcgtgc acaacacttt ctgctttcag    118500
     gatctctacc ttcaagcccc cggcattttc tgattcggtc attgctgtga ctgtatagaa    118560
     gtggcccact gcatactcgt cggtggtcat cggaagaact gttacatata tcttctccac    118620
     cttggccatt gtgttccgga gtctcccttt atttatcata gaagcatcca gcagcattat    118680
     gaacttgaca attaaaataa gcaaaaggag gtagtcagga tgacgtgaaa tagaaagttt    118740
     taatctaggc gaacatggcc ttgaacttgg gctcgaacat agaatggaag cgcacaatct    118800
     ttgatctgtc ctcgtcacat agaccatagg tgtcgtacag ctttataaga gacagaataa    118860
     cattgttaac tacattcagc gacttgaaaa gctctcctgt tccaatgcag ttctcttctg    118920
     caattcggtt ccaatttccg tggcggaaga agtctactag atatgagttc tttaccttgt    118980
     cgagattctt cacacttaaa aaggagtcga taatatgaag gggtgtatcc gacatctcct    119040
     gcaaagactt cagaattgga gagtatagcc gggtgacgca agccttggag atactgttga    119100
     ttttcttgca aaactcgtaa acagccgggt ccaaaggagg gagcgtgcat cccatatcaa    119160
     atagaagagg ctttgtttca aagaaatgtg ccagtgcatt cataagggtg gtagggtcca    119220
     gaggaaggac tctgctctcc agaagaagtg caaacgacag gatctctgga tcagagtccc    119280
     tgtttcctat aacaaggtcg caaagataag accttgggag gaagtatgga ttgaggagtc    119340
     tgagttggta gtctacaagc tcggctctct tttcctcgga ttcatatatg ttacttaggt    119400
     cgtaagaaga tgagctgttc tcagatatgg aaagctttcc aatagacctt ccaagctcgt    119460
     cttgattgct atagagagta ctctcgagca aaggattctt tacaagggaa tccttcatat    119520
     taaacccgac aaagcttgtg tttgtgtagg tgtaaacacc ttttatgttc ggcaggagag    119580
     acaccatgag gttctgcacc cgttgctttg gtattcccat gaacactaca tttcctagag    119640
     tgtcaaaacc ccttcttcca gctctccccg ccatttgctt gtaattcatt gggtccagct    119700
     gcaaggagtc cccggcaaaa acaacggttc tgcagggcat gttaattcca agagctagag    119760
     tctccgttgc aaacagaact tgcaggtgct tctgcctgaa caggatttca acaagagatc    119820
     tatacttcct attcagatgt gcatggtgaa cccctattcc gcgataaagc atgtcaataa    119880
     actcaaagtc tgtgttcttt atgaacttcg tctcttccga gatctcgtaa tcagtcagct    119940
     ttgtaagagg atcaagaaag gtatatttga tgttcttctt atcactcctc atctggaagc    120000
     tcttctctgc tgcaatcgac tcttcaatcc agctttcctt tgtcttctcc acatctctgg    120060
     tcctctttgc ttccttcttc atcttttcta ttagcttgtt cttcttcttt tccatatcct    120120
     gagactctag ctgcctgtat actttcaggg caagcttact agcaaagtcc ctgtctgtgt    120180
     taaagacaat gcatggaaac ataccccgct ccttaagctc cataagaaga tccagaatgt    120240
     tttcaagaag ataatcggtg ctatagtcca caacagtctc aaaagccttt cttgcttcct    120300
     ttgtctgtaa cttataaaca tacttcacct gcttttcatt tagtaggtct ccttcaatca    120360
     tctcctgaaa agtttcaaga agatactttc catactcgcg aacctctttc ttcgtcacta    120420
     tgttactttt gaaaaagttt tcgggcgtta ttctgtctat aagatgctct tgatccttac    120480
     taagcacagc acatatcgaa tcatatagat ggagaagctc ttcgggaagg aagctcatgt    120540
     catttccaaa cccaaacttc ttgatatgtg aatacgaata tgcaaacaga ttgtttatcg    120600
     ccaccatctt gggctcaaat ccatgggagt agacataagg cttcagctcg cagtatctct    120660
     catcatagga aacaagctcg cattcccttc ccttttcttt ctcaatcttc ttcatccatc    120720
     cataaaatcc ctcgatgttt ccaagcgttg cactaagaac cagcatagga catggcgaca    120780
     gatgaattat cctctcaatc ggaatcccca tctcctcgct gctaatctta tgcacttcat    120840
     caataattat atacctgact ctttcgataa agcccttcgg gggtgtgttc agcacagact    120900
     ccagaagaga aggaatcact attagcacct ggcagttcca aggtgctatt gaaaactcct    120960
     tcataaggct cccttgtaag aaggtcttgg aattcacttt cggagtaaac cgggcataga    121020
     tgtctgcaga cacctgattg acaagggcct tggtaggaag gcagaagatt accacgtctg    121080
     tgtcactctc cttcagaacc ttctcaattg cgtagaagca gataaacgtc tttccagcac    121140
     ttgtcggtgc agatattact gcactcttgt tctggtcgac aacatcaaga agtcgcacct    121200
     gccactcgtc tggattgaac agaacacgtg gatccttctt tgaattcaca cttctttgaa    121260
     gcttgtctcc agtatgcttc agttggaagc aaatgtcaaa ctcactaggc gcacttgtgt    121320
     cgtcagtaaa gaattcaaga ttcaggcctt ccaggccatt cttctcaact agctctctaa    121380
     cagtggcctc aaatccacat ccaataagat tctggaacac aaactccaac tctgcatcgg    121440
     gtgcctgatc ctccttcccg agccttccaa attcacggat gtactccatg cagcttaggt    121500
     agcagggcac aatgatacct tcatcacaat cttccgatct cttcttaaga ttccacatgt    121560
     ctgcatagaa ctctatcttc aggagaagaa ccctcctgta gatcccagac ccgtcccgtt    121620
     tgacgctttc caacagactt ctctttcctt ggtagtcaag aaccttgtac tttccaaaaa    121680
     agttccggag ccaagatgcc tcctttactt ttctttcttc cttcattctt ttctcatttt    121740
     cttctataat ttgcttttgc ttctgtgata ttttaggagg cttccctccc ttggtcctga    121800
     caatcggagt gtataatagc ttcccgtcaa acagagactg tgctgacttt cttacattct    121860
     tcatatgtgc tgctgccgat gctgggctca cctcctttcc acttataagc aagtctaatt    121920
     ccatctcgag atttttactt tcaatatccc tgtggttgtt tccaatcaag tcttgatatt    121980
     ccatacactt tggatcttct cccatctcca tttccccaag aagaagcctc ccatcaaagt    122040
     ccatggtcct ctcaggactt tcattcctga acatccagac aagctttctg cataattcca    122100
     taggcaccga aagcttgcaa ggcccaaaac tcttggttct tgtcttgaac aatctgtcaa    122160
     ttgtctcaat gctcatttct gcattaatct tcttaatttc cgtgtccaca tccccgtcgc    122220
     ttccttcatc gctttcctcg tctaaaggtt tcgtggcctt cctcccggtc ttacggtcaa    122280
     gaggagaata gacaaatgca tagacactcg ggatcctaaa ttccatctga tctagaaccc    122340
     cacagtacag gctaattcca agacattcgt acaggaactc aagctcgccc ttctcagtcc    122400
     ctccaagaac aagagcaact ctttcattct caatgtactc ataaaccttt gaaatgtcca    122460
     tgcaatcaaa tcttctcatc aaacattcct tgataaccct tctgtgccca gactctgccc    122520
     ggaaaaacat catgatgtta tcaaacccaa ccttctgtag gttcgacatc ataaatcgga    122580
     tcccatggat gtatgtatgt agaggaagac tctcatagct aaccccatat ctcttgctga    122640
     tactgcttat aagagcccct ccatccacta tgagatgccc tatccctgtg aactgtgcag    122700
     agatgttcgt atacaccgga tgctttgtcc tgaagtattc ttcatagtcc attttcaggg    122760
     caaaaatttc tcctgtgttt tgccgccttg gaaaagacaa aaagacatct aaaaccgtat    122820
     ttaatcatct tctcgatctt ttcttacctg tatacctcgt gttccgtgga acttcgacgc    122880
     ctttaagctt tagtttctct tttcttctta gaattgcatc tattcttcca atccccttct    122940
     tcttcctctc ctttctgcat cttgcttccc tgttagatgt aagaaccaaa aagctcttga    123000
     catttcgtgt tccttcgttg tctatttgta tccctccact aaatcctgca cgaatagcct    123060
     cactcttcaa catctcgatc tgattttggc tcttcagata aaattgaagg acacatttag    123120
     catcgggctt acagacagaa tagagggttg tgaagaatgt tctgattctg cgcacaggat    123180
     gatcttccga tgagtacgag tggaatagcc attggattgc actgacactc accactccgt    123240
     caaatgtccc gggttgaaag tccagtccct ttcccatatc cattcttatg tatccaaccc    123300
     cttcttctct ttccattccg agcttcaaca tttccatgct tatgtcaatc ccaacccatg    123360
     gatatccgtt ttctgtgaga acagacccac taagtccaga cccacagcca acatctagga    123420
     gtagtcctcc atcctttgcc tcaaggagct caagacatct aagagcaagt agtctttgga    123480
     tatagactat tctgctgttt tgcgtatact tcaaagattc ttcttcgtcg tagtacagtt    123540
     ctgccggccc agaatgctcg ggaatcccca tgagggctaa attcatgctt cagataatgg    123600
     gaaggagtaa gacatacctc ccaagcatac tccaaggaac caagcattta aaaataaatc    123660
     aaaccgaata ctcccaccca tgagtatagc atacgaggtt cttggcgtga aaagatgcgc    123720
     ccgctccggt gccgaattcg aaagagattt gaagaagttt tccatagcag agaagataat    123780
     gatattgata ttttacttac ttccaattct tattccctcc accgccaagt cgatagacac    123840
     actcactaat cttgtctttc ccctctctat ggggttgtcc accttttcgt tcatgccgat    123900
     agctaccaga gcagcccgca gattctttga ctcagatgtt gttaggatcg tcactctgca    123960
     cagcttgata gttacaatct acatactcat ggtgtttgcc tcttctcttc gtgtgtctaa    124020
     tatcttctac agcgacaact tcctcgagtc aagcgggtct agcggagaaa tggcatacag    124080
     aatggttatc cttatttcat atctattcta tgaatcagga agactcatta atcgatccaa    124140
     agggctttgc aaacgatttg tagtggtgtc tcagcttgcc ggagctcttc taacgggagt    124200
     atctgcagtt gtatgcagga tggggcttat ccctgattcc ttacttcacc aactgttctt    124260
     ctgctgtggt gttgtttcga tcataatgtc cttagcattg gatagtttcc caagcatgat    124320
     aactctgaag aaggatttgg acatacttcc actcattgga gcaggcggat gtctttttaa    124380
     tgcatttctt ggaacttata tgatacttcc cagcctcccc ctcaaccaat aaatctctca    124440
     ttaataatat cttggcttct taccagtcaa ccttgaaatc tattcttttt acacttaccg    124500
     gtctaaacgt ccttttttct tccaaccccg ggtccgagta atagatctca ggctgttcct    124560
     ttccatagat gttatattct gcagaatcta cctcgacact attgattctt tcttgcccag    124620
     gccctccaat gcagctgttc ttgcatagaa atacctctgc cattttgtat tttgggcctt    124680
     tcgtcttact gatcttgaaa tagttaatgg agttctccag gcctgttatt tgagatacta    124740
     ttccaccatc atctaccatg tactccctga ttccgtttct atcctttatt ttctttacag    124800
     aacgatgttt ggaaagtatg aactccgcat atccccccga gcttgttcca atgttccatt    124860
     gtgttacctc catatcttct atctcatggt gattccagga attggctttg agaaacagtt    124920
     caaactcaag ctcgtcaaga accctccgga attctcttgt ggtaaggaca tgatcaaact    124980
     taactccatc tcttccactt tccagtttct tgtcttggca aggcatcaca cttactgttc    125040
     tgtctccttt cacaagggag aaggccatct gttggggaga cttaactctc gacagatagt    125100
     ctatgaggtg gggagcagtt ctctcaacat aggcaacaac acccggacat gcgctgatca    125160
     ccagatggtc tgttgccaga tactccttgt agatctcttt gtagattttt cttctcatgc    125220
     tagaagtgtc aactatcctg cgtacattga gcttagctct gaggaacgag gagagagcac    125280
     cttcaaattc tctgtagctc atatttccct ttccgtagat gttaaagatg tttactttcg    125340
     attgaggaga aagaacaaaa gatgtttgcg gggcagaatc tcggacaaag gaaatatcag    125400
     cagagagtgc gccagcctca tctgtggtca cacatccact acatgcaagg caatcgctta    125460
     aagataagtt gaatggtgta tctgtcttaa tgcatttctg attgttcttc gaaagacctg    125520
     caaagaagga cattgtggtt ttgcagggga tttcgcttct gaagaattgt tgccatggat    125580
     cccttgaatg gagattagac taagctcttt caaaagagag cattctcttc gagaactgtt    125640
     gtcaaaggat atgtccgagt attgggcaac agacgatgtg ttgccacact ccatccagat    125700
     atcttttgac aaggtccgat atgtccagtc cgtacagctg tttctgagct tcacacagga    125760
     cgacagctat actcccgaaa agatagaagt caggtcgggg ttgaccagag agagaatcag    125820
     accaataagc tctgttgaac ttgtggagcc ggaggggctg ttgaccctga atgttgcgag    125880
     aaattgtctt tatgtccaga ttgtaatcaa ctcgaaccat caggagggga aggatagcca    125940
     tgtccgccat ttgaaagttt tggagtcgtc gacaaaggag atttactaca agatataaac    126000
     tactcttgta caaaaaccaa ataaaccttt gttcatagga tttggccata cagccaatga    126060
     aaagcgatat gcttggatat cccatgtatt tctatatact aaacattgag caggtaaatg    126120
     aaacaacggt catgctttat ggaaagcaac tggacggtct tcctaaggag ccgcctgtag    126180
     atgcatcttt atgtagttcg atatctggaa agatccgtgt ggaaaatata cattcgccag    126240
     tcttcctgaa ggcagtcaag ggtaaggacg aggagttgaa gagagatgtc gagttgttca    126300
     tgagatccaa gggagttgag tgtgtgtttg agtctacatc aaaagaaaat gtgttctata    126360
     gtaatatgga tcgaaaggtc gatttaatca aggtcctccc caaaagaaac atttcctttg    126420
     acaacttctt ttcagattac tcagaagcga tcataacaga gtttggcaat ccaacagaaa    126480
     acattgttat atcaagaagg cttagagggc cttgcatagt tcgaattgat ggacactcca    126540
     tgtcttctgc aagggaaact gttgtgaggt ctccctcaat gatccacttt gtttgcaatt    126600
     caagtctccc taaactggtc tttggctcac tagcagtgag atttgacaag acgggaatta    126660
     ccaagtattg cctgtatgca caagggactt atcattgcgg aggagtgaaa cttccggatt    126720
     gcaaggagaa ttttgaagga aagggagttg agtatacaca ccatcaatcc tcggatgcat    126780
     tagtgaagga tctcaataat ttgatgtcta gcaaaggcat tgattgtata gtctatcaca    126840
     atctcccttc tctggttctc aagaagctgg atatatctgg aatggtgaga tgtgatttat    126900
     ttgtctttgc gagcggaagc ataaaaggat gtgatttttc cattggggaa ctacttggaa    126960
     cactgaatct ggaggttcct ggggagctga aggaaatcca agaacacaca gatggccagc    127020
     ccaaaaactt attcaagaca cttgctttag aatccaaagc aatactggag atatttgagg    127080
     ccaccgaagc attgcatcta tcaaaggaaa tgtgtgagat ttcaggatat attctaaaca    127140
     gaactctgca gaacctacgt gctgagagaa ttgaatatac tctccttcat gagttataca    127200
     accgaggata tctatttccc tcatctgtaa gtcgtcgaga ggtgaagtat acaggagggc    127260
     tggttttatc tcctcaagca gggttctatg aggatctcgt ccttctcctg gatttcaact    127320
     ccttgtatcc gtcgattatc caggagttca atgtatgctt ctcgacgata gggatgtttg    127380
     ataaaagcgt ctcgggggat atgagtcctg agaaactggc agttctgacc gagaagagca    127440
     gaatgtcgga aagagggttt ctcccaaaga ttcttgaagg atttgttgga agaaggaagg    127500
     caatcaagga cctgatgaag cagagcagga cgccagagga agcaaaggct ctagacataa    127560
     gacagaaggc attgaagttg acggccaaca gtatatatgg atgtcttggg tttacaggat    127620
     caaggttttg taactacacg atggcagcat atataaccaa caaggggcgg gaccttcttc    127680
     tggaggcgaa aagaattgct gaggaagagt gtgggatgag gattatttat ggagataccg    127740
     actctgtgat ggtttacact ggtctttgtg gagagaagtc caactacaaa agagcactgg    127800
     aaatgtcaag aaagctgaga gacacaatca attcaaagca tcagaagata gagattgagg    127860
     tggacaaggt tttcaaaaag cttttgctat acaagaagaa gaagtatgga gggctctaca    127920
     tggatgaaga tgggaagacc tatgtggagt acaagggatt ggatcttgtc agaaaagact    127980
     tttgtgaggt cagtaggaag atatgcaaaa ttgtattaga gctgttactt gcagacagtg    128040
     aagatcctat ggtctacgaa aggttttata aggataaggg agaggcaaag accatcttaa    128100
     acaatggaaa caccaagatc atcgaggcgg tttatgacga gctaaagaat ctaagcagca    128160
     atcttgagag cattccttca aaggagtttg tcattcataa caccctgtcg aaggcgccgg    128220
     aaagctacga tccctcggtg gggcttccgc atgtttcttt agccttgagg ttgaaggagt    128280
     cgggaatgaa gtttgatcag ggagatgttg tttgctatgt cataggaaag ggagatttga    128340
     gggaggctgt ccataagaga gcataccatt tgagcgagag ctttaccatt gactatggat    128400
     attatgtgtc taaccagatc ctcccgcctt tgctcagaat tgtgggtgtg gttaagggct    128460
     ttcacccgga gaaaatagga aagatctttg gagtcgaaaa ggcagtgaag cagggggtgg    128520
     aaaagtccat atcattctta acaccttgtt gtgaaattgc tcaaggagca tcttcgaagt    128580
     gtagagaatg cgggaagcct gtttccaggg aattctatgt atggaaagtt atggagatgg    128640
     ttagaaaaga ggttgagtgc ttgtatagtg ctgagtcaag atgtcttgag tgcgggatat    128700
     cctcttatac tcatatgaag agatgcttca actgcaactc agaactatcc tttgagcccc    128760
     taaactatga cttcgatcgc ctcttgagta aggtgcagtc tatgtttaca ggatgggttg    128820
     agatagaaga tattacaaaa aaatatgcag ctgcttcgga gtataggcga atcgacctgt    128880
     ctaagtattt tgaaaaagag attggtagaa atcattagca tgccgaagat acccaatgtg    128940
     atggagtaat gatgaagcca attggatgta tagggtttaa aataagatgg gggatatgaa    129000
     gtatggatgg agtatgggga agtattaaaa ggaaattgaa ggacatgtat gacaggatat    129060
     ttgttgttcg aatgagagtt gcagtgattg ggccagagaa aagcggaaaa tcttcaattg    129120
     tgatgaagat gtttggagac ggattgagat atcaaggaaa gcagaatgat gcagaggtgt    129180
     ataagtacga cgaagattac atgagctacg tagtatatga tttgaaagga aaaaaaaaca    129240
     cccgaaggaa atgggactat tttcatggga tgtgcgatgt aatattgtat tgtgtggatt    129300
     cttctgggga tgaagaggag tggggagaag caagagaaaa gctgaagtca atggtgtatc    129360
     gaaacttacg atcaaaaaaa aacatcttgg ttcttgggac aaagaatgag aggggaaatg    129420
     cattggaatg catagagatt gttctgaagc ttgatctttt agacatagaa gggagagaag    129480
     ttgcctgttt ttcggtttct gcagaaaaga atgttaatgt ggaatgcata aagacgtggc    129540
     tgagagggca gagttctttt gtgagatcca gatggggatc aagagttgtg agaagctggt    129600
     ggaaagcggg ttttgtagaa aattagcatg atttgggctt ctagaagcat ttggtagata    129660
     aattttggga ggattagccc tggatggaag tgcaccggga ctcctcgggt tcagaagaag    129720
     aggctaccga gttttcaagc aacgattatg aggtttatga gccacaagcc gacgatgaga    129780
     atcttgaggt ttctgaggaa gcatacaatg ttatggaata catttccctt gactggccgg    129840
     cacaaagcat tgacatcttg aggggattta cagttgtgct tggaacaaac ccgtctgagg    129900
     gaggtacacc tggaatggtg agcattgatc tgttcccaac caatggaatg aaagctccgg    129960
     agaagatgag gatttccaaa agaaaagtaa aggaatcata taacaaagtc cgggtgaacg    130020
     gagagatggt gtactgccta tcggatgaca agcttgtagt ccacaactcg aaattcgacg    130080
     aagtctatag aagagatatt gggcaagggc ttggatacgg gctctgtttt gggaattccg    130140
     gatgtgtttt tggaacgaag gagggggaga tatccattaa cgattggaaa ttcaatgagg    130200
     ttgggacgat gaagatccat gagggttcta ttgagagtct ttgctaccat gggggcatgg    130260
     ttttttctgg atcatgcgac catagtgtca aaatcacaga cattcggagt gggagcaata    130320
     tcttccagaa gaagtttgag gttgatatca atgccgtgga ctttaacggg gactatctcc    130380
     ttgcttttgg ggacgacagt gggatgatcc gactgatgga tatcaggaac catatgattg    130440
     aagaggttca aaggcataag acacctatca gctgcctgaa gtggagagat tccgatattc    130500
     ttgtctcagg aagtgatgaa caagtatgca tatgggatgt gtctcttgat gcaagcgagg    130560
     agggaggata tcttctattt gttcatcaag gacagaggtt ttacaaggac attacgtttt    130620
     gccgagggga taacaattac gttgttacaa catcgataga cgggctttgt gtcttctatc    130680
     cgatttcttt tgatacttaa agaataaagc tttaatccat aatgacagtc tgatttaaca    130740
     ctctagcggg acagacacat ctctttaaaa gtaaaatttt ctctttggca atggccctat    130800
     aatgactggg agctctgggc acctcggcaa ggagacaaaa gaagatgaag agaaggcctg    130860
     ggattttctt ttgacggata tggataagat gattgtaaag acaaatcatt acacaccact    130920
     tggatgtgga agcatgccct taaacaggaa gattgacgag tacattaagt atgggataat    130980
     caatttggac aagtcgtcca acccaagttc gcacgaggtt gtgacatggg taaaagagat    131040
     tctgaagtgt gagaagacgg ggcatagcgg aacactggac ccccaagtga gtggagttct    131100
     gacggtctgt attgatcgag caacccgcct gacaaaaagc cagcaatccc taggaaaaga    131160
     gtatgtgtgt gtgattgagt ttctagagga accaagtgaa gaaggatttc gtaaagcagc    131220
     cgaaaggctt gtagggtctt tgttccaaag gcctcctttg atgtgtgcag tcaaaagaga    131280
     actaaggata aggaacatct acagtatcga cattctcgag tttaacaaag agagaaggct    131340
     tggtctcttc agggtgtcgt gcgaagctgg gacttacgtc cgaaccctct gcatgcatat    131400
     ggggatacta atggggtgtg gagccgtgat gaaaggactt cgaagaacaa gaagcgggag    131460
     aatctctgaa aaagatatct ttacactgca tgacctactt gatggagtac acatattcaa    131520
     ttccacaaaa gacgaaaggg tgatcagaag ggtgatacgg cctttggaaa gccttcttgt    131580
     gggatatcca aggatcatga taaaagacag ctgtgttaac gccatatgtt atggagcaaa    131640
     gttgagtatt acaggagtcc tcaggtttga cagaaacatc gatgttggaa tggacattgt    131700
     gattgttaca acgaagggag aagctgttgc tcttggaatt gctcttgtca gcagccccga    131760
     gatgagcatc atcgaccatg ggcttgtatg cagaaccaaa agagttatta tggaaaaaga    131820
     tctatatccg aggagttggg ggtttaagag cgaatatgag atacttagtg aatagatgtc    131880
     cttgggaaga aaatcccttt tttattagtc tgtaaggcag ctatttcgga ggatttgacg    131940
     gttaaaaatt taccctttaa tgcttgagct ggaattggca gcaaaagaaa aaagcaatgg    132000
     gggagcagca tctgaggttt tgacactgat gaaaaggatg ttggaaagtc tgaatgagat    132060
     tgtagaaacg gcagatataa aggctacaga aaaaggcctt tcgattcagg tgatggatgt    132120
     gacgcatgtg gcctttgcag atattttctt gtcatcaacg atgtttacga agtaccggtg    132180
     cgacagggat ctggtgattg gagtccagct caagaccttt acgaagataa taagaggaat    132240
     gagtgttgaa ggagggggaa tattcaagat ggaatgtgat gatgccatca ccaacctgaa    132300
     tgttaagaac atccgagaag ggaatgttct cagcttcaag ctgaagttgt tttcctctga    132360
     ttctgaggtc tataatattc ctgacttcga atttgatgta tctgcatcca taccggcaga    132420
     tgagtttatg tacgttccta ggcttgtggg tacatttgga gatgttgttg gggttcaggc    132480
     agagggaaag actctgatgt tctttcagac cggagaacat gcggatgcat ctatgagctt    132540
     tgaagagtca ccgggaaggg aggggataaa gattgaggca aaagagctca taacccaaga    132600
     gattgctatg aaatacgtta accttattag caaggttgta cctctttata aggatgtgaa    132660
     aatctctttg ggagtaggaa agcctgtgtt ttttgggctt tacctggacg gcacagccca    132720
     tatgaagctc tatgtggcac ccaagttcga aaatgaatga ccattaaaaa caaactattc    132780
     cagtctataa ctgttccatg gtatgaaata aacatcttta gaccttcgtt ttatttccca    132840
     gttagtccct atagtagttt atgtaaatta ttgaaagcag cttctgatat aactcttctc    132900
     tacttttgag cttttcctcg gccttcttga cctccgaagc catgtagttc catttgtccc    132960
     tcagaaccct ccactccaca gggttagtga cctcaaggac atcaagtaaa tcaatctttt    133020
     ttttcttgtt gaacgtcata tccaaccaga aacataccat gtccactaga acatgtatgt    133080
     taagaacact tgctctgtct gggttctcaa catagtcatg atagaagaat gacacctttt    133140
     gtagattaat gtagtttacg tcactgtata cttggaatat ccctctaggc ctgtatgggt    133200
     tacgcccggg gccctcaaag atccttaaat aggatgtatt atgaagcaca gtagccgtca    133260
     cggccgctaa ttcgtattgc ctcgtgctac aaaactcata aaggaagttt aaaaccatta    133320
     caatgtattc gcttctttct ttggttattt gcattcctat cctcttgtat gctggaacac    133380
     acattccaaa atacacccta tgaagatatt cgccttggga aatcatctta ttttcatcac    133440
     tcggaggatt cagctcttta agcggattaa catagttctc gtttatatac acgtcgtata    133500
     aatgagagat gtacttcgca tgtaatcccc gaactgcaaa tacaagaaca cctagaagcg    133560
     gtagtctttg cataggtggc gattttaagg tttcttaaat acttttctag aaatatttaa    133620
     tacaatcgca aattttcgac gttaattatc atttccaagt gatactccgc gtggaattaa    133680
     tatacctgaa agtaatactg gaatttaatt tcaatcactc tgtgatgttt taattaacag    133740
     cacaaaggat ttctctcaat cttctggact cacgtcaatc ctcgggtttg tgcagctagg    133800
     gcctctacat tgatgcagac acattataca ttagagcttg cgtcggaaag ccttatggaa    133860
     agcgaggata acatgaagga atatacaatg atttcgggaa tggttaagaa cagatactac    133920
     acaatttatg gagtgatagt agattggctg gagtggaaaa gatgccgagg aggagattac    133980
     atgatgacct tggatctgat tgatgaatgt atgaaaaaat tatctgttaa gattttcagt    134040
     ccaaagaaaa tattctctaa aggattctgt gttggagagg ttgtaaagat aaggaaccta    134100
     aggatttacg atgcatgcag ggcggtgact gatcgtagca atgacattga ggtgatattc    134160
     acgccatacg aatctcccag cgatgttatt gctccttttc caaagcggct tatggagttt    134220
     tttaatcaga acagggaaat ttttgtgaaa gaaaggaaaa tatctgaaat agaggaggga    134280
     aggtattttg atttcaacgg agagttgata gacaaacaga aggaaagatg caacttaatt    134340
     ctccttagat ttgtagatta tagcagaaac aagcgggttc agggccaaga caccaccgag    134400
     aactatccaa aggacatggt tctgattgtg aaagcatggg gatgctttgc catggaagcc    134460
     gagaagtgcg aaattggggg atggtataga cttaggaatc tgaaggcaga cgaagtggga    134520
     tatcgtttgt atgcaagtct gtctgagtca agcaagggga gcatttccaa cataggaaga    134580
     gacacgactc tcgggaagta cttccaaaca aaaaaggaca agtacatgga aggttttgca    134640
     ctccggcaag gaggaatgaa ggttccggat ggaattgcaa gatacagact gactgaaatt    134700
     aaggacatac ttttgccagg tgtgtaccgg attagggttt gtataaaaag atatatgcca    134760
     tctggaggaa tggaagtgtt tttctgcaaa acctgtggat cggaagacag aggagtagat    134820
     ggagattgca aatgtagtat tcccgagata aagaaaatca aggtagtaaa attgctgctc    134880
     tgggatggga aacaggagat aatagctgta tgccgaaaca agcttgtaga acatatattt    134940
     atcaaggaaa acgatggata tctaagcaga agaatgtttg attgcatgat tctgaacgtt    135000
     aggggtgtgg agggaatggt ctaccatctt attgatcttg gcttttttga agtcgaaaag    135060
     gaaggttgag aagggagccc atttgtagac caaaatcatt tatttatcat tttcgaatag    135120
     acctagtatc ttaaagaggt ctccctcgga gaatctctct tccatgtctt ctattacaag    135180
     ttggagacaa acaatcgacc tggggttgag atctatcagt tgtattgact caaactctgt    135240
     caagcccatg ttcatcaaag cttctctgac ctttccggcc ttatctctgg tcatggagaa    135300
     ggtgcagaat agccttacct tttccaagaa ttcggtctgg ccgggatgac tttccatgga    135360
     gttatctatt atatctaatg catctatctt tgacagtagt cgaattctcc ccgttatttt    135420
     cattgggagt atctgacaag cgttaattta ttaacggggg agatgttgta aagtctagag    135480
     ttcgacccat gaaaaatgaa ggaaacccgt ccggaaagga ggaggaaaga taaatctgat    135540
     agagcgacag tagataaggt ccttgacaaa aggaccctga aggtcttgga gaggctgcag    135600
     gctagaggaa aactaacaaa cctctgggga agtctttgca cggggaagga gtctaatgtc    135660
     tatcttgcag aagctagcac atccctgtgc agcaagttca tcaagaacag atataatgaa    135720
     ttggaagaga ctggagattt agaagaaatg attccggtgg ctgtgaagat tttcaagacg    135780
     tcgattatgt cattcagaga tagagagaga tacataagaa gtgaaaagcg atttcaaaga    135840
     ttttgcacat cgaatccacg gaagttaatt aagttgtggg ctgagaagga agtgcgaaat    135900
     ctcaagcggc tgggaaatgc cggaatcccc tctccagagc ccatttatct aaagaacaac    135960
     attcttataa tgacacagat aggaaggcaa ggagaggtag cacccaagtt gcgtgatgcg    136020
     gaaatagaag atatcgaagg atgctacttg caatgtgtag aaataataaa gaacatgtat    136080
     aagaaagcag gtcttgtgca tgcagacttg tcagagttca atctcctata ttatgaggga    136140
     gtggtttatg cgatagacgt tgggcagagt gtagagattg accatgataa cgctcagagg    136200
     tttctgataa tggacataaa caatgtcaat agtttcttcg gtaagaaagg tgttaacaca    136260
     attagaggaa acgatctgtt tgaagagatt acgggaaacg tcattccatc ctacctgaaa    136320
     gacatggaca ttgtcaagga tgtttttatc ccatccaggg tttctgaagt gggaaaccta    136380
     gaagatcttg tagctttcaa agcagaaaga gaggattccg agtctatgga gtctttatcg    136440
     tgccagtctt caattgaaag cgaaagttgt cttgaggatt ccagtgcaaa tcttgaggga    136500
     gaagcaaaag atggagggga ttcaaaggaa gagaagaaaa aaaagaaaag agctgttaag    136560
     gaattgaacc gaatcagaag ggcatcgaga atcagtaaga aggaaaagaa aaagatattc    136620
     aagaagtata taggaatgaa gaagagaaaa agctaacagc attttagtta ttaaatttct    136680
     tattctattt taaacccata tgattattgc agatctagac agaatatcta tcagctcgga    136740
     gacaaggcca agacagcagc atatagagga agcaagaaaa atagtgaaag caaactcgaa    136800
     atacagggga gatcctggat ataagcactt ccttgacgag acagtcaaag gtctttgcaa    136860
     aggatgtagc aacgaagaca ttttccatgt gatccgatct ttgcagagga tgataaggcc    136920
     taaagctagg atccttggag aggatttgta ttacagaaaa taaagataaa cccacattaa    136980
     cttcttttaa tagagagctt aagccgctcc ttatgtataa ggtgattaca cttgattagc    137040
     ttgttcatca catcatcaac gctgtcattc cactttctct tcctaaattc gataatccct    137100
     gtcttttgat tgatcttaca ttttgtaaac ttgttgttga ccatgaagga tatctttcgg    137160
     atgacgtttt ctgaggagct ttgcatcacc attgagatct cttggatgct gatagacgag    137220
     taaaaccttt caacaattct gaagttgtgc tcatcgatta cagagccaag atcattcaag    137280
     tagattgaga catctaggac agaggaaaag gcctgttgta tctcattgat cattgacctg    137340
     tctataatga tacgtgacaa gaacctattt acaatggatc tggaaacctc atcgttgttt    137400
     ttgtccaggc tgagctttct caacatttct atccttctgt caaccacatc ttccatttct    137460
     gtttcgcatg ttgttaggat acaaaagaac gagctcagta caacatagca ggtagagttt    137520
     tctccaagct tactgaggga gtagtaaacg tcggatgcat tgaaatatct cctctgccca    137580
     agatggagca atacgataag ctcatagaac ttgatcttct cagcaacagt atcgttctct    137640
     tcaaagtact ttctcctgat cttcttcatg cttatgtctg cccttatcca atcttggttc    137700
     tgcacacaca gccttagttg ctcaagctgg tagttgacca caacactttc cttaaccatt    137760
     gtaaatgttt ccaccggaac atttataacc acatccagtg cactcttgat gtctccagac    137820
     aactcgtatc ttttcttaag ctcttctgtg atgtatatcc tttcctcttc aagaaaaatc    137880
     ctcccttcaa tcacttctct caagatagag ctgaaaaaca caacaaaccc tttctcttgc    137940
     ttcttccttt caaatagctg cccaatcatc catttgattg ccattcggtt ctggcctctc    138000
     tttattgtaa ggacccgggc gagcccaaca agttcctcgt cagacttaca aagattcatc    138060
     aggtcttcaa atgtctttaa aagtgtctcg tagtcatttt ttaccctggc ctttctttcc    138120
     ttttctaaaa gttcctccat tcccaagggc tgcccaagat cacaaaaatc catttcaaac    138180
     aatagctcaa caaagacttt aattcctgat gtttttcctt ggcttccaga aaatgttttc    138240
     tggacggcag tatgttttca ttataaatgt aaggagtatt ccaaagctat tgaaggccac    138300
     aaactgcaca gtgaagtcgg gaatcacaat ccagtctaca accctgttcc cccacacggc    138360
     cttaccttcg atgactccga cggctttgat cacaacgcct tcatcaatat agggcgagca    138420
     ctcccacact ctacatagat tcttttccca gagaatgtca agcactctct ttcccttcag    138480
     gcagaagata acaatggttg aagatttctt ctctactatt ctatatacag gcatggatat    138540
     aaggtgtggt atgacatttg aaggatactc aatggccaag aagtgtgtgg ttggatgtgt    138600
     ggttgtgtat cttatgatgc tcttggaaca gtctgtagaa attatctcgc atgagaaaca    138660
     caatactgac gaggccataa ctaaccatcc aaacagaata aacatctagg gatccccttg    138720
     ggtgcttcgc aactttcatt tatgaaaaag gaatggatgg ggccctagat gaatccgttt    138780
     gcagaggaca tacagtttga ccccaggctc tatgaggtag tttctagagc cgggaaaaag    138840
     aatgacaaga caaagcttaa gggacttcga gagctaaatg acatgctgga cggtgttgat    138900
     ttagaagcaa acatcgatac attgttagag gtggtagagg atgcaatgaa gtctcaagac    138960
     ctccagataa agaacctatc gatcgatatt ctctacaggc ttctctcttc ggtaaaggat    139020
     aggctgaagt tcaagagggt gctctctatt tggctttatg gatttataga aaaccctgta    139080
     tattccacct caaaaaagat cttcactgag tttgtgagga ttgaagaatt ggaagacgaa    139140
     ttcgtgcaga tattaaactt taaggaaaac cctgtgcttg gattgtcctg cttgcagctc    139200
     ctggtaaaga aaggaagaaa ggactactca ggagtgattt cagaaaacat caagtaccta    139260
     gatttaaact ctgcaaggga gttgagggaa atttacaagc tatgcaagat gcaagggaag    139320
     attgaaggtc tttacaaaaa ggttgtcgaa gttagggggc ctaatcttgc aaatctcaaa    139380
     tggaagattc tcttagatat atttggttcg gtcccagagt gtattaagag cgatggaaag    139440
     tatcttgact ctgaaacgct ttcaagggct gtggagaagt tggatgtatg tgatgatata    139500
     ccggtgagga ccattgatgc acttcgtata gttttcccta agattaagga caagagacat    139560
     tacatgaaag gatatctaaa aaacggatct atagaggaaa tatgtattct tgagttcctt    139620
     aacgacttcc actttctgaa cgagaatgca ggttttgaga cggttaacaa actgattgag    139680
     aatgtgatga acatccattt tcaaagcgac agagatgtag agaagtcaat cagcaaaatg    139740
     aacatagagg ttcattcaga aagttgtcct tctccaaacg agaagcttag ggaaagccat    139800
     gaacacatat gctccttgga cgaatcggat ttcagaggaa gtattcttag aatgctttta    139860
     tcttcgctag atgggctcca tggaaagaag aagataatcc gagcagatat cttggggata    139920
     gaacttaatc cagatgagtt ttcaaaggaa gagatagagg aagtgtttca acattcggtt    139980
     aatgtgtttc caaaggacta tattctgaac tcatctttta gctgcaatct tcttcctttg    140040
     gtgctaaagt atcctgaaga tgtaggagaa gaaaaaataa ggaaaacaat atgcaaggat    140100
     aacctctttc tatttattcc tgtgtgcaag gatctagatt ttctaaggtc acttgtattt    140160
     tcatatgata acaggtctat aaacgagatc tatctatctt cggatatccc ttctgagcta    140220
     gatctggatt tttactacag actcggagat aaaatagata agcctaggat tgtggactac    140280
     aaaagagttc tagaacaata tctggaccgt gagttcataa gtggtatgat tgagagtgaa    140340
     ataatggaca gaaatgtatt gtacactaca gtggttgagc agttgagttt gacagatgtt    140400
     cccattagta ccagctatac aagtgcgttt tatgattggg acgaatgctt ttatagagat    140460
     attaagattc gagagcaatc gcaaatggtt ctggggctta gagatgtata tatatgtata    140520
     cacaaggggg ctttggaggc atttcttcta cttgttctag atgccatgtg tgatgatgag    140580
     gatgagtcct tagacgagaa gctgaaaagt atgggagtac ctggtggaaa aaaagcatta    140640
     gcagaaagtg ttcttggaag ccagtctgca atagagaaat ggaaaaacac cgatttggga    140700
     acaaatcagc actttgttga aaaggtgttt ttcgatctag gtcttccatc gagaagatgt    140760
     ggtgataaaa aacttgagca acttctggag gaaggagggc cacgagcgat tgattatgtt    140820
     tttaggaagc acatcattcc tccacgattt gttgcatcgg tggactttag ttatctcagt    140880
     aacaaggcgc ttatgtatgt aatcggtatc ctggaacggg gatctaggaa tggcttccca    140940
     ataagatttg aggaattccc agtggaagat ctggaaagtt gtttctgcgt ggatagaaag    141000
     gctatagata cccatctttt agagtctctc gggctggtaa ggactcttga agatctcggt    141060
     atagaagaag ttgtccagat gatagaaaag gatcagcagc tgcaaagaaa ggaactttat    141120
     aagaaaagat actccattta ttctccattg ctaaggacca tttatatcca tgtagcaaat    141180
     tccatactca acatgtacag tatatcgagg ttggacataa actctgtcga tgacgaggtc    141240
     tattctctct taaggggatg tctctttgaa tcggagattt tgttctggaa cctcctcctc    141300
     aattctcttc taaccatcag aaacattagg gtcaatgcct tcctagagaa gatggttggg    141360
     aaaaacgaga aatggaagga atttcttcaa gatgcagatc tcgagcaaag gtctctattt    141420
     gcatttgtat ttccaaattt gtttgccaca gcacccaaga tggagatatt tttggacccg    141480
     tttatactaa aggagacgtc cataggagta atagatgttt ctgctaagac ccagaagctt    141540
     accaacggat tcgacatcag aattacctat gaagcaggag gcactcaatt tacagctctt    141600
     atatcgattc catcagacta tccatacaaa aagcctatat ttacctccga gatgggaaag    141660
     aaaagtcttc ttaatctcaa aatcaacgag atgatcaaga gatgttcaaa gttcatggaa    141720
     cttgtggggt tgtggaagat caacattgac gagaagcttt ctggccatgg agaatgtccc    141780
     atatgttatc tcgtcataga catacatgac tcgtcatttc caaatgccca gtgtgaaacg    141840
     tgcaaaaata agttccattc acgatgcatt gtaaaatggg ttgctgcagg aacaagaaac    141900
     aactgcccga tgtgcaggag acctatagaa gtgattccag gaaagggtac gtaggccagt    141960
     tctttggttt ctatcaacaa tttaattgaa ttttatatca agatcactgc agctacttcc    142020
     ttgttctaat aaactctttt agtgtttctg gatctaggca caacgaattg ttcctaagga    142080
     acttgaatag catttggaag gtcgatgatc ttctgaatgt tctggaatcc ccaatcacca    142140
     ccagcccttt tttacaccgg gttagagcaa cattgagtct tttctcgttg tccagaaacc    142200
     caaattcgtc tcggtcgttg catctcacca gtgttattat tatatagtct ctctcctgcc    142260
     cttgaaagcc atctacggta gagacctcta catccaccat atcccgaaga agtaatacct    142320
     gggaagtata gggcgctatg attccaacct cctctccttg gagagtctca acaatgcttt    142380
     ttactatctc agcttcccct atattggatt ttgagacccc gtcgctttca taaagctcga    142440
     agtactgagt gtcgacaaac agaattaagc tctttccaaa caccgatgtg tgctcctcgg    142500
     tgatgctttt gactcgtcca ttataaaata cttcgttact gaacttcaaa aggcctgagg    142560
     gcattctgta ctgctcattc aaaagcatag ttggaagatt aagggattca tatagagagg    142620
     atgtttccgg gcatagctgc atggggtcac caacaaggat gaatgtgctt cctttagaaa    142680
     cagcaagaaa agactcggcc tcacatgcct ggcatgcctc atcaatcaga acccaatcga    142740
     acttagtctt ctccttaaga gaagaaaata acgtggcaaa cacaacagag gagtttgctt    142800
     gcttctcttc aatgaatttt ttttgcttct ctcttttgtc tttatagaag ttcttgtcat    142860
     ttctctcttt cttcataaac ttagtgtgca actctgcctg cgaatccagg ttcaggtggc    142920
     taaaaccttt ttcagagctt ccgaggcgat agaaggaggg ttggttacat gcgaagtatt    142980
     tactcttcaa aaacctttct ataatgttgt cgacagacac attgctgggc ccacatacaa    143040
     gaaccctttt gttgttgacc aaaagttgag atattatttc taccactgtt cttgtctttc    143100
     cagtccccgg aggcccgagt attttgtatg gattgttgta ttttaacatc tccactgctt    143160
     tcctttggct ttcgttcaga gaggagtcat atagattgag actccaactc tcagctattt    143220
     tgctgtttct tatatccaga atatcttttt ttaggttgtg tgcttctttt gcccctctcc    143280
     atgattctac tatgaaatca ttgaaaggtt tccccaactt aacaaatctc tcaagattgt    143340
     ctagaaggac tctgttagta tacttgaggt caaggacagc ttcaaagtca tatcctttga    143400
     gctttctatt cccaacggcc ctaactatat ccccttcaat tcccacaaca gtacatctca    143460
     ctgggccgct aggagtttgc acgaatagtt tttcttcctc cttcaacact ctagatatct    143520
     tagttcttct cgacattgac accaccctca gggaatacaa ataagctcct cctctatttt    143580
     ccattgaagc aagtttacac ttgaacttgg ttgttgggct ctccttttcc tgggcttcca    143640
     gaattccttg tagatccttg cacaagtgat ccagatattc ctttcttcgg gaatctatct    143700
     ccattgaccc ctacatcaga tcaaattcta tactacgaag cccattggaa tgagtgtcga    143760
     gcaaaagctt catttgatta caagaaacct ccaggaggtt ctaggactgg aagaactgaa    143820
     aaaaattgtt tctgagagaa atctaaatgt ttattgggga acagccataa cgggaagacc    143880
     acatatagcc tatttagttc ctcttatgaa ggtgaaagat tttctagatg caggatgtaa    143940
     tgtaaaggtt cttcttgcag acatccatgg gtttctcgac aatctcaagg cgcccatcga    144000
     aaaggttcag gacagatgca tatattacga aaagttgata aagtcctgtt tgaagatgtt    144060
     gggagtagac cttggaagaa tccagtttat caagggaagt gagtttcaga aatctaacga    144120
     gtatacaatg gacttgtaca agatcttgtc cataacatct gagcacgatg caaaaaaggc    144180
     aggggcacag gttgtcaagc aggtcaaaaa tccgatggtg agctctctaa tatatccggc    144240
     tatgcaggct cttgacgaag tgcatctatc agtagacgca cagtttggag gagtcgacca    144300
     gaggaagata ttcacatatg ccaggaaata ccttcctctt ctcaactacg agaaaagaat    144360
     acatctgatg agtccgatgc tcccaggatt gaactccgag aagatgagta gttcggacga    144420
     cctttcaaag atcgatctta tggactcaaa agaaaccatc ttcaagaaga taaaaaagtg    144480
     tttttgcgag gaaggaaaca aggaaaatgg gttaatgaag attttctcgc atataatatt    144540
     tcctatcttt caacacaagg gagagaacgt taagattacg gataaagatg gaagggaaat    144600
     ggagtttgaa aagtaccagg aattcgaaag cgaatttgtc agcaaatcca tccatcccgg    144660
     agatctcaag agcaacgcag caaggctcat tgatggcatc ataagaccta tccgagagga    144720
     gatggaagaa gatttgtcta tggtcaggcg agcttacaat taaagacagg gctgatgttt    144780
     tacttgcttg ttaaaaacaa atctcacatt accctgtgat ggaaatacgc ctctggccaa    144840
     accaggagtt ccgaatcgag gttagtgaaa cacaaaagct gaaagtgatg gttgtgtctg    144900
     gcttagcaga aatcaagggc caggagcttc tcaatgaaaa gtggtacgca ttcaaggaca    144960
     taaagacatt tatattcacg ttttctggat gcaagctcaa agtggaggga gcatgtgatc    145020
     tacaatatgt gtctggcacg acgaatgtcc cttcgatatt tgggatcgtc aattttttct    145080
     cgaagaatgg gtttgactat agcaagctta ggacattcat ggtggtagga aatggaagat    145140
     caaccctgtg cttcacactg atcaacttct ttgtgcgaat gggaaagaag gtactattca    145200
     cagagataga tccatcgagg ggaaacatat ttcctggagc gctaagcacc atgcacgtag    145260
     acaccttaat cgactgtatt gaaggtctcc gtctgaagaa cccgttatcc ttcttctacg    145320
     gatccacaga gataacaaac atggagttgt atgatctcca aacaacgaag ctccaggagg    145380
     ctataaaatc caaaaacatc gatgatcttc atctgatact ttgtccggag ggtgcatctg    145440
     cgttttataa cacgttaata aagagatttg aggtcgatag agttattgtt gtagggaatg    145500
     aaaggttata ccacactctg gacgtgatag tggaaaagtt gatgatcagt agaagcggtt    145560
     ttgttgaaga aaaggaaata ggaaagagca tatccagata cttcaaaggg gtgaataatg    145620
     aatatacacc atttacattc aatgtgaaat acaagtggag ggttgtgaga ataggagaaa    145680
     tgtatgttgc acctgctagt gctttgccac tggggagtgc aaggaaagta gggtgtgtgg    145740
     aggcctctga agtggagatt tcggagaatt ctgtcttagg gatttcagaa gctagagaga    145800
     tagaagatgt tgcaggatct ccggttcttg gatatgtggt tgtgattgat acagggacat    145860
     tcaaaatatt atgtacccag ccaaggcttc ctaagtatgt ttttttgatc cagggagacc    145920
     tcaagcatat cgagtactag ctttcttaat aaaacattac agttctccga ctttatccaa    145980
     acggaaattt tgtaaattcg atgatccctt ggatgaacag aaagaatcca gtaagagatg    146040
     caggctctat tctcagagat aaatacatta cctctcatct gaacgagagt ttgaagattg    146100
     atcatgaata tcctcctctc cagaaggtgg gagggataaa atatctacta ccaaagataa    146160
     cagagcttgt atacaaccca ctgtttgcta gggcgaagta tgacgagatt gggatccatc    146220
     cgcccagtac tctcctgctg catggtgttt ctggggttgg gaagacgttt cttgtaaact    146280
     gcataagcca ggagtacaag cttccgattg tcaaggcgtg tgtagactcc gataaggagc    146340
     ttcgtgagtc attcaggaag tcatccttac tcgagaagtc gattgtgctc attgaagaca    146400
     tcgacacttt aggagaggat gataagaagg tgatatccca gctttccgag tatcttgaga    146460
     actacaaagg aaagtcgatt gtgattgcta ctgctcgaaa ccccgcattt attcatgaaa    146520
     gtctcaacaa gtttgaaaat tcgctactgg tgaaaatacc aacgacatcg gagaggagag    146580
     agatcttggc cagtattacc gacagaatga aatgccagga tattgactgg ctggaacttg    146640
     caaaacttat gccaggattt gttggaagag acttgaagag agcccttaag attgcttcta    146700
     caaaagccgt gactgacgga tcacatgtta tccggatggt ggactttgag atggcgctaa    146760
     aggagataag gtggaagggc acagacatca cctttgatag tattggatct cttgaggaag    146820
     tcaaagacga gctcaacatg agcatcatct ttccgtcccg atttccagag aaattccaca    146880
     agcttgggat cacaaggcct tctggaatac ttctttatgg acctcctgga tgtggaaaaa    146940
     cattacttgt tcgggctgtg tcgaacatga gccattgcaa cttcttgagc atcaaaggcc    147000
     cagagctcat aagtaaatat gttggggatt cagagaagga gataaggaag ctgtttgata    147060
     aagctaagca gctacagcca tgcgtgttgt tttttgatga gatagattcc ctttgtggag    147120
     agaggaatgg aaacgaattc accagtcgca tagtcaatca gatattgacg ctcttggacg    147180
     ggcttgatga tagaggagat gtgtatgtaa ttggagccac caacagaatc gagagcattg    147240
     ataaggccat attacgtcct ggaagattcg acaagattct taaagtcccc ctaccatcta    147300
     gagaaggatg cgtggatata tttagaaagt gcaccaaggg aatacccatc gagccctttg    147360
     attttgaagg attagatttg gaagggttta gtggagcaga aatagcaggt ttaattagag    147420
     atgcagcaat gttatgcctg aaacgcaact tcaatgcaga ttctttttta atatccaaag    147480
     tggacatctt ggaagcgttg aaggccgcaa gagttaccaa ggacttccgg taggcacttt    147540
     aagctgatgc cttctaagtt ctccaaaacc caatgcagat agagctacct aagatggaaa    147600
     tggctcgttt atttttaata aaaggtattg agcctatcca acgccataat tattttgttt    147660
     ctatcatatt ttccagcttc aataaagtct tccaaatctg cgctgttcat gttgtttatc    147720
     acatcgacgt ttatgattct ggttgtcttt tcctggaaaa atggtgccag tctaccagca    147780
     tgtctttcca gttccgtaag gagcccaagt tcctcgttac ccagagtaag gctccctaat    147840
     attccaatcc ctccgtttct tgttgtgaaa tagacagagt cagaccgggg taatgacaga    147900
     gaccctggac acatgcttgt tattctgtct ccaatagaaa gcgtctccat attataattt    147960
     ctgtccaaca tcagaacctt cccatctgtg gttgtaagaa taagactttc tagggcgaaa    148020
     accatggatt ctatctgttc tttaccattt gaaaggaaat ctagggatag atggttggtt    148080
     tcctcgttaa atgtaaagac cccaaaagat ctgtagatac atgaacaggc aatcttgctt    148140
     ccatgcattg ctattctata cggtataaaa cctattttca ttacacacag ctctacaagg    148200
     attcgtgctt gtcttttgta tacatataca ttgtggtttc tatgtgttgc caagtaatcc    148260
     ccgtcggaat ccaatgcatg cacaacaccc tcccctgtgc tttcgtagac aagcttgata    148320
     caattccctc ttgtagaaaa catagcaagc cttgaaaagc tgccctctct cgaaaggtta    148380
     cttacaacaa caaagtaatg tcttgacaga aaccttccat ccattactat ctcatcttgg    148440
     aggaagagat tgtgtacatg ccttttcact ttcaaagaga gataggaatt gattatcgga    148500
     tcattgtcga tgttgaggat tgggcttacg agccctgtaa cttccttttc atcattcatg    148560
     gcagagaact tcagcacata tccattcctc ggatccgttt cttgtagctt atcttcaata    148620
     gaaatcttaa ttttgggaat ggatccaaga tggcatctgt aaatggactt ccctacagaa    148680
     acatacagat gatcggcaac taaggcataa gatatgcctt ctagggagca tttatagcac    148740
     gaaaagtcct ggaggtctat aaatatgctg gataccccaa ttcccattat gtgccttcca    148800
     acgggaatca tggtttcaat cattgtatca gaaaagaatg aaggcttaag aaatagaagc    148860
     tcccatttgt tctcttcttc tgtctctttt aatattgata agatgcttct ggaacttgtt    148920
     tcgggctctt gcccaaaagt aacttcatat cccaccccat gcatgtctcc aaaaaagagt    148980
     ctcccgcctg caatgcatac cgatttcaag atttcatgtt ttcttctatg aaccacttgg    149040
     aggtgtttgt tcataataat aaactcgtcg tagtatgttg atataaacag gtagctatgg    149100
     agatagagaa ggctaacttc gtaagggcat tctacacact caatgcattc cattgtctca    149160
     aggcatattg ccttaagatt cctgtctcca gtaaacacaa tacataagcc ttgatggtag    149220
     gaagagagta ctatgtcctt tatctccaaa cttgaaatat cccttccttt cagacgatac    149280
     atgtggtttt ttgtattgaa atagcagtag ccatctatat gtatgttaag gatttctcca    149340
     aagtcctgtt cttcactcat accttctctt aatactttcc cttggtttgg atgtgacaca    149400
     atcaagactc catctgctat cccgaatctt cggataactc cagaaagatt atatcttggt    149460
     tctaccgaaa gatcaactga atatgtgatc ttcttaatcg aatttcttga aatatatcta    149520
     aatgaagtcc caaggtacga tagagacatt ggacaggcac caccttcaaa tgttttcaga    149580
     acccttaact cttttcctat ttcgagatgg taagaatttc cacaaggtga tcctccatag    149640
     tacagcttgt cttcaagatg aagcagaaca ctaaaccagg acccaaggtt tcccaaaacc    149700
     tcggttttta gagataaacc tttgtaagat gcaatttcat tttcacaggt tttgttacta    149760
     gttggaatat ttccttccag ggatatgcgt ataatctctc cgtcctccat tgagagcaaa    149820
     atacttccgt ctgccgccag agtgttcttg atcccgggat ttgcaaattc gctctcaagt    149880
     acaaacttgc ctctcacata gtaatataac ttcccttcgc ctataaggag caacccatcc    149940
     cctatggccc ttgcagatac aagccccttt ctaaggagca tcttttcttt tagaatcatt    150000
     ttaggtttgg aaggcgccat ttgatatctc gaataaaaga cgtctccaga aatgtcttct    150060
     agcaaaaacc cgacatcacc cttattggaa aatccgtcaa gaatcttata gtatccaaag    150120
     tcatttacat catctccaaa aacaagtcct tcgtggccca tacttgcaac agtaactgta    150180
     tcattttccg caataaatat aaaattcttc gaagttcgga tgcatttgat ataggataga    150240
     ggagctggca tccttccgca cacaactggc ttgtctctac ccataatggc ataatctccc    150300
     ctattggaaa ccaacagaaa tctttttgaa ctcctaaata ccactggcac aataagtgtt    150360
     acatatccat tgggatatat cacatccaca ggcctcaggt ccagattgta tatctcgact    150420
     atcattcctc tagttaccgc gatacacggt tccctctcat attcaatcct tgctccggaa    150480
     accgcagagt cagggtcgtt gatggttctc attgcatagt gcattgatac aatttctggg    150540
     ttccactgga ataagttaca actatttcat taaaaatttt gttgagtaaa caaaggttgg    150600
     atgaaggtta catatgactt tgccgaaaca aaggacaccg caatagtgtt tgtatataaa    150660
     ccctctgcag aaaacatgca tatagaccct gtgcttgagg gccctagaag actcagacta    150720
     tccgagaata tctctataga cctttatgga gatgtttatc ccgaaatcaa aattaacgag    150780
     tcgaagttaa gaatggaaat tcacctaaga aaggtagagg caataagatg gggaggtatc    150840
     agaggaaggc cgatcgaaga gcctcaagac agcaataaag aaagtgtaat agaagattcc    150900
     gaggacgaag agaatacttc tgtaatggac ctgttcagaa agatttatca acgatctgga    150960
     gaggatgtcc gaagagcgat ggagaagtct ttctatgagt ctgaaggaac tgttttgagt    151020
     acagattggg accaagtcaa atcaaagaag attacccggg aagattaaat ccttatttct    151080
     agaatctacg cattagacta tcattggcac tttcaagaca ttaatagaca agaaagaatt    151140
     aagaagccat tgtacaaagt taaaatcttt tgctagcgag ccattcaaga gatcccgaga    151200
     tcaccctatt ggtttatttc gttctggtgg tatgctttct tcaacttctc ggctagggca    151260
     tatatatccc cttccgagct cttgagggcc actttttcca tggaatttct gaacattttt    151320
     agatggtttt ctctttctgc ctctctgtct cttatcttcg aaaagtactc ccaatttcct    151380
     atcgagtcaa ttatcgcctg gtctgtcaaa agagaatgat caagccccag atctcttctt    151440
     atgtcctctt ggaaatactc tatttcctca ataagctcct tcatgagggc acatccatta    151500
     ttccaaatgt catctatgtt aattgtagtc acacaataca aaaatatatt gagatcaaat    151560
     ttaattgcct gtcaaccatt acacccacca aaattaaatc cgcaagatac tttttgggag    151620
     agtaaacaat actctgattc ctacgatgta acaataccta gcagatggaa ctgtatacaa    151680
     aactctaagt aagggattac ccaactatta tattttccgt taaatatttc agatacaccc    151740
     ttcattaatt caagaggaac tcctttcggc accgaaaaaa acacttgctg aacaagatat    151800
     ttaacctcgc ttgaagccct tatgtcgtct cttatcctct ccaaaatctc aaaaatactc    151860
     ttgtcttcat tggtaacagc atttttccgg atgtccattg cgagttgctg gaacttttcc    151920
     caaatgtatc gagaattttt cttttctgga ttgtggatta gaaaagagta gtagggatcg    151980
     attttggatc caagattctg gaactcctta aaatcctcgg gacttatacg ataacaaact    152040
     tcaagtcctg tacttatttc ccatgatcta acatccaaca agagcctatc aatattagat    152100
     tccgtttctt ttattgttcg cttaatctta ttgccaaaaa gatcctctct tgaaagatat    152160
     agctttatat cttctgaaaa agagaattga accatatttc catccgacat gttctccaaa    152220
     agatttctga tcgttaccaa aatagaatat acaacaaaga gcaaggagtt cttacgtgaa    152280
     gccatttcgt ttcctatatc atcgagagca cgaataattt ctgcagtttg tccatccatg    152340
     ggctatgatg aatagtttta tcaaatatag aaaatgatta atccatttat ttcttgatca    152400
     aactccgttt cgattgatat ggaaagacgg atgcttagaa gtagagcctt aaatttagac    152460
     tgtctctcta aggactttag atatggtctg ttgaaaatcc gaaggtccat cgatggcttg    152520
     taatatgcga gacgaaacat taataatatt gcaatccttt gtgattaatt ctccattcca    152580
     gcctatctcc tttgccttaa caacattact attggagtca tcgaagaagt aaacatttct    152640
     aggtacttct attcccagag cctttgtcac aaattcatag gatttatagt gcggcttgca    152700
     gcagaaggtt gtgtcatact ttcctataca tatcacaacc tcaaaacaat ctaaaattcc    152760
     tatctttgca agaatatttt ctgctctgtc tctaggccca tttgtaaagc agcaccttct    152820
     gacattcttc atggaaagga gaaactccct caagcttgga tctggagaaa gatattgaag    152880
     ataatcaaat tccgaaagca tcttccagta ctcctcaagg gaaattccca catacttgta    152940
     aaaaagaaat gaatacagta atgatatggc taggtgctct tcaaacatct cctcggttcc    153000
     tccttccttc agggaaatat acttctccat aagaaatttc ttctccattt cctggaggtt    153060
     atttgatgga tgataaagag tgtcatctat gtcgtacaag aacagagtat cgcttcctat    153120
     ctttttgagc ttgatatcca aaagagatag atcctgcccc atctcaatga aaacaggact    153180
     ttgaaaaggt ttctcatccc gaaagtcctt ggaacttggt aggctatctt ctaagtgttg    153240
     tttctcctct tccataggaa acgacatttt ctcagacttc tttgcaagtt tggtcgggat    153300
     ctttccttta tcacaagaac tggacattaa ccttttggcc ttgctctcag ctttctttat    153360
     cccgctagaa aaaaccttga aaatagcctt gaccacattc ccaattcctc tcatcggggt    153420
     aagtaaagtt gttttagctg tactaaaatt tttcttagaa acatataaaa ataactcaca    153480
     agggagatct ttatttactc ctggccgtgg tcgacaggct tggtcggcat cttggaggag    153540
     agactagact cattcttttc tccatttaca actgtagagt caatggtaga gaaccccgag    153600
     tccgaaacat cttccatatg ggagttgttg ggggacatct tagagatgcc ttcttcgttc    153660
     tttatcccga ggatttcctc ttccatctct tcagtcccac gccctcggta gtttttttga    153720
     gccttttcgt agtactcgtt gaaatacctg aatattgcag accttgttct ctcaactatt    153780
     tcctcgagat ctccttggta cttctccata aacccacgaa tatagaactt gtaaacaaac    153840
     actgcgccag tacaggcagg tatggatatc catgcaacca ctataagctt gaacagctgg    153900
     tagaaaggta tgaagtcaag cacgaatgaa aacaaattgt ctagaacaag aaacacggca    153960
     ataaccatga aatacttatt gtatctctta taaacccttt tatcttctct gcatgctctg    154020
     aatgactgaa gaacattgta aagaaccaac attgccacaa aagcattaac aagaaagctt    154080
     atcatttcag ggttccttcc tttctatttt aaaaacaaag aaccacagaa agaaaagttc    154140
     cctttcaggg agctaaagag gtctttttaa gcctgattgg cagtattgcc cggattctct    154200
     gattggttta agccaaatca aacatcacac agattcttcc gccaaagaat tcaatagggc    154260
     cattcacaaa gacaaaaaca agatcaccta ggaactatac ctgatagatg aacaacagaa    154320
     agaaatttga ggaaataaag cagcagcttg agtcctttct tactccaaaa catcttagga    154380
     acgagtttcc ccaagagaag ggatggatga tgcccgaaaa ctccccatac aagaacgagt    154440
     acagaaaaga aggctgagca cagtagtctt ttagtaaaca tattgtaagt gatctttaat    154500
     cagatgttca atcctttctt atactcaagg atgcttccat agaacctctt gatgtttcta    154560
     ttttcgcaaa catatatttc cttaaagacc gagtcaatga agcttaagtc atgactgaca    154620
     caaacaacag ctccttcaaa ccttcggagt gcttctgcca gtgcatctat ggattccatg    154680
     tcaaggtggt ttgtgggctc gtccagaact agaaggtttg gccttagccc attgatgatt    154740
     gcaaacccta gcctactctt ttgtcctccc gagagcgttc caatacattg gttgtcaaca    154800
     tttaatccga aagaggcaag gacccgtcta ctctcttctt ggccataaga cttcatcata    154860
     aagtctagca cgttttcatt gatctttagt tgatctacat ggtgctgagc aaagtatcca    154920
     actctcaaag aaggacttct tataagattc ccctctgtgg cctctatctt tccagctaag    154980
     agcttgagaa atgtactttt cccttgtcca ttggctccaa ccaccactat tctggagttg    155040
     gacatgattc ttatgtcaag accctgaaga gtctttccaa gaccataaga aaatccaacc    155100
     ccagacatct caagcaatat gccctgggat ggagtagaag aaaacgaaaa cttgatgatg    155160
     ggatcttgct taggaggaac aagtgttggc atttttgcaa gtgcctttat cttactctgc    155220
     acaagagatg cccttttagc attgtatcta aacctatcaa tgaaagtctg catgtgttcc    155280
     ctaactgtaa gctggttttc atactctctt ttggctgctg tcatcctctc ctttctttgc    155340
     ctcacgaagt tctcatagtt ccccttgtac atatcaatct tcaagtcgtt aagatgaagt    155400
     atcatctctg tggtactgtt aagaaaattc ctgtcatggg acacaataat aaccgtcttc    155460
     aattctttca cctttttttc tagccagctt aaagcattga tgtcaaggta attggtaggc    155520
     tcatcaagta acagcaaatc cgggttcata tttatcgcct tcgccagatg tgcacgcatt    155580
     ctccatcccc cactcaaatc attcatcttc ttcccaacca tatcttttgt aaatcctaat    155640
     ccatttagtg ttcgcccggc ctcagcccca acaaattctt ccactgttcc ttcagagagc    155700
     agatcttgcc ttatcatata aatcttcatt cctcttggaa tcccaaactt tctttttcta    155760
     attgccttca aaagtgttgt ctttcctatt ccattcctcc ctacaagacc gtacttcctt    155820
     cctttgataa tggtaagagg cgtctcccgg acaatctcct tccctcgtac aaagaggtca    155880
     atattcaaat ggagatctcc ttcaaactcc tcggagtctg tgtcttcccc tgatgaggat    155940
     gactccaata gatattcctc ttctgctatt gtgtcaggta ttgcctcttc ctttctgctt    156000
     tctatcgatc tcatcgaaaa tggtgtttcc aatggaatgg gattccttcc ataatccaca    156060
     gtgtaggatt ccacccccac tgcaatggcc tcttctttcg actcaaacgg gaatttctca    156120
     agctttccta agtacttgga tttcagagaa gagatctttc tgtccatccg accgtagcgt    156180
     gggtcataag gccagaagaa ttcaagtctt cttcctgaat aaagaccggg gtgggtcgaa    156240
     aacgcctgag taaataatag aaagagattt accaaatacc actattaact aacaagacgc    156300
     tccatcagat tgcaacagtg gggtagaatc cagaagtcaa agagatggcc tttgtcttct    156360
     ccctcaatca gaattcttct aatggccttc tttttctttt caaatttctg gcctgtataa    156420
     acaattttgt tgttgttcac aaacttaaca tactccgagg caagaaattc ttctttgaat    156480
     ttttctgtcc attctgtgat attttgattt tgatttgtct ttgttgaatt gcaggcatca    156540
     agaatagaga gaagctttgc ccaccaagct ttcttatcgc tattaaaagg actgctgata    156600
     tcatatagtt gggaaaaaat ttctttgaac tcttgtccaa tatacaagtt aaattccctc    156660
     aggcttgctt ttcctatctc cttctcgatc agcttgtgtg catcgatata ccataagcac    156720
     acctgcatct caagcccctc aagatcgttc cgtatcttgg atagaatttc tgtcatttcc    156780
     tgagcaaact caggtgtgtc ttctccctta atgttctcta ggatgttgtt gttcaagatg    156840
     aaaaaagaaa actcgttcga atgtactaag gccgatgcct tccaggccat ctccaacaaa    156900
     ttcacaagaa tgagaatctt gggctctttg gtataagcaa cacatcggag aataagatta    156960
     aggcgtgatt tttcactcat ttgttagggc tttttacaat atctcttgaa tctctcgggc    157020
     tgtcttcccc atcatttcta tcaatacttc tacattcaat ataatatcta ataggagtta    157080
     caaccaactt gtcttgtttc cgttggacca acttttcaag aaaccttgtg catctcccgc    157140
     taaaagttcc cacacccatt atatcttcaa tatcaacctc taatccttca atctgactcc    157200
     gaagatactc cccgtcctca acaaaaggac aattgctttt tctctcctca ttcgttgtgt    157260
     ttgctatctt cgagcaggtg aagcaggtgt agttcgccct ttttccttca agaccatagt    157320
     tgtgcctaat tgaatataga tattctttat caaagacttc ttttcctgcc ttgaacgatc    157380
     ttcgaaaaaa atctattcca tcttcaacac tcatgccaca gtcctttagg aagagacata    157440
     atgtttgtct gtcgttgtat ttaagatgtc tattctttct cagcctttgc attatggcct    157500
     taatacatag cggaaagtat ttctcggcgt cctctaatga aaacacagtg ttcttctcac    157560
     atgttgtagg attcagaagt aattttgtgg caaggctttt catcctttcg tctggatttc    157620
     ttaaaaacat ctccaccagc tcattcatct ttccttccaa gtaccttctg aactcattac    157680
     caagtagtga tcggatcccc tcgtcattca gcttgagata tcctccctca ggtataacta    157740
     ttcttcttcc aaccatatca atcacctttg taaagtggac gagaacctca gagctcatca    157800
     tcccaattgc acaatctgga ttgtattttg ctttcattcc aagcaccaag accccattcc    157860
     gaatctcggc tccatccatg taaggcaaca cctctgtaag gaaaaactcc tttgcaccct    157920
     ccggattttt ggccattctt aaccgcagta aattcacttc tgcatttaca aaccaagtag    157980
     ctgcccacgg atcttgagaa cacaccattc tacagaaaaa gtgggagaga gtatcatctt    158040
     ccgtgtccat ctcaaagcat ctggaaaccg aaggatttac ttcttcgcgc ttcagaattt    158100
     ctattcttct ttctgcacac ttcctgaacg tttcgtagtc tactgaactc ttggaaagca    158160
     tagtataaaa tttaattcca ggcaattcgt ctccctttgc agcctttatt ctcttcatcc    158220
     ttcctaaccc taggaaaccg ggaaatattt cctattccga agatctctat tttctccgtg    158280
     ctacctttag aatagacata agaacaagta caacagaaag aagtaacata aaatacataa    158340
     tcttgtcctt catccggcga tgagaggcgg gtatcttctc cagctcgcag ttggctccct    158400
     caaggtaaaa gtttaccgac tcgagataga agtctaatct atctatttga agtgtttgtt    158460
     gcccaacggc cattttcatg tctaagagaa cggaggtgag atcataaatc gacttcctta    158520
     aatcctttac attttcaagg agcattctac ttccctcgtt ctcctcatct tcctcctcta    158580
     tctcttcata gatgtctatg ttttttagga atttctgttg tagccctcta tagtcatgga    158640
     ctatcgactt cagctgtcca acaaaataac catacatgca ctctgtcaga gttttcgaag    158700
     gagagatttc tcggatcccc tcgatgtttt tctctgcatt atggatatgt tcgactatac    158760
     atctcttgat atcctcgatc tcttctttct ttttcctttt tggcgaaaac gaaggcatac    158820
     aatgtttttc ctgcacgata cctagtctgc agatactttt ccttacgtct tccaaaaaca    158880
     ctcgaagccc ggatgtcgaa agcggattaa acctgacatc ctttcttttt gtaaattttt    158940
     tatattccag ggttctattc acaagcatct gtgctcttta tttgtcttag agaggaaggt    159000
     gttatcactc ttatgaaaca gtgttttatt tgattacttc cttggagcat acagaaataa    159060
     aatccatttt cagtatccag aacatcctct acatccacag ttgtcgcatc ttatagccct    159120
     cgcaacgtcg atacttctct cgggaactct gcatatgcat acatttccat gcttgctgtc    159180
     aatgggctgg atgcatcgga ggcagcatag gtcttcatat ccctcttttt tccaataaca    159240
     aactaattca tggtccacaa atcggtttag tgaaagatat ttgtatagct cattacttat    159300
     ctcgcctttt ttatctaaat tatatatgta tctagatctc tggtgatgga gctggaaaat    159360
     cggccaatag ttttcgggag gatttgtagc aagaggagca ttctccgctt ttctcatttc    159420
     tgtctctatt ttctctagga aagcctttac tttctcaaac tcctctggtg gattgattgg    159480
     aattcttgtc attcaaccca atccggggct ccacacaata aataaaattg tgctgcatcc    159540
     atgtgcttgt cgtcacagat cttgtcttct tgtttcagat ttttttgaat aaaatggata    159600
     ttttattctt taaaacaatg caaggaaaac ttacagggct attgactttg ctgttaggat    159660
     cgataggagc ttcaatagtt aaggaaaata cccttggaag cccagacctt agaacttcag    159720
     aagtattata ctccaatgga gcctgcagca cagaagttcc actgtgctcg aggcttggag    159780
     tcaaaaaact catggagggt ggaaatgcaa tcgatgcagc aatcgcatct gccatatgta    159840
     ttggaataat aaactctttc tcgtcgggaa ttggaggtgg tgggtttgtc ctaatcaaag    159900
     gcccagatgg aagcaatatg tttgatatga tagactttag ggaggtagcc cctaaaagcc    159960
     tttcttcaga caaacttgag ggaatgggaa ggacaaaggt aggaggtctg agtgttggag    160020
     ttcctggaga agtccttggg ctgtacgagg cacatcaaaa gtacggaaaa cttccatgga    160080
     agaacttatt tcccgagaac atagcaatcg ctaaagggtt tcctgctagt aaccagctta    160140
     taaagagaat caataagttc agcagctatg tgaggagtga tccgggacta aaagaagttt    160200
     atacaagaaa tggagttctc cttaaagagg gggatatagt tgtgcgtaaa aactatgcta    160260
     agacattgga gactataatg aacaatccaa aaagcttcta cacaggcgaa cttgcagact    160320
     cgattgtcaa agctgtaagg gaaaaaggag gactgatgga aaagaaagac cttgagaagt    160380
     atcggattat ccatagagat gttctggaag gaagatatca cgactataag gtttatacca    160440
     cgaaccttcc aacaagcggg gcattgatat tgagagccct taacatactt gagaagtatg    160500
     atctaaagaa gctaaaggaa gatagtataa aaaacgggaa ctttaaatat atccacttac    160560
     taatcgaggt cttcaagttt gccatggcaa ggaggggaga gcttggagat cctgcatttc    160620
     tcccgggatg ggagaggata gtagaggaaa tagtctcgaa aaaggcagca gaagaggctt    160680
     ataagaagat aaacatggaa aagattttgg acgtaaaaga gtatggaata aaagcaagag    160740
     gagttgaaga tcatggaaca acacacataa atgttataga taaggaagga atggcagtgc    160800
     ttcttacaag tacagtgaat cttgaatttg gggctcagtt catggatcgt aaaacaggaa    160860
     tagtgttcaa caataccata gacgacttct atgtctcgtc tttagacaac tcccatgaaa    160920
     agcatcccaa tgaagtagaa ggaggcaaaa gaccgttctc ctctatatct cctgttattc    160980
     tacttaagga tgacgagatt cttaccctgg gtgcagcagg gggaataagg attcctacat    161040
     ccattatctc tacaatattc tatctttcga cgggagagaa tctgcgagaa gccataatgg    161100
     aaacaaggat tcataaccat ctatctccgg acacgacgtt tgtagaatac aacagtccaa    161160
     ggaaactctg gaaatatctt agcggggttg gacatagaat agagaagtcg cttcaaaaca    161220
     ctgttttcac ttctgtccag ggaattttcc tgaaaaagat tggtggaaat agagttatcc    161280
     aagctgtatc ggatcctcgg aaaggaggag aagcctttgg gtattaaata taaattttaa    161340
     gactctactt tcctcggagg agataataag caaggtacag gccttcagtg gatacctttt    161400
     catagggaat cacctctacc ctttcgtcat ccatcctata ccacttgcct ccaaatatgg    161460
     cataggaaag ataatggcca taagtaatgg atccacgatg gcttataaac cctaaaacat    161520
     catagatcct ttctcccacg gctaatgtat ttgataaggc tacatgggaa tcgatttttc    161580
     tggacactcc ttcataggag aatctcttta gatgaagaga taagaccctt ggatatcttt    161640
     tgacttccaa cctttttgtg cataaccctt cttcctggca agcttcacac attacctcat    161700
     ccttcaagtc ctcggttcca aggaagatgt ccaacgatga ctggatagaa ggaaggcatt    161760
     caagaggaat tgttgcaaat gcttcttctt ttgttttctt aagattacag tttctacaca    161820
     gcattgtcga ggaaaacatc ccgaagaatg ttcgatgaga taagcattta caggtgatct    161880
     cgtctgtaga ctggaagtca tatgcctcgt gaatcttttg gagaaggcat acaaagaatt    161940
     catgcacatc ctgctgcata gatcctacaa agtgaggaac cagaagccac attgtgtgta    162000
     tgaacttgtg cgtaagcaca cactcagagc catatgaata gtcaattaga gacttcatgg    162060
     cacacattat acacctgctg tctctacact tgaaccttgt atgtgtattt gacaaaagtt    162120
     cgtctcttat tggacataga ttgatcatta tactaagaac tgcgtttata tagcacgtat    162180
     ttccaaggtt tgaaaaccct ttgaggggga tgtatggaaa aacttcatac agtgatgaag    162240
     agatactaac tatgactgtg tcttctattc tgttggtgag gcttctcaag aaatacctcc    162300
     tagcacatac agcacaagag ataacagaag aagtaggatc aagaaatact tcatggctat    162360
     gcaatccctt gtctgtgcta caaaggagac agtagcattg taggcatatt tgtaggtcta    162420
     ttgaagtctt gccggcattg caccgggtac tcaatccctt ctttttgaga tggcccagtt    162480
     ttaaagtaat cgccttgagg atcttttcaa cattctttag tgattcaaca tgtatacata    162540
     aattcattta tgggtgcagt ttttatttca tctgaagaat gacactttta aagatacaaa    162600
     gccaaataaa caaattaatc gtcttgtgtc ctccatttga tatgatcggg cagaagagag    162660
     cctcaaaaga agacctgagt atatgcggtt gttcaagaac ctttagaaga agggaagaga    162720
     gtgacacaag tgaaaaaaca cattacgaag tcgtgcaaaa taaggtaaca acaataacca    162780
     aaactaactt cttcaaaaga ttgatatggt ctattcttat gatctcgggt ttcttttgga    162840
     tttgtgtaaa caataagata tactctttca tcttgatcat ctttttaaca atatctatca    162900
     taagagaaat gattggaatc acaaaaaaat ctgaaggaag gccttttcat cttcgagtat    162960
     caatcctttt cgggttttct gtgccgatat atctttactt ggtctttcct tcgataatgg    163020
     gtgtctattt tcctggactt ccgaagtact tttttcggag attatctttc atatgctttt    163080
     acagctatgt agttgtattt atgtcttttg ttgcttcact tagaaaggga aagctaaagt    163140
     cacagctggg actgtttgcc ttggtccacc tatctacgta tataatggcg atagtagcaa    163200
     aatgtgcaat cttcaacctt aataagggga ggttctggtt tatgtttcct gctctgcttg    163260
     ttatatcaaa tgacatctcg gcatacgttg tagggaagag cattgggaag aggcctcttt    163320
     accgccttag tccaaagaag acacttgagg gattcatagg ggcctttgtt tttacggcaa    163380
     ttgtaggatt tgtactggga tatcttcatg tgaacagtgg atttttgagg gatggggact    163440
     ctgaacaatt ccagaagctt ataaagttca aagcccttgg aatgagtctg aaaatacaaa    163500
     gtatatatat acatatcatt ccatttgttc tcgtaacgtc atttgtggca ccgttcacag    163560
     ggtttcttgc aagtgcacta aagagagcct ataagaagaa ggactttgga gagacgattt    163620
     ctggacatgg aggaatagca gacagaatgg attgccagat attagttggg atttttacat    163680
     ccacatatat aaactcgttc atctacacag aagataagtc aataggatca gtattcggtt    163740
     ttatatgtag aaacttcagt tccgaagaaa taatgattct catcgagatg ctgaaccgaa    163800
     gaatagaagg cataagaggc agggagcatt agatcttgca tatttacgat ttaaggtcca    163860
     atgtgtctat cttcactaca tcggataaaa acagaaaaaa aatctttccc atggaaacct    163920
     ttaagatgat tgaggccatg aggcagaaga ataggttttc ttccggggat tacacgggtt    163980
     ataagaacta tcttaaagtt gagatgaggg gacgggggca aggagaagat agagatttgt    164040
     ataaacttga gtcaaacctg tcgaagttct ttattttcaa ctcgacgagg tttctgaaga    164100
     gtaatttgag aatacttaga aggaataggt ctgagtttgg agttatgtat agtaccctta    164160
     tgagaggtat ggttgggggt cttatggaaa aacccattga aattggagat ctcttggagc    164220
     tccggaaacg gcttttacca tataagacat ttgtaggcca gatcgatgca ttgcttgaat    164280
     cggcaccata tagctttgac acctcatcct taaagaccag gtacatgtgg aatgacatag    164340
     cgattggatt cagaaacgac tttgaaagag accaatttct agagggaaaa gctccacagg    164400
     acgggggata tgatgcagac attgccacct ttatactgaa ggtggaaaac aaaaagaagc    164460
     gactactgtc tctcattaaa tccaagccta ctaagattgt ctgtattagt aagaaagtag    164520
     aaaagctttt ggagacactt gataggctaa aggttgtttt gaatgaaaat ctggttgaat    164580
     cagcctatgt tgagaagatg atcaatgaca cagaagaact gaaagcatac tacttgaata    164640
     tcgccgaatt taagaggtgt ctgaaatggg acgattctat agacgggttc aaggttcctt    164700
     tgtcatttaa agaggtagaa ccccagattc tggaagtaag agatgattta tcgtatgtct    164760
     caaggaaatg cttgagaggt gcgctttcca agtatctaga gaaatccctc cagccaacca    164820
     aaccggctat aaaggttccg tttataccgg tgctgtttga tgtggctagg gattacatat    164880
     cgtatcctgc agaagataaa aacatggagg atctattcaa gaagcttcac atgttcaaat    164940
     gattaaataa ggccttcttt ctaatttact ccttgttcat ccccaatgag gagccctgcg    165000
     attcttagaa gcttgaagaa caagattctt gccaagttga acagaaaaaa gaaaagtata    165060
     tgcaacagaa gcacctcgga atcgaattct cttggcgacg aagttttggc caataattca    165120
     gaagagcttc taatggaatg gcctttaccg tttaacaagg atctcctacc tccatatcct    165180
     acagatgttc aaaagactgt aatcccatac atcctggcaa aaaagagtat caatgttgtt    165240
     tctgagacag gaagtggaaa gactctctcc tatgtacttc catatactca tatccttgaa    165300
     aatgaagata agagattact ggttattgtt cccacaagag agttggtttc gcaggtaagt    165360
     aaagtgttcc agaagttttc ggagggtctt cttgaagttt tagagataac aggagaggga    165420
     agcatagatt cacagcgctt agaggcttcc aagccctttg atgtagtaat ttccacacct    165480
     ggaagactga aggaacttat ggaactaaag agtattggaa gctttgaata tgttgttgtt    165540
     gatgaagcag atagattgat gcaacacgat attagaaggg atgtagcatt tatattgaga    165600
     gaagcgaggc ctgaggttac tagctttttt tctgcaacat cttttgaatg gtatggggga    165660
     ataaagattt caattggtgg ggtttctgtt agtagaaatg tagaggaatt tttcttgtat    165720
     gctgagaaca acgaaaagca acaggttctt ggagagattt tgaattcttg tgaggattgg    165780
     tttggaagaa ccatgaatgt cagaagggat gaattagaga tcaagaagat ctttatattt    165840
     tgtaacacta tcaagatgtg cgaagacctt catgagagat tcagggagtc cctggtgctt    165900
     cattcaaaaa agtccatgga tgaaaggaaa acagttatga aagcattaga aggagaaaat    165960
     gtggtcttga tttccacaga tcttggagga agaggggttg acataaggga cgtagacttg    166020
     gtgatcaact acgatcttcc caagacgatt gaagcctatg tacatcgatg cggtagggct    166080
     ggaaggcaaa agaaaggagt ttctctgtct atggtgtgcc gggaagacaa ggagatactt    166140
     cccaagctta gaaggcttat tgaaagaaag ggaggggttg taccaagatt tatgaataga    166200
     aaagaagaca taatactaga ctgatatggt gaatggatta aggtgtttag tagccccttg    166260
     gggaatgtat tttgagtatg ataaggctat aatgcaaaag ataatcaaga agcttaagga    166320
     ggaaagcgat gaagatcaag gaatcgaaga tcataacaaa gggaatggag aggaataata    166380
     taatagatga ggacatctgt ttttgagtta tggtaataaa tttttggctt gtttattcac    166440
     ccaggaatga aaatcttaat aacatctgat aaccatcttg gatacaagga gtctgaccct    166500
     gttctgtttg atgatagcta caatgctttt gaggaggtct tgaagacggc gcaaagggaa    166560
     aaagttgacc tgattttgca gggcggagat ttattccatg agaataggcc atctagaaac    166620
     tgtctcaaca gaactatagg acttctgaga agatactgtg ttggagatag gagatcctcc    166680
     ctcaaatcaa accatagctt aaacattcat gaccagaata ttggaatctc gattcctgtg    166740
     gtggccatcc atggaaacca cgatgacccg agtggaataa atatgatttc tccgcttgac    166800
     attttgcata gtagtgggct tgtgaactac ataggaaagt ataatctgat ggacaggata    166860
     gacgtttttc ccttgctatt agaaggagac tatcgaattg caatctacgg tctaggacac    166920
     attaaggatc gaaggttata caagatgttt tgtgaaggaa gaataatgtt ccacagacct    166980
     ccggactgcg attcgtggta taacatcctt gtattgcacc agaacagggt tcccagagaa    167040
     aaggaacacc cctcagagga ctttatagac gacttctttg atcttgtggt ttatgggcac    167100
     gagcatgaaa gcaaagttat caagaaagaa cgtctagtac tccagtcggg ctccacggtt    167160
     aggacatcgc tgtgtgaggg agaaaggtat gataagtata tatatattct aaggatagga    167220
     aaggaatgca ttctagagca cattaagcta agaaatgtaa ggccgtttgt cctggatgtc    167280
     cttcggattg agggaaaaga caatgctgaa gaggttgttg gaaataaaat acgggacatg    167340
     atagaagcag ggaaaagaaa agaagtctgt ttcaataaag aaatcacagc cgtagatgtt    167400
     gatacacaga gatttaaatg caaggaaaag aaagaagaag agaatgaaga agacactatt    167460
     tgtaagaact ttgcacatga agaaaaagaa tatactccac tgattagatt gaagattgag    167520
     aattgtggaa ataatgtgtt tgataggcac aggtttggca tccaatttaa aggacttgtg    167580
     gcaaattcag gagatatgct gaccatatct agaagaccac gaagaaaaga agaaattgag    167640
     atagaggcgg tagaggaaaa ggttgagata gcacgggtat taagaagaat tcttagggat    167700
     gtggagtttg gggtcttaag taggacagga ttctcggaaa gtttagagga atttgtaaaa    167760
     ggagatagca atgcttttat ggggatgatc agaaagaaca tcgaaaagat tacgaaggtg    167820
     attgactatt cctcaattgt ggaagaagac gtaataaaga ccatgaaaag aattagcaat    167880
     gaagaagatt tctacgatgg cgaagatcgc ttggaagaca aaggagataa aggggcttct    167940
     aatgagaaaa gagtggaaga gagttttacc aaagatctgg aggatgaata ttcatatcat    168000
     tcagaagaca acgaaaagaa caaggctggg gtcaagaaga acttcaatgt ggaagatcta    168060
     ttgggaaaga agtatctgag caaaaagcca aggaaaaata aggaagattc aagcactgat    168120
     gtttctttta cactttcgaa gtacttatga tcgtttgtag attcaatcaa atcctacaag    168180
     ttttttgaca agtgaagtct actaaatata ctttccacag gcttcttctt ttctaaactg    168240
     ctaaacttat cctctagata gtcttctgta gagttttttt gaggttctac ctttagatct    168300
     ggaagggatg gtgatgcttc tagatcgata tccgaagaaa agtctctttc ctcaatactt    168360
     gtggaatcat caacaactat aatatagctt ttggtaggac tagcagagaa cttttcaata    168420
     agccagactg cggaatttat cacgtctcta ctccatagga tagttttgga atgaaccttt    168480
     ttggcctctt ccaaggcatt cataggcaca aagttcccat ccaccacaag tatgtcgcaa    168540
     ggggaaattg cctttacatt gtttgtaaaa tggatatgag tgtacgaaag cttcatttgg    168600
     gtgttctgaa gcagagtatt tccgataaac attgtaggag gaaagctcat aggagaacta    168660
     tatgttacta ttcttactgc catggattaa ttgtttatgg gtatcattta tcttcaaaat    168720
     ctggaacctg atggaaagta tagtgggagg aaagaatgcc cccaaatgct tgggtttgtg    168780
     gctggcttta tagtaggact tctgtctttt ccgatgatct attgcctgtt cccgagagct    168840
     gttgttgaag ttaacaagaa aaagatggta aggataagca acaagagtaa aggaattgag    168900
     attagtgatg aacaaatgaa aacagtgatt agaagtatgc acagatgcag agacacccac    168960
     tggatcaatg ctgttattca aagactttat atggaggttt cgaagtcgta tgctattgaa    169020
     gccaagatca agtctattat attgaaaaga tttgagatgt cgggaattag gaaatacttc    169080
     aaatccattg atgtcattga agtggtttta ggtgaggagg caccatacat agaaaacatc    169140
     caagttgttt ccgacgacga catacacaaa atgatcttct tagaaggacg gaagtatgaa    169200
     gattgcgaag aagagaagtt attccatctt gaagaagaga tcaaaaagag tttggagatc    169260
     gaaggtataa tacctgaaga aaggtgcgaa tgcccgatcg actcagatga aagtgttcca    169320
     cttgaggaag tggaaaatag tggtgtggaa acaaagacag acaacaggaa gaagtgtgta    169380
     tcagaattat ctacaaagct tgttgaggat tgcctcactt ctcaagacag agaaacaagt    169440
     aggatggtgt tttcacagaa agtttttgag aatctccagg ttcttctggg aatcagatac    169500
     aagggaggag ctcagatctc cctcagttta gagcttccta agagaataaa tctcaagaca    169560
     acgatattta tcaaaggaat gaaaggagat gttcttgttc gagtgccttc aaaagactac    169620
     gatacaagat atgagtactg ctttttgttc aacccgactc tttcagtggc tgtagaatcg    169680
     ggaatatctg gagagatagg aaagctttac ttccggaagt cgatttcaaa cttcatagaa    169740
     agatatataa ggcatctcat agcgaggacg atggtctatc catcatggaa cgggcaatat    169800
     cttccctttg ttgttcctcc gatcaaggat gtagtgcata gaatagaaaa ggtgacctta    169860
     gaaaaccatg ccatacatct tccacagata gtggagaata ttcttctcta ctcgtcaatg    169920
     gattacaaga ttgtagaggt tgatggggaa gtagtatata gaaggacagg atattttatc    169980
     aatgaaaagg aaaggatatt ttgcacacac tttcctattc ctaagacatc acttaagata    170040
     tctcattttg taggaaagaa cagacttttc aagggcctaa cactgcagga aagcaaaatc    170100
     atgagccaac tatatagctg gggtgccttt accaatgtga tttctaggtt tcaggagttg    170160
     aagatgaaga ccatcctcac gcctacctct tctttggttg agcttgagtt tgaaaacata    170220
     agatatgaat tcataagagt aattgtgaaa aacactttag ttttccagag aaacgatcca    170280
     aagagcccgg aattcattgt atttaaaata gccgatgagg ttctttacat ttaccaatat    170340
     gtgaccacaa agcatttcat gatgaccaag agaagaatat ggaagctgag gaagaagcta    170400
     gattctaagc cgttcactgt tctcggatct gtttctctct acaagctaat caagttctcc    170460
     aaaagaatga tgcttgatca tcttcgaaag cctttgagcg aagttgttga ggaatctaca    170520
     gattctcttt ctgttgagaa aaactcggat acaaaaacag aattgattga gatatttgag    170580
     gacataaaag agaccttttc cgatgaaaag tatcaccaga agaaaatgtg ttcaaaagca    170640
     tcttccgagt cgatctacag ggtcctctct ttggacgaag ttcgaaccaa gctattctcc    170700
     gagaactgtg gaatatacac ggtcatcaac gaggcagaca acattcgcag cattgtcatc    170760
     gagagtagac tgcaaagtgg aagtagtgag ttttcttctc aaggaaacac acaaccggat    170820
     atcactatgg agatagaaga ggattttata attcattctt attttggaga agatatgatt    170880
     atcgatttga ggtttggaag ggaaaaggag attctgatat atagaataag aaggatggaa    170940
     gaaaactcat atggatacag ctcaaaagta gttctttatt atagcaaatc tatgaacctt    171000
     aactttccga attactttat agaggctttc caactgagaa taagacagga tgaatatttg    171060
     atgattgcag cccagcattt gtactccaca tccttcctgg aaaaggaatt ccggaaggtg    171120
     gtggagattg gtaagggagc tctctatatc gagttctata ccgatgttcc cgacgattat    171180
     tccttcacag tttatggggc ctctggagat tctgtgtata gtatatacaa ggtaattacg    171240
     tcccggaagg cgagaataat cctccccacc gtaaaagaaa aagaggtgtt tactattgtc    171300
     cttactccga agtttaatag aaacaggaaa atccactaca agattgtatc tcttcccgag    171360
     gagttttcta ccgaggttct ggttgactgc aatgtcgggc tatccaaaaa catgaagttt    171420
     tattgtcctg tgtttgggag aacagattcg gtaatattct gggaaaaagg agacgacaac    171480
     gagatcaagg gatacataga gaatagtgac acaaaaataa tgatatcaag gagtggaacc    171540
     atgaggacag agaacaggga atataatatc tactataaaa acaaaggaga gaaaaagaga    171600
     gatataaaga tattccttgg aataagtctg agaagaacat agaattggta aaagccatag    171660
     ctttattata ttttccatat tcttggattg aaatcaaccg acctgggttt gggcttgcag    171720
     ggcttggatc tcttctctaa gatcccagaa gttgacttgt gtcagttctt ctgctatttc    171780
     tggagatttg agccctatca ttgtaatgtt ttcccctctc actataaata actcgtgttt    171840
     cctttctccg tattttccat catggaatat cctctctata actttgtcga gtgttatgct    171900
     attaaattga tcaaaggact tcattacgcc gtaaaggtat ctcccatctc ggagcatgac    171960
     aacaacttcc tgttccaaat acttctcgta gtcccttgta ttgtcaaaat cttcatccag    172020
     catctcaagg ccaagaagga agaagaaatt aaaactccaa aaccgtcctg aagcattaaa    172080
     tcgttttatt gatggatata taggttttct taggagcatt caaacatagt tgaagtcgtc    172140
     ggccactccg ttgaactcgt cgatcttctt cttgatcttg gactcgtcga cccaagacac    172200
     aaagtcctcc atggctttac ttataattgt tgagggatcg taaacaacct tcgacccaag    172260
     cctaacatgg ccatgctcaa caaatctcgt ggcgtccttg aaattgggga ccattctgat    172320
     tctcttcata accatcggca accgtctctc acagaatgaa gaaacagtta ctttagtaca    172380
     gtccacaagc tttctatttt tgatgattcc aatactgtat agcttcccta caagcttctt    172440
     ggttacattt gccctaatga gatcgttttc gggaagtttt gctaatttct cggccagctt    172500
     ccgtatcttc cctactattc tgttatatct cacatactcc tctctgtccc gcagacagta    172560
     ctttacaata gcaaggtgtt caagcgatgt gtttgtgttc ttccactcga ggaagttgac    172620
     tttcttcaga agcttctttt catggaattt cagctctctc atgggctttc catccttcaa    172680
     agtaaaacta ttctaaagtc aagaaacaga gtagcattat ttagacagaa acagaattta    172740
     ttatttatca aatacttcgg caataaaatg gtcaaacaac actacttcct gttcccggca    172800
     gtcctccgta ctaatcggag aaaagtggag tgtttggcta tacttctcat tgccattcga    172860
     gcaaacacca ggatggtttc taccgctgga ggctggagtc atcctgaacg ttggggactg    172920
     gggagtgtac tcttcggata cacttgcact ttcaaaggca gaagtggata taaatgcatc    172980
     aagcttctta tagtttgagt tgtcttttgc aaactccctg tgctcaaact cttttatgtg    173040
     ttcttcataa ttgctgaacc tggtgtagca aatttcacaa aagccttccc gagtatggcg    173100
     gcgtttgttt gattgtttgt acttcttggt ggcctggaaa ggacagcata gagttgggct    173160
     gtccaggtga agttttgggg catctgagtt aacgtattcc ttgtagaacg gttggaactt    173220
     gttcttaaag tcctctataa gaacataagg cttcttgaat actttgtagc tcttcatttc    173280
     ttgacactct tcatactttt ctttattatt tttctctttt tggcgggaat ctcagaaatt    173340
     cacattccat tgacttaaat accaaaacaa atctcaaaaa ggcaaaaatc aaagaaaaaa    173400
     gttcttttta ctatttagca tggacttctt caagacatct taggacctct tcctgcgcaa    173460
     ggaatctctt acagtcttta gaaaagtgca ggatctccat cctatcccct tcttttggcc    173520
     ccagctctcg aatccttcca agaagcttta atatttcaat tgttgctgta ttcatatcca    173580
     tctcttcctc cggcaaatcg ttcttaagcc ctccgttaac agcttcttcg ttctctccat    173640
     aacacattcc tttccatctg tttaatgtcc cacttggatc tgtggaaaac agggtatact    173700
     ctccgtttac tattcctgcg tacaggaagg acactccaaa gggccgtgtc ccagcatatt    173760
     gagtgaatgc ttgttttctt tgcccaattg ccttgcataa ggttgtaaga ggacattgta    173820
     ctccaagctt ttctagaact tcctgagctt tcagctgtgc atatctcttg agtctcattg    173880
     catctccaaa caacccagat agtgcacaat aaatatcatc actcagctgg taaatctttt    173940
     ccatcggccc atttgtaggc tctttattta ttcctatgag aacaatacca tctgtacaca    174000
     catacccaat tattgttcct gccttagaca cattcttgat tgcaaactcc acctggggca    174060
     gcctgccttc gtccgtaaat gtgttggact tgggtttgtt gtcctccatg ttcagggtct    174120
     tattttaggg atgatttctt caatcgatgg aatggactct cacaagattg ttgtttcact    174180
     tttaatgggg agtttggatg gcataaggct tggagttttt gctaaaaccc agaggtatac    174240
     aggcttaccc atctatatat gaaaaaccta tttgacaagc tggaaataag ctcttcgtgc    174300
     tgtctcggaa agaaagacaa aaaagatata aacaggcagc taggccgaga gatattgggc    174360
     aagaccgaag gatatatgct tcataagtgt agaaatagag catctgtgat atctcgggag    174420
     ggattggcaa ttttgttctg tttcaacaag aagtactttc caacaataca atatcttgaa    174480
     aaacacagca acgaagagtt tcatgaagta tttttagacg atggggcgct tgggccttta    174540
     agtagaggag cagatgtcat gatcccgggt atacttaaat acaaagatct ggtgaaagga    174600
     gactttgaag aaggagatag tgttgttata cggattcttg ggaagtctat tgtgggtatt    174660
     ggagaggcgg ttgtaagctt taaagacatg gccaagaagg gtaacggaat agggattgaa    174720
     gtatatcacc gaattggaga tgagctatac aacgagaaat gtctctagga aatcaataaa    174780
     tgtttctctt gaggatgaag agaaaggata tatacttgac ttgtgaagcg aacagttgcg    174840
     gccatatcca cggaaaagca ccggaactcg tcagatctcc gcagttaagc ctgtgcgagc    174900
     ccggatagta ctgaggcggg agaccactcg ggaatcccgg gtgctgcaac tttttgcaga    174960
     aattcttttt atggaaaact cagcctggcc tggcaagaga agggtccggt actaaaaatt    175020
     gtctttttat ttactgaagg atcgagtatc tgcattaaca acctctgtaa atgtgtatcc    175080
     aggagacacc ttgcagttta taagcacact cccaggaagg attgtggctc ccattccaat    175140
     tatagagcct tcaatgtgtg atccatgtcc aatcgagaca ctggacatta caattgatga    175200
     tattattttt gactcttccc cgatatcaca atcccttcca attatcgagt caagaagaag    175260
     cacatttcct gtctttgtgt tgttgtcaat cacattactt aggtccttga ggttatactt    175320
     cttcacatag tcttttatga atttggcatt tgattcgctt gttttaagtt tcttatcggt    175380
     actaattgaa tgtcttttga gcagagcgtt tacgcttaaa taattactta tgcttcttat    175440
     ctgatagatg taactcttcc caggcctatg aattccaaca ggatttgtca aggccaggtt    175500
     cttcacaaca tttggaagaa gatcatgctt aaagctgaaa taatccggct tgaacatctt    175560
     gaacagcgaa gtcttgagca tgtagaactg gaggatgtca agatctttcg taagagttag    175620
     acccttcttc aatagatgga agggaatctc ttcgttacag tcgtttgaat aaaacatcaa    175680
     gtcgtcccct ttgtatccta gaatagatgt ttctgataca gcatttccta gaatcaccat    175740
     gagtgctttc ttactgtcga agtagtgaaa tgccattgcc tgaatgtcca tgttggttac    175800
     aatatctcct ttgcacacaa gaacatcatt agatgttatc cttggatata aacttaagag    175860
     agacgcaact gttccatcgt atgtgtcgat ccccacatat tctaccggta catcgatatc    175920
     ttctcccaaa gcactcatga gatcttcctt ttcctcattc agcccaacca caaaaaacct    175980
     ttttgagacg ctctttaggc actccattgt atgtagaatc attgggctat tcatgattgg    176040
     gaggcatgcc tttgaaaact tctcattcac tattggaaac agctctgtcc caggacctat    176100
     caagattatt atctcaaaca tatgagaata ggggatggaa aatgaatcca attggtctct    176160
     ccatggctaa gtcaaggaag gaattctcgg ttctataatg tgtaggaaga ctaagggagt    176220
     gttccttttg ttcttttctg taagacttgg cataatgctt tgggaggtta gatttcagca    176280
     cctctattcc tcatatctgg aaagaggact gccatggttt aagccagata ctttgacagg    176340
     aaagatggct actgatggaa gattgtttgg cgatgcacag ctcaaagctt caaaccttag    176400
     gctcaaaagc ctgtataaag agatgaaagc tcttgtgctg tacatgggag ttgtattctt    176460
     gatattcaac aacaagatcc gaagcaaagc aatcaggttg ttgggatttc tttggatacc    176520
     caattcagaa gtaatgttcc tattacttct gatttccaca attaccttta tagagaaact    176580
     ctgtggtgta gggctcacac tagtagaagg cacgtgcagt gtgagatata tagagtatcc    176640
     gtttaatatg gtagttttat ttcttgtaga gctcccactc acaatatgcc tcataataaa    176700
     gctttttgag ctcctgagga aaaagactat ggcgacattc tatgctgcct ttgtaataag    176760
     caacttattc aacacctttt ggaatgcaag gatagataag aacaggctaa ccaaggttcc    176820
     tcttgagaag tttccgtcga aactacaagc gatgcttaag tccgagggac tggaagaatc    176880
     gatctacaaa gttaaaggca cccaagagaa aaaaaatgca tctctgattg gatttagcag    176940
     ctttaaaaga attgaaataa ccggagactt tgacaaagat ccaaaaaaac tatatcctgt    177000
     cctgttccat gaaataggcc attcgattga taacattata ctaaagaaaa agattattat    177060
     acacataata gtgggatgcg aggcgttagc attttggttg atttatgtaa aaggaagcaa    177120
     ggcttttgga ttttcagaca taacgtccga gtcatttgtc ttgatcattc ttgccatgta    177180
     tctggttctt ggaaggactt tgatccttat ccctttaaat atgtatgtgc agcgttcgga    177240
     gttatttgcc gatgaaattg cattggcaaa cggacatgga aaagagcttt ctcaaacact    177300
     gtttgacatg gctttagagc acagcacagt tattgatacg acatatcttt tcaatgcgat    177360
     agcatcgtta catcctattg ttagagaaag aatcgataga tgtggaagtc tcctgcagaa    177420
     atagtaacta aaatatccca tatttaggaa tgaatggaat tgaagacagc aatccatttg    177480
     aagagcttaa agaatatgaa gtggttgtgg catacgacga tgaaaacaag aagctttcca    177540
     acgtaatgaa ggatagaggg cttgattatg tcgaggtgaa tctggcggtt tctgagaagc    177600
     tcaggacaga atttatgaaa cattttagag tttctgaact ccctgtgctc ttgattgaag    177660
     gaatacctgc tcttgacgat ccaagtgaaa ggattaagga gtatattgag agaaaagaga    177720
     aaaaatcctt agagaaaatt cagagtgtga ttgatcctaa caagattact cttttcatta    177780
     agggatcccc cgaacatcca agatgtggat tcaccaagtc ccttatagaa attttgtatg    177840
     gcttaggagt aacaagggat aaaatagaat accttgatgt tctttcagat gaggatatta    177900
     gggagagact aaaagaaata aacagatggc ccacttttcc acaggtatac attaggggcc    177960
     gattcatagg ggggttggat attgtccgaa agatgtctga aaaaggaaag cttaaagatg    178020
     aactctcagg aataatctga aaataaaacc tgttgtttgt attcttgata catattaaaa    178080
     gaattccaac aaacaaaaag atgaagtacc tttctcgagg gatgttctat ttgttcttca    178140
     tgcttacgta tcttgcccag atgatagagg tcttgaatgt attgatcacc aaaagtcatc    178200
     tggactctgg acaaacagga attgaagaag gactagcaac aaacgaaatg gcaaagaaag    178260
     atcaggacta tgcccccaaa gccaagaaag caataggaaa aagaaacaag gagctacttg    178320
     aggatatagt ggcacacact atccatttta ccgccaacat cttgttcttt actgggattg    178380
     gaaaatcgtt tagcatgaga atacttggca agatctttgg ggagatattt gaccttgaga    178440
     ttgtgttcct tacagccgta atttcgatga tttcccttga tggttttata gagtatattg    178500
     tctgcttggt atataagaat ccgtcgctag aaatgatttt cttgtggtgt ttctttgcaa    178560
     ttgtatttgt tatcccaaca tgtatcctca tttctataaa gctcttgagg atctttggat    178620
     ccagtttcgt aatttcctgt tatctctcct acttcattct ggagatatct gatatcttat    178680
     ctgtatccaa tgtggatttt agtaagatgg agaaggtgcc atcaaatata ttttcggaga    178740
     atgtccaggt tcttatgaag gacagagggc tttcggattc tatctataga gaaataaatc    178800
     cgggaaagaa cgtcaatgca gctcttatag ggattggcgg tgctgagagg attgaaatct    178860
     acggaaaagt cgagaatatg aacgatggac agctggaatc tatattgatt catgaagtag    178920
     gacattccta tgatggaagt ttggtcaaga agatatcggt ctttttgatt cttctgggtt    178980
     ttgaaatgat gcttttagta ttcttgtacg ataacatagc aaaagaattc atatggaaca    179040
     atatttcgaa ggaggggtca tttgtagtgc ttgtatgcct ttattttgca tcaatccgtc    179100
     catggttgtt tattctgtat aaccttacgt ctcaaagtgc agagatgtac gcagaccttt    179160
     taacaaaaca atataactac aatggaaagc tggcagatac tctatacaag atatctgtgg    179220
     actcctttga tttcctggca ccatcctggc tgtacaacag cttaaactcg ttacatccca    179280
     gtataatgaa caggattgaa tatctaagca actaataaat ctttagaaca tttcgagtgg    179340
     gtcttgaggc tttggacgga gtttctttag tgggatttga aatctgatga gtcctgtaaa    179400
     tgcgcatccc caggatggaa gattttaaac aaagtgtaaa cacctacagc tcagaaggaa    179460
     gaatacatca gattgagtat gcaatgaagg cgatgaatct tggaacaaca acaataggaa    179520
     taagaaccaa ggattttgca atattgtgct ctgagaagaa aatattatct actttgcaga    179580
     atcctagaac agtagtgaaa cattatgaga tctacgacca cattgtgctt ggcttttcgg    179640
     ggataagcgg agacacaaag actattgtaa agaaatctcg agatttttgc atttctcata    179700
     tgcatatgta tggagaaaat gctagtgtag agaggcttct gaagtatctt tccagcctga    179760
     gtctaaggtt tggagaggag gacgaggcta aaatgatatt tcgaaggcct tttggagtct    179820
     cactaattgt ggcagggttt gatagcgagc ccaggttata ttctttggat ccttccggat    179880
     catatgttag ctacaaagca aaggctatag gatccggaca tgaagtggtt gagggtattc    179940
     tcgagaacga atatgaagaa tacaaggagc ttgaccagtc cttgaaaaag gctctttaca    180000
     ccctgtcaaa agtgatgaag gacaagatca ataaggagaa tgtagaggtt gtgacggtta    180060
     caaaagaggg aaacaagttt ctgactccag aagaaatatc ggtatatcta tgaatgaatt    180120
     tctaggaatc tgtttttatg tttatgtttc atcaggtatg tcatacgtac ttagatatct    180180
     atttttcttc cttactccta tcttcgtgca gtattcagac tcaaaactta cttcactgtc    180240
     ggtatagtct tttttatagt gctttttgag ttcaacaata gctctggtta gagagtctct    180300
     ctcttttagt aggctaaaca aggaaggact atagactcta ttcaagatag acttaagttc    180360
     ttcgtctgtt ggaagacatt ttcttgcaaa ctctttgaag tagaactcgt cgacttttgg    180420
     atttctatga actatgagtc ttaatgcctc aaggagacct agttcatggt atatgtactt    180480
     caaagactcc aaggaaagtt gttccatata ttttctgttg caatgctttt taaacaaggc    180540
     aatctttgaa tttccgcaca gcttatcctt acatccgttg ttgttattgc aaaaatcctc    180600
     aagaatctta gtgaagtagc taaagacatc gatgctgaaa tgagtaaata agtatttcaa    180660
     tattctgccg attatcttgt tgtatgtatc cgatccacag caaacctttt cgttttgtgt    180720
     cttctcatgt atgaatattt gtaatagtag ccgttctatt gtttcatcac ggaagtttaa    180780
     ggatgcaatc ctctgcattg caccatcata gtcctcaaaa tagatatagt tgtatagtat    180840
     ttcatgatta tatataacct tttggttccc gactagcttg tgctgaagag cttgaatagc    180900
     cttgtttttt tggttagttc ttctgtagat gcttgctaag accgaaggat ttctcctcaa    180960
     aatcttcttt gttatacttt tgtccaacag gcctgtgtca cagttgggtg tcccaaaaat    181020
     aaccaagtcc ttttttctta tcaagctcat ggatattgat cttagggttt tgtataaaat    181080
     tcacataatt ggttggtatg atgttctgga gaaatcggct tgtgattgga cattcagtat    181140
     aagtgggatt ggacgagtat tggatataag aaagaggaaa gcaatgggga tggacaccaa    181200
     gattaagata gatctagaca aggagatgta tcccgggggg tctgaagtaa gaggagccgt    181260
     tgacataaag atgaggagtc ctcttcggat aagtaagata aatctggtgt tctctaagac    181320
     aacaagacta aagatacagg agattgagag aaaggaaaat acagagaaca acgaagtcga    181380
     gaagatatat gatggataca gacatgaatt tgagatatac tcaagtgatg acccattaga    181440
     agaggtatct agtgggcacc atcgattccc attccgattc atgctccgga gagaagacga    181500
     aggatctctt gaaataaaag gagtctactt tgatatcctg tgcaatataa gaagtatata    181560
     cgacttatat gcagagattt atatccttgg agttcacaat ccggcatata ctgtccgaag    181620
     agagatacaa atagtagatc ccatcatgga gcccaggaac tttaatacag ccattgatgt    181680
     gctatcaccc atctgctttc taagtaggag atataacatc cgtcttgaag ttgacaagga    181740
     attctattac tcgggagact gtctagttac tgaagcttct ataccatcta agaagcccaa    181800
     gattaagaga atggagtgct ttatatatga aattctcagc gtttctgtgg aaggaaaaga    181860
     gattcttagg acaaaataca ttggaggggg agaggccgaa cattatgatg gtggaagagt    181920
     ccttcgggca tccctgaaga taccttcaac aacaccatcc actgtcatgg gcagtaactt    181980
     cagcataaga gttgttttgt tcataaacct tgagctgtat agaggaacac ctgtccgaat    182040
     caagaaatac attcatgtca tcaagaaaaa tataattcat ccagaaattg attgtatgga    182100
     tgttcttgag ggagaaatat atccggaaag aatacttgta ttaccataga gtttttataa    182160
     gttggatgat ttgaagattc ctgatggagg aggcccccag agtatgtagt gtttactagt    182220
     ctttcttcct attcttgcat gccttgacct ttctagacca tttccgttgt cttagcatgt    182280
     gggagaacaa gaagatgaat ccgggaatat acaccacacc agccaatact acaaagtaag    182340
     agagtatttt tcctagggag taatacagag ttttcaggca gtacatctca agtgcaaatc    182400
     ctatcggaga tgttaggaga aacaagttgt atcgaatgac tctaattgtg tcaacacgaa    182460
     acatatagaa aacatatctt atcgagtccg aaagatacca gcatgttgtt ataatgggga    182520
     aagtccagtc gataattcca tagtaccaga aaacaaccca aatgatgaac atccgggata    182580
     ctagctgcat cactgtggga acatatctag cattgctttt ttttgcacat atatttgcta    182640
     cttccatcag aaaaaatgtt tggcagagcc cagcctctct taggtatttt ggatccattg    182700
     tcttgtagaa cattaggctg gttgaaagag ctactataca gataataaag ccaacagtat    182760
     tgtatattct tatataactt aggtacacca ttatcagggg gtgtattttg gaaattgtct    182820
     ctgttctatt atcgattttg gcggatggac atttaggcac tttattgagg aaaagggatg    182880
     ccaagggatt gagtttagga acgtgtgtgt gtatggtctg tattccagat tattatgctt    182940
     taagcatgag taagcgggag ttttgttctc ttgaataaaa tatttcaagt tgcagacccc    183000
     atgcaaatat tcataggaaa gatcccaagt cacgttagcg aggaacaaat caaggagtat    183060
     tttggacagt ttggagaggt cacggatttg agcttgaagg gaacatacgg attccttaat    183120
     ttcgattccg aaagcagtat aacaagggtt cttaaccaga gatcccacgc cattgatggc    183180
     ttgcccatat ctgtggaaag agccaatgga cgaaaaagac ctcttgatgg agaataccat    183240
     gatagataca tggacatggg acgaggagga tactcccccc atcgggacta tcgaggattt    183300
     cgaaacgcac cctatccccc ctctatgaga tacgatggta gatctccagg aagatatgac    183360
     ccgaggtttc ccgatcgata cggaggtagg tcaccggaat accgtggaga tggctttcga    183420
     ggagaccctc aaaggagcag agacttctgt gagtattgta actcatgtcc catccatggc    183480
     ataagggatg tggtggattc aagaaaaaga ctacatacca caagggatca tcctaacaat    183540
     catctgaagg tagtttttga gaacattgct ccgaatacaa ctgttgaaga cttcaagaac    183600
     tttgtgcatg atcatggttt tgagccttcc tatgcaaggc ttggatatag tggaaatcat    183660
     gctgttcttg aattcaaaaa cattgaggac aaggataatg tcatgaagaa gctcgatgga    183720
     gtagaattca atggccatgt tctcaagacc agatcctatc tttccaagga tgagtacaag    183780
     agcagagaaa gggaaagtta tacgagaaat gaactccagc caactgatac aaactcatca    183840
     gagccacaag gtacgactgg tgatatttat gaagggattg aggacggaaa ggctgaaaat    183900
     gattaaaaac cttggatcac tttactagac atttttgggg tcatggtttt actccttggg    183960
     cagttccatc attcctgagc agtaattttc cgatcagtgc agtgtttgtt ctatagtttt    184020
     tcttgaatgt cacaatgtaa tttgtgtttc taagcaatat agagctcgtg ttctctttca    184080
     gaaatatttt actgccggct ccgaaatcta ttgggtcgat gaaataaaca accttgtatc    184140
     cagactcgtt ctgaaccagt gccttatgca tgccctctgt atgttctgtt cctgctttta    184200
     aagaaagtag aggtttggat atgcacaata tttcaataac tttatatccg cctttgtcca    184260
     gtgagattgg atctttacgc atcaaagggc cttgaagatg gaagttgttt tgaacaaagg    184320
     aagtaggaga aacgtatttt aatgagtgtt tttatctttc tctggtctaa gaaagagctt    184380
     cagaatcatt tggactgcta ggctgaagac aagaaacaca tgacctgcaa aatacacacc    184440
     tttccataca tgtataagat cggagatgct cagaagaaag aaggaggtgg tgaaatatgt    184500
     tgtaagaaga agcatctgga ttctagacag tatccagaac agggatggac aaaagcgttg    184560
     aagcaacttg ttgttttcct ttacaattgg tatggaggat gagaaggaaa gaaacattat    184620
     caaatagcat ggatttatgc catgccagag tgcggaaaca ccagatgttg ctatgcttgc    184680
     ccaaaatatg gacttttctt tcatcgggag gaaaaagcaa tttttcagcc aaatcccagt    184740
     acatatattc cagtaggtac ttaggtcctt tacacttgtt gctaactcta ctttcatgaa    184800
     gtcagcattt agaaggtctg ggaagttctg gaacgcaaag catccatgag agaagtgcca    184860
     agcaaagtag aactttatcc tatttcccac tgtgaagagg tacaaataaa taagccttga    184920
     tagtaacgaa gtgttctctt ccaaaagatg gctccttgga acacttattc ttaaggcttg    184980
     gaagagaatc agaaatgcaa aagattttag aaaagttcca tagggaggtc tttttggctc    185040
     ttcgtactta ttttggatga aatctttaaa tgttggggtt ggacctagca taaggcctgg    185100
     tgtaaacaac atgtacgaaa gggcatcctt tatggagttc gtcttcctgt catattcctt    185160
     tccaagatag cacattttta tggtcatcaa cattaaaact ccggagatgt cgaatgatcc    185220
     tgaaattctt tcttcaaata aaggtccgaa gattttgtaa atgtaaagga ttagaatgtt    185280
     gaacagagta aacgaatact ctgacatcgg gatgtacttg agaaggaggg aatttaggaa    185340
     gatcgatcca agtatatatg cagtgtgctt gtaatcaaag gcaatgtaca gaatcaacat    185400
     tgcggatagt agatgatggg ctcttgccct atttctcata gtataacttg tgaataatgt    185460
     tagaaaaagg gaagccagga atctgcgctc caaatggctt acctctgaga ttttccttat    185520
     cattaagagc agaaaatttc cagctatttt caaaagatat ttcgtgaatt tgattgatag    185580
     agaccaagac agttttggag atatgaaata aatgtcatcc agtcaattta ttgagatatt    185640
     gttgtaatct ttccttcttt ttctggggaa tgaaagtaga attcacacgc tgagtaagat    185700
     ctccaatatt tacctcatct agatgcatct cttcccaaga tttcaaaaag atttccatat    185760
     tgcctccctc atcgcaagcc aatagacagt gaagggctac ttctgctgga tcacccgtaa    185820
     agttcctgag agcccattcc ttcactatct cgggataaat atccatttta atgccaaaat    185880
     cgctacattc cttaacgcta ctaatatagc atgctacatc tgccatgtcc ttgtaattga    185940
     tctttgcata tccaccgctc agtttcagca acttcaactc cttttctacg agctctatct    186000
     gggagtctcc caagtaaaag cagccttgaa catctacggg cggcaacaga ttccatatgg    186060
     agctagatgg aatagagtca tgaattttct caagatctaa tggattttca acgagttcga    186120
     gtacatgctt gatctctgta tacctattgc ccctttttac tataaaagtg ttagatgaag    186180
     acactttttt tactgtgtat cctttgtctg gagacaggac ttgtgcttgt gatgtccctg    186240
     tcaggactga catttccctg cttcccgata caagcaaaag tgttttttct ccgatgccca    186300
     tggaagagaa attttactcg gaggatatta agtctgttag ctgtgatttg gatgaggcca    186360
     gatcttctat ccagaacgag gttcttgatg taaaaagtga cttgctatcg gtgtatctta    186420
     tgaatcttgt tctttacaag gagatggatt cggaagatag aaaaggaagc ccagtagaag    186480
     aaatgttgag caagacaagt attcttcttg agaaaatatg tgctattgag cgtagagctg    186540
     ggagtctcgg ggaggtgccc caaagcgaag aaaacaaggg cagtgtggaa gaggaagatc    186600
     ctgcagaaga gggaaagaga acaataacag acaaaatgaa aaaaaataag ttcgttaaga    186660
     agagaaaggc agaagatcga ataccaaggc ttaaatataa aaacaaggcc agaaagcttg    186720
     cagaaatggc agagataaag catgatggaa atatagacac caagaagcca agctttaata    186780
     aatttgacta gagactttag aatggagttt ctgggaaatg cttatgtttt ttcttcttgg    186840
     gactattagg tttaattcca aaaaaaaatt tgccctgaat agagatgagt ggaaagagca    186900
     gcaagggtga caacgttaca tctgcacttc tgttagcgat gaagactgga gaatgtattg    186960
     ttggatttaa gagggccata aagtctatca ttatgaagag ggcaaaatgc cttgttattt    187020
     catcaaatta cccatccaca aagaggaagc agcttgagta ttacagtgtc cttgcagggg    187080
     gacttcctat tattttccac aatgctaaca acgaggagct aggaaacatc accgagagag    187140
     ggcatagact gggatgcatt tcgatcattg atcaaggtga ggcagatcta atacctgcaa    187200
     agggagaata aaagttattt aattgatttc ttgtgtatat tggtctagta gaatttcctg    187260
     cccttacaaa ataaaacttt aaatgcatct tataaggctg aggtgtaccg ataggatgtc    187320
     ggtgtctgtt ttgattacca taggagtgga taatacaatc aaagaactga aggaggaaat    187380
     atgccggcat ataggaaaag acagggagca aattactctt aagagggaaa atagggaact    187440
     agcagacagc attgaaattg atgcatacga gcttaaagat ggggagtgta tagagattga    187500
     gtacagatga gcaagttctc atgattaggg tggtctttac ccgcgagaaa tagtctctga    187560
     tgttatacta aaagtgaaga tattatagac ccaggatgtc caaaaagata ataagagaaa    187620
     aaataaagag tggaaagaaa atagcagagg aggcactgaa ggatgtggtg aactacgata    187680
     tacttaggac agagtcttgt ggatacattg aagtagattc agacgaaaaa acttatgatg    187740
     tgacacaagg gaagattcga aagtatgtta gtatcaaagc atctgagcag gcgtacgatc    187800
     tgaaactaga aaacggccct gtgcatgcca aatattcgag aaatggaaac cacattcttc    187860
     taagaaatga taaaggatat ttggcatcgt ttaatagcaa atcgatggat cttcattttg    187920
     agatggatgt gaatgaaaca atacacgatg caatatatct ccacaacgaa cggtttattg    187980
     cagttgctca aaagaacaat gttttcatat acgacgggaa tggagttgaa cagcattgcg    188040
     taagagaaaa cagccatgta tttaaaatgg aatatctccc ataccactac cttctggcaa    188100
     gtgcatcgca ccaagggttc ttaaggtacc aagatatatc tacaggaaag attgttagcg    188160
     aaatttttat aaaagagcga agagttactt ctatgaaaca gaatccggca aatgccatca    188220
     tacataccgg cagcatcaaa ggtgttgtta gcctgtggtc tcctaactgt aaagaatatc    188280
     ttatgaaaat actatgtcat agaaatacca tttcaagcat tgagattgag agaagtggaa    188340
     ggtacatgat cacagcaggg atggacaata gaattaacgt gtgggacctg aggaatacgt    188400
     atacgcaact caacagcctg aaaggaaaga ccagcttgtc tgcaacatcc ttgagccaga    188460
     agaacatgct ggccctatcc tatgggaaca acgtctatat atggaaaaac ttcattgatt    188520
     tgaattctga cgaggcgcta tatatgaagc acaagacggg aacacttgta tcaagcattg    188580
     acttctgcaa ctatgaggac atactatgtg ttggaagctt gaatggaata tcaacgatca    188640
     tcgttccagg atgtggagat ccggtatatg actcctacga ggattctcca tttatttcta    188700
     agaaagcaag aagtgaaaag gaggttagaa gtttgataga aaagatacct tacgagctta    188760
     tatccataga ctccaaagtt ggaagtattt tcaaagaacc tagaatggat agacctaagg    188820
     aggagttgcc taggtatttt gaagataagc ctgttagaag gggagccttg agtaggttct    188880
     atgatagagg agattgaaca aatggtcttg gtattccgag tgagtaaaac agatggtttt    188940
     ctttaagaaa ttttaatttt tcgatgttct gggaaacatg taaagttaac tacttcgatt    189000
     caaaaaacgg atgcttcaga cattcttctg cagtaggcct actttggtga tcataaacca    189060
     atatcctctc caacaggtct attgcattgg catataaggc agccgatcca ggaggtgaaa    189120
     aggaggaaag taacactctt tctcccgtac cctcgtgttt tgggctgagt gggtccatct    189180
     tgtatttctc aatgtacttt cttaggtcag tgtatcctaa aactctagct atcttaacaa    189240
     gttgatcact attactttct ccatggaaaa aaggtcttct cctaaatact aactctgcaa    189300
     gtacacatcc aaaggaccaa atgtcaagag aatagtcgta gtatggataa tcaaccagta    189360
     gttccgggct tttgtagtat cggcttgcaa ctcttacact atattctttt cttgggtgat    189420
     aaaactcagc aagtccccag tcgattatct tcaactctct tttttcctga ttgattacca    189480
     tattctgcgg cttgatgtct ctatgaatta tccccatgcc gtggcagtag ctaagtgcag    189540
     aaagaatctg tctggaatac tcgacaacat ccttgtaact taatttttca aatatttttg    189600
     catagtcttc gtgctctaca tattcgaaga tcaaagagta tatttgagac tcagaatcta    189660
     caacaacatc catcaagttt atgatgtttt tatgagaaag attcttcagt attagaacct    189720
     ctctgcatat ctttgccttc cgtacgggct ttaaagtttt tattactatc ttctctctat    189780
     ccttccgccc ttcaaagacc tcggagtact ttcctcggcc cattcgctgg tatatttggt    189840
     atctttctat gcatccagta ggtatgctat agtattcata attccaatac ttctcatcct    189900
     tcttctcatt aacatacacg tttgatttcg ctatagttgg aataaccatt gtgtagggat    189960
     tcttaggaag gccaggaaag taaaatcctg ataaaaccat ttaatgttat tgaccaggat    190020
     tgaagtagac aaatctacca actcattgcc ttgagtaaga ggacttaact ctgaacacac    190080
     cctgttgccc tgtcaaacat atcagggttc catcttggtg tataagctgt ccttcgcaaa    190140
     tagcttttga attccttatt cctttacact ttacaatata atacaaatag caatcatcaa    190200
     tatttttttc aagattcaca aagttcacta catggttcaa agaagtcaat agagatagat    190260
     ccttggagaa tagagacaga ttcgacgtta tgagagcagt ttccattagt agtatatcgg    190320
     taattaaggt gataagggaa gccttctcga ccatactctc aggtttttct tttattctaa    190380
     tacggatttg tctcatgtcc ttattctctt tccctacatc cacatccaac accttgaaca    190440
     gcatcaacat gttttcatat agaacctgga acttgacggc tatctctgcc tggtttgtcg    190500
     aggtgttggc aagggacctt gatatatatt ccgaaaacgg gataaattca tcatcataag    190560
     ctgtatacgg gggactttcg tagtcatggg aattgttatc cggcctgcta aagctgatat    190620
     gagaactaga tatcaaaaca tcgtcctgat agcaatctac ctgcctcatg tccatgatac    190680
     taccatttct tagattttta accgaatacc taaccttttt gtcagattta catcgattaa    190740
     taaacagaat gttcattgta accgggactg aatccgagct gacggttgaa aatgcagacg    190800
     caagggattg tgctgccaac tgtcctccga atgcagggta tcccggcaaa ggagaccaaa    190860
     ggttacttcc ttcaaaggtc cagctgtcaa gccttgctat tttgagaaat tccatggggg    190920
     attccctcag taaggttttt tataggaatg agaagattga aatgttatgg ctgatgaaaa    190980
     ggaatttttt tctaccttgc aaaatgtctc tggagagaga accgttgaaa ggaaaagtat    191040
     ttgtgtttac aggggacatg aagatgagca gagacgatgc gaaggcaaga gtaatggttc    191100
     tcggtgggag atgcacaaca gcaccatcgt ccaagacgtc ctttcttgtt gtgggagaca    191160
     atcctgggcc gatgaagata caaaaagcaa atgaattgaa tataaaaatc ctaaacgaag    191220
     aggaatttgt taaattggtt gagagtaaca tagatgattt tagcagtaca cccgagacag    191280
     aaaaacatct aaaaatggat ccggaaaaag ggggtgggtc tgctttaagt agtgtatgga    191340
     atgaaaagta caggcccaag agaaaagatg aaattatagg aaatccaggg attatgaagc    191400
     agttggagga ctatcttcag ggatgtacaa aatataaggc agctttgtta agtgggcatc    191460
     cgggaattgg aaaaacaacc atggcccaca ttgtctgtag atctcttgga tttgatgtag    191520
     tcgagttcaa tgccagtgat attagaaaca aatcggagat aagtagcaag gtaaggagtt    191580
     ttaccaatag ccaatcgatt tgttccggaa catcaaagaa gaaagctctc ataatggacg    191640
     aagtcgacgg gatgtcaagt gacagagggg gaattcccga gcttgtaagt gtgattaaaa    191700
     agacaacaat accaattata tgcatatgca acgatcgcaa taatctgaaa ataagaacat    191760
     tgtccaacca ttgcttggat ctaagattta gaaaaccaga ctctaggcca gtactcttaa    191820
     gaataaaaca tatactggag aaggagggaa aaagaatacc tgatggagtt ctaagtgaaa    191880
     taatagcaaa gagcaacgga gatataagat acgccatcag catggtacaa ggaatttcac    191940
     tcagaagaac tcttaattcc agtatatcta caaacttcgt caagaagagc gtaatgaaga    192000
     gcctgtttga tgtagcagga gaagtctttc aaagaaagtc ggtctcggaa aaaatagacc    192060
     tttattttga ggattactct ttggtgccac tttttgtgag cgaaaacgtt ctaaagacct    192120
     cttttaaaag tctaggagac ctttctgagt gttttgactc aattagctta ggagatgttg    192180
     ttgaaagact cataagagga gcaggccagg attggagcct agcaccactt catgcagtat    192240
     atagcgttgt aataccaaca agaggaaggc cgttaacaaa gaagatgatg ttcccatcat    192300
     ggcttgggca aaattccaag catttgaaag cagaaagagc actccacaca gcttcggtgc    192360
     attcatcatg cagaatccgg gcaaatgccg aagagctaag aaaatacgct ctggaattga    192420
     tactaagaag atattcatgc catttgaaag catgttccat tgataaagca atagacaaca    192480
     tcattgaata tgatatgacc aaagaggaca ttgatagcct gggaaatata gtgctaggag    192540
     gcgtagagat gttcgaaggc atagaacgta aaacaaaaat tcatctggac aaggaatata    192600
     agaagctaaa gaggaaactt ccatatccag aggtagaaaa ggaaggacat catactgaaa    192660
     gccagagctc ggaagaagaa atagcttctt atcaggaata ttagggaaga tagtcggact    192720
     agtaaagatt ttatttgtca tgggtttttc taaccttttc atagcataga ggttcaatag    192780
     caggatatct catatgctct tggatatact tcgttaattg tatgcaatcc ctgattccga    192840
     tacctatgtc agcccccgac ttatcctctc tcagagagta aaagatacca tcaataacct    192900
     tccccactat caaacctttt ctaattgttc tcttaaccag atactctact tcttcaggat    192960
     tgatgtctaa gagatggcct atgtctgcat aagatatttg ggaatatata acacttattc    193020
     ttcttattcc ctcctgaatt acattttgat ataatcttct tgccacaaag tacaagcctt    193080
     gagacatcaa ttcattctta ttgttttcta gagtctcctc aaactttttt atctcggctt    193140
     tcttcacaac agaagcaagt tcaaagtatg ttttaagact tggcctataa gagtacggaa    193200
     tgttgtaatc gctgttaagc aacatacaca aaataacacg tttctcagca cctaaaatca    193260
     catcacgatt tgttgaaagg atgatgcttg tgtgaaagca cttcagggcc gactcgtagt    193320
     ctccttcaac catggaaatt attccattgt aataattgta ccttgcttgc tcagaagttg    193380
     ttacaatgga actctcgatc ctttggaata ttttgttgct aataagcata tccagaagac    193440
     aattggttat caccgaaacg gtatattcat taccaagctc cttatttgta acaagaagac    193500
     tgaaaagagt ggagttatcc tggcattcgt tcttccttgc aagataaaaa atcttcacaa    193560
     cgagcccgat aaaataatcg tagattcttt tctttccaat gagataaggc agcaggtttt    193620
     cattaaccat cttgtcgatc ttcttaaact ccttcctcat gaaaagagct ccaagaacta    193680
     taggatatgc agcaatcctc tcaagctcac ttccaaagtc aagagagtca aatgtctcag    193740
     gcttgatatc tttcataaat gcaaacacac gtctctcgta aatatccatt ccttcttctc    193800
     tgtttgtgcc tagccggctt aatacctcaa gtaactcttc aacacgttct ttttcactca    193860
     tcttagggtt tgtttatcaa atgaattcaa gaagagaggg caagccgaat tggctcgttc    193920
     agccaagtaa agaggatgaa tggtagtcat tagtaagcta gagacattat agaaaggaag    193980
     tttgggaaga ctaacaagtc ctagaacttc attactacta gagacccttt aaattaaatt    194040
     atagatagtc atccctaaag taaaatatgt ttcttagaga gatgattgag ttcttgaatg    194100
     cactgtcaat tgaactctat caatagttaa atcataactt aatcattaac gccataatta    194160
     gccatatata ggagtttaaa gttataaatc ttcttggagt taatcaccct aaggaatatg    194220
     aggctgttgt accaaagcgt tctaggatta atgttcttag tttccatcca tgcttcagat    194280
     agcaagggcg caagcggagg cgagagcaag gttgatcagg gaaatccttc gctggagcca    194340
     agttacaaat atgtagcttt ggcagtcaaa gttaaagagc acagcaatct ttacctcagg    194400
     gtttcctctc gaatacaaaa tgtaatcaaa gcatgcaatg aagggaaagt ggctttggaa    194460
     gagaaccact taagacttta taaatctcta ggagagcttt ctgagcttct ctttaaaagc    194520
     tggaatgatt tttcttctct cctagaacag ggagctgagc taaaagatct taaaagagaa    194580
     cttctggata taactaagct ggaatcccgg gttatacaaa tctctgctga attgaatatt    194640
     gaaatcttgg tcaacgaaga tttcttaagg gaattcaatg agcatgcgga aaataacgat    194700
     cacaaagcat ttgcagagtt actcggagat atgatggtat ctgtacgtga atcacttcta    194760
     ctccgcgtat ctaaggggaa ggaagctgaa gagaaacaac aggaggaaca agaacaacaa    194820
     caacaacaac aacaggggga gcaagaacaa caccgggaac aggaataatt agctggaaat    194880
     taaaagaaat attatccatt aagctgtttt attttttcta tgtagatctc agatggactg    194940
     ttattttaag tgctagaatt cctttgaaga aattcagaaa agacttaagg gataacataa    195000
     taattgatca gttagattgg gatccctaaa aaacacggta gaagggaatt atatgatgta    195060
     gatcttaaaa ttagttgcaa tgaggagaag gaaatgccag attaataaac aagtatattt    195120
     taataattaa tagaactctg accaatattc cgtatcggtc gataaaaaca aagcatataa    195180
     gtattttttg atgaaggaaa aatgcttgca ataaaggttc ttgaagttct tggactcttg    195240
     ggcaaatcaa gagggaaaaa tcttctcttt ccttcaaaaa aagctattaa tgttaacaac    195300
     gtagctaaaa gttggggaag tgcctggaag agagaagtgc ctaggagaga gaagtgttct    195360
     ttggatgggc agatggatat tggaaaagtt gacaaaatta tagagaatac tccaagaaga    195420
     gataaaaaaa ctatcttttt gtttgacgta gatggaacgc ttacggaatc cagatctcca    195480
     atatctagga agatgaagga gatgctaaag gaggttaaaa agaaggttct cctaggattt    195540
     gtgggtggat cagatctttc aaagcaaaag gagcagattg gagacgatct tcttgagcta    195600
     tttgattatg gatttccaga aaacggtctc agcttctaca agaaaggagc tctgatgtct    195660
     cagaaaaaga taattaacgt cctcggagag gaactcctta aagagttttc caactttgtc    195720
     ctagagtatc ttactaagct cgaaatcccc atgaaaagag gtaaaaattt tgttgagcat    195780
     cgaaactcaa caatctatat aaatttaata ggaagacgtt gcaacagaaa ggatcgtaga    195840
     aagtttttgg aaattgatga gaggggaaag ttccgagaaa aaatggttgc tgcgatgaga    195900
     gaaagattca aggacacttg tctagtgttc tctattggag gagaggtatc aattgattgc    195960
     tttccgaagg gctgggacaa gacatactgt ttgagacaca taaagaggga gggaatcgag    196020
     aatgtatact tctttggaaa catgacccaa gagggaggaa acgactacga aatctacatc    196080
     cataaggatg tccatggaac aaccgttaaa aaccctgatg atacttatga aaaggtaagg    196140
     cagaagctga aagatctgaa gcttggggat atggacaaga attaaacact atagtaactt    196200
     ttaagatttc tttctactca gaccacattg agacatcggc ctaaaatgaa aaaaattctt    196260
     taattggttg tagcctaact tcttccttct ctcaataatt attcctttat agctctctta    196320
     actaggtcgg agtttagctt accgagatag tccatttaat cattgtgaat acatcaagaa    196380
     ttataacaat gataaagaga aaaataagtg gaattttact ataagtctca acacacctta    196440
     gagattgggt ttttcttcag taggatgatt gaaaggccaa agatcataaa gcacaagaag    196500
     agctaaaggc cacagaaaag gtggaacgga ggataaaaga aaagagagag ggaaatagat    196560
     atagatccta gaaaagggag agatacaggg attggtagta gaatgaagta tggttggatc    196620
     ataaaaagaa tttagagtaa aa                                             196642
//

If you have problems or comments...

PBIL Back to PBIL home page