(data stored in ACNUC8465 zone)

HOGENOMDNA: ENINT1_8

ID   ENINT1_8; SV 1; linear; genomic DNA; STD; FUN; 205935 BP.
XX
AC   CP001948;
XX
PR   Project:42703;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Encephalitozoon intestinalis ATCC 50506 chromosome VII, complete sequence.
XX
KW   .
XX
OS   Encephalitozoon intestinalis ATCC 50506
OC   Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-205935
RA   Corradi N., Pombert J.F., Farinelli L., Didier E.S., Keeling P.J.;
RT   "The complete sequence of the smallest known nuclear genome from the
RT   microsporidian Encephalitozoon intestinalis";
RL   Nat Commun 1(6):10-10(2010).
XX
RN   [2]
RP   1-205935
RA   Corradi N., Pombert J.-F., Farinelli L., Didier E., Keeling P.J.;
RT   ;
RL   Submitted (22-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Botany, University of British Columbia, 3529-6270 University Boulevard,
RL   Vancouver, British Columbia V6T 1Z4, Canada
XX
DR   StrainInfo; 819376; 0.
XX
CC   Linear chromosome is missing portions of the telomeric regions.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..205935
FT                   /organism="Encephalitozoon intestinalis ATCC 50506"
FT                   /chromosome="VII"
FT                   /host="Homo sapiens"
FT                   /strain="ATCC 50506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="nasal tissue"
FT                   /db_xref="taxon:876142"
FT                   /culture_collection="ATCC:50506"
FT   gene            complement(<472..>1242)
FT                   /locus_tag="Eint_070010"
FT   mRNA            complement(<472..>1242)
FT                   /locus_tag="Eint_070010"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(472..1242)
FT                   /codon_start=1
FT                   /gene_family="HOG000150044" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070010"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0080"
FT                   /db_xref="GOA:E0S7T1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013949"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7T1"
FT                   /protein_id="ADM11766.1"
FT                   /translation="MVESIQLGMERMISELEDYKTRGIFSPHELRKIVETRKKYELRLQ
FT                   RPEKKLLDFMRYIKSECILEKIRDKRVKKKNVGFSLHDMNISKKIVELYRSALYRFNDP
FT                   RIVSQFTAYVMGKKMYGEMKNVFAECCTRNPLDVDLWIYCAFKLFEVGDIESARAMFLK
FT                   GIRMNSKSTRIRIEFFRMEVMYIEKIEIQNKEIGLDSDDKDEIERGEVAFAIFVDCFNS
FT                   PSFTGKEVNEVLKISESVKELKEKIGEYARSKGL"
FT   gene            <1318..>5265
FT                   /locus_tag="Eint_070020"
FT   mRNA            <1318..>5265
FT                   /locus_tag="Eint_070020"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT   CDS_pept        1318..5265
FT                   /codon_start=1
FT                   /gene_family="HOG000222974" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070020"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /note="similar to ECU07_0090"
FT                   /db_xref="GOA:E0S7T2"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015700"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7T2"
FT                   /protein_id="ADM11767.1"
FT                   /translation="MLKRVEEDEVDIRIKRISFGLLSPRDISGLSVHEISSKDLYDINT
FT                   RVPLPNGPLDLRLGVGNKKDKCATCGEGLATCIGHFGEVKLVLPVFNIGLVKNTISTLN
FT                   CLCKSCGSILLGEKKKIYFKKKLRESSGGNDTKLILRKIIAECKKANVCFVCSSRNGQV
FT                   KKTFGFRMVHEIEDLEKRKKDKNKGSGGVNSSDYEEINPLMALNIFRMMKEDDYELLGF
FT                   SESPERLIIQSIIVPPSCIRPSVSMDDEGTNEDDITIKISEIVHTNKVLKEGIEKGNPL
FT                   NLINEDWDHLQLQCALLINSELPQVGIPGQPIRGIVQRLKGKNGRFRCNLSGKRVDFSG
FT                   RTVISPDPNLSIEEVGIPERMAKILTISERVTSFNKKKLQALVLNGPEKYPGANYVVGE
FT                   KFKRFLMYGKKDTELKEGEVVERHLLDGDMVLFNRQPSLHRMSIMSHKVKVHGNKTLRF
FT                   NECVCTPYNADFDGDEMNVHVPQTEKARAESSILMSVSNNIVTPRHGEPIVAATQDFIT
FT                   GLYLITGKDTFFDRERFGQLVSYFSETRISMKPAIKKPVELFTGKQLVEALIKDSFAAS
FT                   REDYRSPYGGCISLVGKNRSFKTHDDPNDGSVIILDNLYYFGRLDKSIIGGENKKDSLI
FT                   YAIMKVSNKAAIRVMNSITKLCSRYLGEVGFSIGLDDVQPGPILRQKKETVVGKGYLEC
FT                   ENKILEYSKKSESSEEMLEMEISSILNRIREECGSICINELSIRNSPNTMQACGSKGSK
FT                   INVSQMVACVGQQIVSGTRIPNGMDDRCLPHFRKGSRTPESKGFVRNSFFDGLTSPEFF
FT                   FHAVSGREGLVDTAVKTAETGYMQRRLMKALEDLSVQYDGSVRNSNMEVVQFSYGEDQI
FT                   DPVISEGDDPVNLERVFLQAKSVFLHQLNSGRFSHSLQPESCDVIDSLRELIPKGYPIE
FT                   RMINKRFVKSLQELIKSKSEERFSFDGTSFPYFSSRDFVRTFFFMVSQKMMDLIIEPGT
FT                   TVGAIAGQSIGEPGTQMTLKTFHFAGVASMNITLGVPRLKEIINAVCNISTPIINAELN
FT                   DSQNLFAAEVIKGRIGRISLKDICSSLTEVVDKEEIFLDIAIDLESLSRLKLNLDIHKI
FT                   ERLLSLHDQIRIVGNNVLRVFIKKITDQSYFNLQKIKKKLLGTRICGAPQISRVIINSN
FT                   KGQYSLVIEGTGLLSVINTDGIRCSSVTSNSVTEVEEVLGIEAARAQIIHEIEYTISNH
FT                   GIKIDPRHIMLLADTMTYRGEVFGITRFGISKMSRSTLMLASFEQTSDYLFEAAAQNKS
FT                   DEICGVSESIILGIPICIGTGSIDLYWRRDS"
FT   gene            <5317..>6045
FT                   /locus_tag="Eint_070030"
FT   mRNA            <5317..>6045
FT                   /locus_tag="Eint_070030"
FT                   /product="NGG1p-interacting factor 3-like protein"
FT   CDS_pept        5317..6045
FT                   /codon_start=1
FT                   /gene_family="HOG000014260" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070030"
FT                   /product="NGG1p-interacting factor 3-like protein"
FT                   /note="similar to ECU07_0100"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7T3"
FT                   /protein_id="ADM11768.1"
FT                   /translation="MSIHEIGKAIGRFASLRRAKTDWDNVGVIIDSGVEDNKVLLTIDL
FT                   TEPVLEESIELGIKNIIAYHPIIFKAIKKLGPKESIVIRCISNGISVFSPHTALDPLMN
FT                   NYIYSLINNGAFLYKKNYGPNTSTIENAISILKEKSGIRNFRICLARGHTMESVPESMY
FT                   VGVGATFRNTPLKNSIVVTGEMSHHDLLSCIANNATVVLMEHSNSERICLEHISGKLQE
FT                   ELPDYKIFISTRDKDPVTII"
FT   gene            <6102..>6413
FT                   /locus_tag="Eint_070040"
FT   mRNA            <6102..>6413
FT                   /locus_tag="Eint_070040"
FT                   /product="60S acidic ribosomal protein P2"
FT   CDS_pept        6102..6413
FT                   /codon_start=1
FT                   /gene_family="HOG000149376" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070040"
FT                   /product="60S acidic ribosomal protein P2"
FT                   /note="similar to ECU07_0110"
FT                   /db_xref="GOA:E0S7T4"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7T4"
FT                   /protein_id="ADM11769.1"
FT                   /translation="MEYVAAYVMFDKVGKELNEKSMMDLFDAIGGKVEPETMRLFLSKV
FT                   AGKSIDEVMSKGKEFMASLAISSAREQAPAQSTDASAPSQAAETKDEEEEDFDIFAAF"
FT   gene            <6504..>7157
FT                   /locus_tag="Eint_070050"
FT   mRNA            <6504..>7157
FT                   /locus_tag="Eint_070050"
FT                   /product="hypothetical protein"
FT   CDS_pept        6504..7157
FT                   /codon_start=1
FT                   /gene_family="HOG000150043" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070050"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0120"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7T5"
FT                   /protein_id="ADM11770.1"
FT                   /translation="MSECEYCKSRKMLPLNGKYYCEECEIYYVYKDGRQQYSNLPIEEI
FT                   SQISVGDHLCKKCRLKYSEKKSIVCTTFREYFKKLPLCRKCKQNNQKCIKNTFFQNFIL
FT                   YRTYSRVFSVQSVVFHSIWLYLMGTMFLSKLIITNLIIYKRKGLKLLECLMSSILLIPL
FT                   GYWSWGTTVFYLYCFLTMVFSKRWYYKVPVNLDGPPPNILKYLEHLNIGRKKDG"
FT   gene            complement(<7211..>8143)
FT                   /locus_tag="Eint_070060"
FT   mRNA            complement(<7211..>8143)
FT                   /locus_tag="Eint_070060"
FT                   /product="anti-silencing protein 1"
FT   CDS_pept        complement(7211..8143)
FT                   /codon_start=1
FT                   /gene_family="HOG000034092" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070060"
FT                   /product="anti-silencing protein 1"
FT                   /note="similar to ECU07_0130"
FT                   /db_xref="GOA:E0S7T6"
FT                   /db_xref="InterPro:IPR006818"
FT                   /db_xref="InterPro:IPR017282"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7T6"
FT                   /protein_id="ADM11771.1"
FT                   /translation="MFAFHCVFVFKLKNLILLSGTMGYLKLKSVEVDNTVRRLMDPLKF
FT                   NFRFACSNEIKRGVEFVVLYNMDVHSDENDQVLAEIEVAPIPKGKIEFSIDANAPDVDR
FT                   IPLDELFGLTSILIIGKYQGRQFIRIGYIVDVSYPGIPSSKLVKNDVEEPSEEIGDKEE
FT                   EEEGEESSEGETETDDSSYLDKDEEKEEETEPRTFMEAVEEVVKEGKERVFESEGKEEE
FT                   KNEKVESDSYSEINRELNKGVAEETEKDDEDKDIIEYCGYKIDKKQIEVKLMDPPVINL
FT                   FEIEWEEETFDKEKSKDSDEAPVKKQKVE"
FT   gene            <8170..>12135
FT                   /locus_tag="Eint_070070"
FT   mRNA            <8170..>12135
FT                   /locus_tag="Eint_070070"
FT                   /product="putative Gcn1p-like translational activator"
FT   CDS_pept        8170..12135
FT                   /codon_start=1
FT                   /gene_family="HOG000150042" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070070"
FT                   /product="putative Gcn1p-like translational activator"
FT                   /note="similar to ECU07_0140"
FT                   /db_xref="GOA:E0S7T7"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7T7"
FT                   /protein_id="ADM11772.1"
FT                   /translation="MPEKVEKKDYNYHSSKLEDLLLRLPSENKGERINLEGCILQALEI
FT                   LFGKSTDYLILGLKACKAHKLGLFHKESIKDFMKKNELVNGYVGSFFAWLVDFFPISFV
FT                   EILFEEEATIFKHYTKVLMKLYKSPKVTESRLATERQDFNTLSCITKPKIAGLIRYPGV
FT                   VTYLTKNLMYMNEEERLFLIKRYLKREDFEYYLNTLIDRSQTPEKYRADLDEYLKNGIL
FT                   EDRSGKYSVFMRVYNFIKKNNHKTIEDVGVVERVFDGYSVEEFLQSDIGLIFVTQTIEY
FT                   IGIYSGSVQKCRDIISRALKSDIPRDISKTLWNTLITNRRVFLECIEKFKIFEDEDLAR
FT                   ILIYRRSTSKEEGPSIYKSISYGDGIYRKEAVEYVVESFSTQEITNVMLKQDSDERSFL
FT                   LECIYRKALLGEFDFRIFEIEDEVWVEKTYDEIFKTLSHNIYDSLVEKRPELLFDYCFR
FT                   HRDLRRKYFEEIDKENCTIEEGICIHKILRHESKMLKSLKSNKSYAEAVYGDTNEGNEI
FT                   YMMSTLMDPIPSSNIVEFIYLLTLIRPEDAKYYMCEYFEEICEQATNCLKEESSFDSTD
FT                   YSKVLSLGDLSLMYLVPFHQMIETMFSVHLRNRYLVYTIMDSLLESIVGGVQNLRLIIL
FT                   KSMDSNSVTSHHIVKYIDTLTPLLHNSNIQICNESRRLLMEIPIITPELVCLKSQMVQS
FT                   IIDKMYAKSFFKSIRRQQFNHYLCFNTLNMLVQTLTMHIKELKEDVFPILSSLEFIAHP
FT                   QDLKLVFPVIFESLSSFVIENAFYLDECCSVVASLMKFGGDISFDRLIDNMGLSLRVNK
FT                   FLVRCLKASNNEIAESVINRIIRKGSGDVDIREDTGEGSLYVEPFFLAYAPELPIFKEY
FT                   LPIFKPLLKRLFLSSDTMKQEIASKAFESMDILEFLLTCCIIGQWKTRLLCIELFDKKG
FT                   GEDSRVLAMLFILRNDTHSALRKKALDIWKSKVVNTNSALKDIYRTILGSLGYKESSSP
FT                   FRDSIMGALSDLITKYSGYVEKYLEDAMNEEHVGSNDNSISNPLGLNKCEEGLKIISKK
FT                   EVLEVILMECVKSGKYMNQALDFSIQNSSTDIFRLLLQIPSYREKVIEIVGNRIDDLVM
FT                   SDLFTGDSHLGIDLFKMTGKTSLFKFLKNSDKMSLLESMLIEKEPNTAHIKKLLKCMKP
FT                   SEKLEKCLLVSDPLYTSIFYGSGEKMDDQGHQRELFIRAFNTLNYQELKPLIIPDYLNL
FT                   LLDVSYKNVNDSQSLIKILCTTNSLRALERLNYVVSDMEIEDSLFVLSGHLLRNYLSYE
FT                   KREAVLPSLNLLYKRYSAKLGVFGLMIRRLLDDSGYL"
FT   gene            <12196..>13080
FT                   /locus_tag="Eint_070080"
FT   mRNA            <12196..>13080
FT                   /locus_tag="Eint_070080"
FT                   /product="hypothetical protein"
FT   CDS_pept        12196..13080
FT                   /codon_start=1
FT                   /gene_family="HOG000150041" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0150"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7T8"
FT                   /protein_id="ADM11773.1"
FT                   /translation="MILTKMAERKLDSTPTSLYLRNGKIYVGLKKKYAIETEYDVLILK
FT                   KIPVEENIRAIVGHEEGLLFFLDKGGLYGLSWGDDNAANRILFRKKIINTGLYDQSSGR
FT                   VVIGTSKGKVLVLNQSLEISKTFYESPSGIINLSVSDLGKVACIYEVDSSVKVFDLKHP
FT                   EVKSVSLSNGFPQAIAFVGSTHLVVGGDSGELCVVDTTVMSIVSSLKIPQAVTVLLWKD
FT                   GYLLIGGENILYLSSVTEDHIEIIDSYECNGFVNAVTLEDGYAVVGIGKEPRLGRWKVK
FT                   KNGEHKLIVLKVG"
FT   gene            <13134..>14129
FT                   /locus_tag="Eint_070090"
FT   mRNA            <13134..>14129
FT                   /locus_tag="Eint_070090"
FT                   /product="DNA 3'-phosphatase"
FT   CDS_pept        13134..14129
FT                   /codon_start=1
FT                   /gene_family="HOG000150040" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070090"
FT                   /product="DNA 3'-phosphatase"
FT                   /note="similar to ECU07_0160"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR006551"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR015636"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7T9"
FT                   /protein_id="ADM11774.1"
FT                   /translation="MKISYIEGGLLVVEHGEIDKCLNKLIMFDLDMTLISKNTGQTSKD
FT                   WEYLFPQVPMKIRELSKQGYFIGIASNQSQLIRLNVLEEFVEKVCNILADLDAPIVFLA
FT                   ALERNEYRKPSTGMYEYICREYVDESKITKKIYVGDAVNSSLGPGHTNSCDSKFAHNAG
FT                   MEFKHPDEFFRGTKLVYFHENFDIRKYREGSFETDGEKKIIFVFGRKKHCGKRFFAKKY
FT                   FPNHRIINEKAFSNIQENCILINCGDRHLIETIMARYPEQYSMYYLNYPNEVMNYLKTL
FT                   AVLSGEKEEEFVPLDACTFSIIEKYGVKVPFIFDSSGFDEKKTKLSRMQL"
FT   gene            complement(<14153..>14464)
FT                   /locus_tag="Eint_070100"
FT   mRNA            complement(<14153..>14464)
FT                   /locus_tag="Eint_070100"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(14153..14464)
FT                   /codon_start=1
FT                   /gene_family="HOG000150038" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0170"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U0"
FT                   /protein_id="ADM11775.1"
FT                   /translation="MNTLGFFLSENKEVDVSSQEDRSKRSKPSSTWGLGLYKNSKREER
FT                   YHCEGLIEPGRVKFLRDFYEKNVFCNKSERVKKKFYSLIPSVRERVKILENAIAREEI"
FT   gene            <14623..>15786
FT                   /locus_tag="Eint_070110"
FT   mRNA            <14623..>15786
FT                   /locus_tag="Eint_070110"
FT                   /product="acid phosphatase precursor"
FT   CDS_pept        14623..15786
FT                   /codon_start=1
FT                   /gene_family="HOG000149155" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070110"
FT                   /product="acid phosphatase precursor"
FT                   /note="similar to ECU07_0180"
FT                   /db_xref="GOA:E0S7U1"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U1"
FT                   /protein_id="ADM11776.1"
FT                   /translation="MIKVLLGISFLLRSVRSTKNIALEKSLTPFRRYCQSGYKFPEKAE
FT                   NYNLEKLFVIFRHGARAPVRNLTREWDNQECMPCNFNDNVISDCKRKKCSEGDLTHRGF
FT                   AQMITLGKFIKKIYKPLLFDKQVKMENIKMRATKIPRTHSSLAGVIRGLTGDTEIGNVE
FT                   VPQKDDSLLNTLGCASTKEREDVTRLFDKPSIVQDNQTFSRHPKPQERADHYYTSLCSR
FT                   VNVDCAELNCNIKNVEDHMKSANDAWTYMATIGSKNVENRKRLFGRFARDLLIDIGEEK
FT                   QILLYSAHDSSMSAILVGLETDVLEWPSYASALFIEIWCNTGKQYVRMVFNNRVVKPKS
FT                   FLDDYIPIRDFMELIKSSSASNPQEKTSESSNIEENKNAEEDRSEKR"
FT   gene            complement(<15846..>17021)
FT                   /locus_tag="Eint_070120"
FT   mRNA            complement(<15846..>17021)
FT                   /locus_tag="Eint_070120"
FT                   /product="26S proteasome regulatory subunit 10"
FT   CDS_pept        complement(15846..17021)
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070120"
FT                   /product="26S proteasome regulatory subunit 10"
FT                   /note="similar to ECU07_0190"
FT                   /db_xref="GOA:E0S7U2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U2"
FT                   /protein_id="ADM11777.1"
FT                   /translation="MFQEDKNKLYEEYTQALLSNEKAYKALKMEQEVYKQTHKHYLKSE
FT                   NDVKALQTVGHIIGEVLEKLSDEKFIVKSSQGPRYVVGCMKAIDRRNITAGTRVALDIT
FT                   TLTIMVVLPREVDPMIHSMGEESPGDNISFESVGGLKDQIRELREVIELPLKNPDIFKR
FT                   IGVRAPKGVLLYGPPGTGKTLLARIVAATMDVNFLKVVSSALIEKYIGESSRMIREMFA
FT                   YAKRKAPCIIFMDEIDAIGGKRSRESSSSDREVQRTLMELLNQLDGFNELDNVKVIMAT
FT                   NRPDILDPALLRPGRLDRKIEIPLPNEQGRKEVLKIHSKLMNAIEEIDYDSLVKLTAGF
FT                   NGADLRNVCTEAGMIALKDERDYVKHEDFVKSVRKIADAKKLETRLDYRKK"
FT   gene            <17067..>18896
FT                   /locus_tag="Eint_070130"
FT   mRNA            <17067..>18896
FT                   /locus_tag="Eint_070130"
FT                   /product="hypothetical protein"
FT   CDS_pept        17067..18896
FT                   /codon_start=1
FT                   /gene_family="HOG000150037" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0200"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U3"
FT                   /protein_id="ADM11778.1"
FT                   /translation="MEEYEILEIYREISSKGTYDFKMFLFDGKKISVKKVSDEMKSRVR
FT                   KGMCYKNDWILIQEDEDGIVFKVIEPRAYSYASLFKKKFDSDAYLTIRGNEGPVGSGLS
FT                   EKTIPKDPSKPEQSPASVVPEELPERILLPFLNDTLPYSVLEIPVMNKDLLNGQKVKSN
FT                   ELVLPDSFNPVDVNRWNNRSSRLSPIIGRVIYKTRMSSVTYTRKYPYYFFILQTSRLNI
FT                   IKVFVWGEDLPYSSMKVGDKICLSKCRKKPNIEGPSIVEHNRFTEARYFRCKEVSAKEI
FT                   FRIELNEPKEAFKSIFSDASGKVEYLSVLNRRCSGFLEEYYLIRMGKHKILLFYNSSKE
FT                   FHEIEVGKHVRITNLRISRRGRSEFYISTIYTQIEFSDGISSPLVIQDGDIVSKLDDEG
FT                   KDTRKRSKMATNFEESEDEDNFLEKKENSSFQCNLIFGAMGYVPDDFSNIEEMYLSRKE
FT                   EISGEMCEIVPFMPPLEINLKDIYDEAEKLMLNESKKFIVDGMLVDVDFSNFIFDEPPT
FT                   LMDGTSVTYFCNGALTHQLPGYVSICNEITIVVYLFNNFWMDEFDLESLYKLGGCSSLE
FT                   ELKSMRGREMKFVIDAFRASEETVIFCLTKVFK"
FT   gene            <18958..>19389
FT                   /locus_tag="Eint_070140"
FT   mRNA            <18958..>19389
FT                   /locus_tag="Eint_070140"
FT                   /product="hypothetical protein"
FT   CDS_pept        18958..19389
FT                   /codon_start=1
FT                   /gene_family="HOG000150036" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070140"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0210"
FT                   /db_xref="InterPro:IPR007846"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U4"
FT                   /protein_id="ADM11779.1"
FT                   /translation="MAEFHPSLFRRKNRPEDISEAVTEVKSTSIPQNTLYEEPLVSQHR
FT                   AKKKYVTVYGFTAGNLDAVMDTVKSCGEVLEVEYGRNWINVLFDNEDSIKRCLRLNTTM
FT                   IEDEIVGTFRQGGGIIDSSDIFVRKKGVFTSIMEYLFGD"
FT   gene            <19486..>20358
FT                   /locus_tag="Eint_070150"
FT   mRNA            <19486..>20358
FT                   /locus_tag="Eint_070150"
FT                   /product="transcription initiation factor TFIIE subunit
FT                   alpha"
FT   CDS_pept        19486..20358
FT                   /codon_start=1
FT                   /gene_family="HOG000149375" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070150"
FT                   /product="transcription initiation factor TFIIE subunit
FT                   alpha"
FT                   /note="similar to ECU07_0220"
FT                   /db_xref="GOA:E0S7U5"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U5"
FT                   /protein_id="ADM11780.1"
FT                   /translation="MDYEPVMNKLIKKVVRKFYEPQHVVITDILLHKTLLYDAELCGRM
FT                   KMLSKEVNRLIIRLKEDKIVKYETKVENREDNGQVLRTVYYINYAEVRDVIKYKIFKMT
FT                   KNLENNIKMAQTEGYICMECGREYSSLDAQSLMENYVFKCEDCKGDLAENKKDRSADCT
FT                   MYSNLMSELDDIILLLKETDKFSIPSLDYFQVLQMKKEKETKQMPSKKEEQVSEMALPV
FT                   VEEFEMGESYTASDREDQKKEVKIEEYVTVNGTKKLFSDVTEEDKEMMNEAEYEEYYDI
FT                   YSKYYDNGN"
FT   gene            <20321..>23107
FT                   /locus_tag="Eint_070160"
FT   mRNA            <20321..>23107
FT                   /locus_tag="Eint_070160"
FT                   /product="hypothetical protein"
FT   CDS_pept        20321..23107
FT                   /codon_start=1
FT                   /gene_family="HOG000150035" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070160"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0230"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U6"
FT                   /protein_id="ADM11781.1"
FT                   /translation="MISILNTMTMETDSKCEVNSNLLFLKYFRRRMGLSMDENSRMKVE
FT                   SFERLDEERRSVEEYFPAENISNLEVNRIMETIDMVKREAAKDSETLSKAIHEATECLD
FT                   LLQGLLRWGAQSLEEGSDLMRNILIWLRIRRSRFSIATVEILEGFLKLGSNQIDEDLSQ
FT                   EEEEYLVRILEEIREYIEENILGCNRDSIRMFLFRIFLKSSKAGDTTKVFAFELYSRVA
FT                   IPAQHEEFGVIIHEIDSLDLFSIGEMNFRDYTILKIYRNVVFRESKIIEESHDRLVNIL
FT                   FEKLLSYLPSRSSERAFSLISYSSSCSQILCVSLSLCYLKELSENRKSLDSKLLILFIE
FT                   NMVRIGRKKEYGEEEIAYFKCKFGSLEPRVAVLRVIKSFVILLLRIIDQKEHKSRIKAA
FT                   KVLCGIQLHGMAIGRKMFLKILRIARKYMEDRRVTIMKGVINIIGQFDLAALAKEMQRI
FT                   HSILAKKEMFDKVKDSFQTETCYRAYIDLLSNKDTRDIEYRIEDIKLLARIFYSYENKS
FT                   VCKFMRITVFSIEDVFVAEFAALYSEFHPNSIDEVYAASILLDSREEITRGKNVLFYNN
FT                   VLRILMNLRSRFSSELRRRLVVFLRKLVFYSPYTRNAGMLINLLGYGGIEFPRRTDYFV
FT                   AILGSCGSPYMRDYFPGYSWSPNKELGLVYNLRFDPAFGTAYKWKLEEILSRMNCSLDG
FT                   KEALVCAELLLFLSETIELNEGAKSYTLAFELVANNSNFIVWGAKSNCISVSKEANVLL
FT                   KKATKAGAILPHISIPIVFSYYLVSPEMVYTYFETTLSVIREAIENKRLMFKEKGQILE
FT                   FQMVYDIYVHSKHKSRLVDKLLEVFDECPIKTYYLMSQAVKFEKKDRFKIMKCVDGMVH
FT                   SYDPDKSRVLLKLHSLFSEVFISSRSKKEMRISNENVLFEENASLDDIDNLRLLRVK"
FT   gene            complement(23152..23223)
FT                   /locus_tag="Eint_070170"
FT   tRNA            complement(23152..23223)
FT                   /locus_tag="Eint_070170"
FT                   /product="tRNA-Gln"
FT                   /note="tRNA Type: Gln, Anti Codon: TTG, Cove Score: 59.15;
FT                   similar to ECU07_0235"
FT   gene            <23321..>23695
FT                   /locus_tag="Eint_070180"
FT   mRNA            <23321..>23695
FT                   /locus_tag="Eint_070180"
FT                   /product="translocase Tim22/17-like protein"
FT   CDS_pept        23321..23695
FT                   /codon_start=1
FT                   /gene_family="HOG000150034" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070180"
FT                   /product="translocase Tim22/17-like protein"
FT                   /note="similar to ECU07_0240"
FT                   /db_xref="GOA:E0S7U7"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U7"
FT                   /protein_id="ADM11782.1"
FT                   /translation="MNMKCIREKIEKAKPHFVKAASDTLQGYIFGCMVGVFSSSERPSF
FT                   KNIHESGKSFAKISMVYSTTESALQLYGSENAPLNSLISGMVAGGLGVRDKSKKSILTG
FT                   AASFGLYTGMSSVFPTKGQK"
FT   gene            <24085..>24804
FT                   /locus_tag="Eint_070190"
FT   mRNA            <24085..>24804
FT                   /locus_tag="Eint_070190"
FT                   /product="gluconate transport-inducing protein"
FT   CDS_pept        24085..24804
FT                   /codon_start=1
FT                   /gene_family="HOG000150033" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070190"
FT                   /product="gluconate transport-inducing protein"
FT                   /note="similar to ECU07_0250"
FT                   /db_xref="InterPro:IPR018608"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U8"
FT                   /protein_id="ADM11783.1"
FT                   /translation="MNKIFGYIKTYEEACLVVHAVRLGYFSTIEGRLAPEEREKIRSGD
FT                   IFCFVESPNGIKRWTDGKTWSPSKIHGQFLLYQEVPKHMNKSAIGKRNRQKSLLGISKR
FT                   GRTREKIINWDDKLSLNKKTISICLQNKTYHVIAYFRPMFFRMSLIKVPLFSHMDMALK
FT                   IYPELLSDEFLRTMTTKKDLYSKFKLPFPSKQMIFPEVKRHSLEEIASSVLTEWMQEKI
FT                   KSSDVEKKYIYLCNSNK"
FT   gene            <24853..>26982
FT                   /locus_tag="Eint_070200"
FT   mRNA            <24853..>26982
FT                   /locus_tag="Eint_070200"
FT                   /product="hypothetical protein"
FT   CDS_pept        24853..26982
FT                   /codon_start=1
FT                   /gene_family="HOG000150032" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070200"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0260"
FT                   /db_xref="GOA:E0S7U9"
FT                   /db_xref="InterPro:IPR007191"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7U9"
FT                   /protein_id="ADM11784.1"
FT                   /translation="MNEVDALLREIRIDWETLITEDFNPLRQALKNKNNSVEASNFRNL
FT                   FHKVEKAMEEIIEGNYKGFSDSVLSYMESYYLNKKCYDSIQEIFRTTKELSEMKIEVKD
FT                   MIKEYEDVVVFEAKEKICLTLLEVRRNFREFCEIRDKIENNIKRNIEDPDMSLRLLEAS
FT                   KKIRDIFDLINENRLIDLDCIRKFRNDVNSEAEDLMRLIYSRINKFVFQNECKYQEDFR
FT                   CIVVLNALQGLEKYQADNLEKEYFKVVESAIEEVEKSKVENKAEVLAKVIMGRTKVIIR
FT                   NFKTLFEMADTSFEGLHEKLKNFFGEEEPVLRIYSPRCQETVELAINKVIRRFVLEYIE
FT                   DPEKRCYEEMFRAENFVDDIDYGSVFESKYLIHEKMTRATKLQTVFSENFRRILSSSVE
FT                   IAIYMEKYAVSSEMKKYLRNVLNEKYVKEKENWAERQIICIFNNDEWHGNDYINYRLSF
FT                   YTKYQEIIADISSHPDLCNISTISGFLDDFLEKRFDEYFSNIFRSDLIRECLSNGNTKE
FT                   EAVEAFKNSLLTRDIDRNFLFFQKRCYENMFFGLETLKDINKSIKGRKLEALLSSALTR
FT                   SKFQVVLEILYFFDLFYREGNYANKNDYYLHRILGVVENLYGPASCLGVQSEYFSFVFE
FT                   CLNFYIQKNVIRLNVRSVEELKSFLEKLRLLDEILGFIGGEDSLNGTVAFIEGVISGNC
FT                   KSESGRKLRTKIVKK"
FT   gene            <27075..>27971
FT                   /locus_tag="Eint_070210"
FT   mRNA            <27075..>27971
FT                   /locus_tag="Eint_070210"
FT                   /product="hypothetical protein"
FT   CDS_pept        27075..27971
FT                   /codon_start=1
FT                   /gene_family="HOG000150031" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070210"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0270"
FT                   /db_xref="GOA:E0S7V0"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V0"
FT                   /protein_id="ADM11785.1"
FT                   /translation="MSSRELATFIPGYSNGDLSESSFGDKIIVRDQSNVCDENMDIEDV
FT                   WSADILPHSWYQERILGNYKEGKRYADKMIKAEAKDIYRISPGKLSKALTSIDLSILRR
FT                   ITPNELVDYDGTGDIKCRNIRHMRSKNAGLTNFVSHELLKEGNYKYFFRVLKHLKKIGN
FT                   YNSFYCVVRAFQMQKLDTKRLDTLSRHIEKSASYFDMRQVLDDLTTTDMFLICPMDVYI
FT                   RDVEESNRTKNNEVASMRFCRLVEILIKLQGQASNVRISYANEHFLLSKFWYHLQKEMA
FT                   SDREFGIKRYEGQFLLI"
FT   gene            <28030..>28887
FT                   /locus_tag="Eint_070220"
FT   mRNA            <28030..>28887
FT                   /locus_tag="Eint_070220"
FT                   /product="hypothetical protein"
FT   CDS_pept        28030..28887
FT                   /codon_start=1
FT                   /gene_family="HOG000150030" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070220"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0280"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V1"
FT                   /protein_id="ADM11786.1"
FT                   /translation="MEEFEAQIPIDCLCCTSSALIAGGYLFHEETRSGKIYFYDLESME
FT                   IQDEFETSGTLDIKINAQTLYSANSRDVSAINIGSKSIIKTDTRDINTYLEINGDEVFV
FT                   SDIGGRVSVYDKDITVRKVVKLGEAPIWVLKGRCKELMCGSEDGELRFVDMRTWSEHHR
FT                   MKRASGVISIYEHLEYLYVGSYDEHIEIVDKRMYEVVRKVKVGGGVWRIFEKDKTFFLS
FT                   CMYEGLKVCDGDLNIVKEFPTNSIAYGLASSDKELFFTSFYDKKICKLRFQDLKDIVEG
FT                   EDYF"
FT   gene            <28954..>30063
FT                   /locus_tag="Eint_070230"
FT   mRNA            <28954..>30063
FT                   /locus_tag="Eint_070230"
FT                   /product="hypothetical protein"
FT   CDS_pept        28954..30063
FT                   /codon_start=1
FT                   /gene_family="HOG000150029" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070230"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0290"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V2"
FT                   /protein_id="ADM11787.1"
FT                   /translation="MKINIQHLKNKFVVEVDNLDITIEELKKKLEENMGESVRIPAGEQ
FT                   TLIFEREKLEDGKKLSDYVKGSTEEIKLFVIKQHRNPNPISKPGNIYQNASNPSDAQSQ
FT                   PQGGNHYGGHGQSTPNPYTAFVPPYGGYGSPQQMYGQMPYGYGSPHQMYSQMPYGYGSP
FT                   HQMYSQMPYGYGFPQGSGSPGQGDGYNEAFSNAMMQQMEQMLNNPTLLEQVLSIQNPNM
FT                   TPEQKEEQKKMLKEALNMMKANPSLFQQALTPERLNWALSTMNGGGYGGMFPSFPPGNM
FT                   GNFNQRDPRAPWMYGYPPPGYGSPRPDPQADEQIHLVQLEQLKAMGFEDEEAGKALREA
FT                   KGDINKALDILHESKKKKSQENAEPPSKN"
FT   gene            complement(<30166..>30924)
FT                   /locus_tag="Eint_070240"
FT   mRNA            complement(<30166..>30924)
FT                   /locus_tag="Eint_070240"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(30166..30924)
FT                   /codon_start=1
FT                   /gene_family="HOG000150027" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070240"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0300"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V3"
FT                   /protein_id="ADM11788.1"
FT                   /translation="MRGKSHLYSLLRKRCIRTIGIERKVAEDMWMPVIPSYKADSRNEL
FT                   KQSTSRIRKKSGGVDGAINKKTPGYNSASSPGSNASLRSYAGFPMDVFLVSIFGQERGI
FT                   RFNFGLINSVILRFLDHRNVGSILLIESIFKVAQELPLVLISGYIYLEKYVKKIGIAFS
FT                   NCKRLIKFFFVCCFMGLKFIFDGPSPSIRFLQEMNPREIFQIEKLVLSAIDYDLEISNG
FT                   DIRRVFLQNKTLLSDKERLDEQFDKVTRNH"
FT   gene            <31186..>33378
FT                   /locus_tag="Eint_070250"
FT   mRNA            <31186..>33378
FT                   /locus_tag="Eint_070250"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        31186..33378
FT                   /codon_start=1
FT                   /gene_family="HOG000150026" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070250"
FT                   /product="hypothetical membrane protein"
FT                   /note="similar to ECU07_0310"
FT                   /db_xref="GOA:E0S7V4"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V4"
FT                   /protein_id="ADM11789.1"
FT                   /translation="MILGLLGIINIYLFLTGLFRTVNLPADSSMESPGSKEYSKIVYLL
FT                   IDGLRFDSSVNTSKEGHIFNKMKHLRSIKSKFHALSVSGIPTETGSRVIGLVTGTPSNF
FT                   LTSVGNLQGCSIHWDNMVRQLLQDGRSCAFFGDCQWIKYFPELKNGPCHTVDPYGRYEL
FT                   RKQENEIIERILQSINNYDVIIAHLINLDSYGHIHETIYHKDMEHQLMIYDNLINDIYE
FT                   KMSEDTLFVICSDHGVDDNGAHGGVSTLEMSSVGIFISKDGRFTNLSPVNEEIEELRKK
FT                   HILRMYDDNPLEIQAKEPYPTIHQDDILPTLCYLMGVPIPKMSCGNFIHELVHDVNAYQ
FT                   TYYKQKCSVLGIEPREVPKETNEYAKLNYKLSEEISRKFAGRNYFRLIISAILSVVIAL
FT                   AVIFKLFSSKFYKFNDILLLFVFIMTAHSVLSIVHEDLFWAVTFFISNPSAKNLLGVVI
FT                   LLQMVRPPSNADPFYVLVMERLKLSPIFNGNLLFILELCLFGILNSTAHFELAPRFFSS
FT                   SIFEIFNSHPHIFISLLRYLFGSGLDSASWRLSLFLSSPSIDTLIALVFRPMESIYLIY
FT                   IIRNLDIENSVTAYFSLTNMAFFSSGLQKLFQSINYSVFFTFSGNFLTLPVALIAILYF
FT                   VCPRLRAIQLFMSHRDKTGSSKGKKRHLRDFQSSVKEIFMFHSLNLLLVMWSGYTICES
FT                   LSFYKFLGIRAFFEYIYYFIDIALFSVLGIIKRRLN"
FT   gene            complement(<33397..>34491)
FT                   /locus_tag="Eint_070260"
FT   mRNA            complement(<33397..>34491)
FT                   /locus_tag="Eint_070260"
FT                   /product="Nop2-like nucleolar protein"
FT   CDS_pept        complement(33397..34491)
FT                   /codon_start=1
FT                   /gene_family="HOG000149374" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070260"
FT                   /product="Nop2-like nucleolar protein"
FT                   /note="similar to ECU07_0320"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V5"
FT                   /protein_id="ADM11790.1"
FT                   /translation="MEKKENSKSKFDEKCVEMVRNVLEGRSTIKSEVYKTKDPKMYHRL
FT                   VHMVVENYDLLLEVIKKCKYMEEDQELGVVKCFEILDRRLKNTRMYKKFKKALDGRKLK
FT                   LTKPSVFIRINPLKNGTEKDIDFLKHEKTCIDGVYKILDSKDIVFSEEYKNGKFLIQNI
FT                   SSCLPAHILNPDEGSRVIDTCSAPGNKTSQLAMIMKNTGKIYAFERDKARAKTLKIRLE
FT                   RLGVNNTDVIEEDFMKTNPEDFKDIRYILCDPSCSGSGMHFGYKMDKERIEGLKSFQVG
FT                   IVKHALKFKPEKLMYSVCSNHKEEGEEVVEEILKDSEYELEDISMFWGPSCPSEFPFSR
FT                   NVIRCRRDDNGATGFFIALFRRKK"
FT   gene            complement(<34587..>35495)
FT                   /locus_tag="Eint_070270"
FT   mRNA            complement(<34587..>35495)
FT                   /locus_tag="Eint_070270"
FT                   /product="zinc finger domain-containing ubiquitin ligase"
FT   CDS_pept        complement(34587..35495)
FT                   /codon_start=1
FT                   /gene_family="HOG000150025" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070270"
FT                   /product="zinc finger domain-containing ubiquitin ligase"
FT                   /note="similar to ECU07_0330"
FT                   /db_xref="GOA:E0S7V6"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V6"
FT                   /protein_id="ADM11791.1"
FT                   /translation="MARRNGNNNFLDIMRSMLNFLDARIESSSIDTNNSPGGVFMSRLR
FT                   SRLIDLINGREEARSNEREEAEAGPSPGASSGVGRRRRERKNQTNGQQEAPTVEERNIV
FT                   NRCSRMIGAEEERPMRGRRRARIVSDDGARRRRSEGSRDPVTLTTSILVTENGMGTQQS
FT                   SLQNEEQVEPRAREPESTGRRGFRVVFPRIPSQELRFLFLTPQNERSRGNIIYEIQINF
FT                   DVFDASAEAPVTATKESLKKSNVVKAVEADEACECTICMSNFSTNQKLRVLPCDHRFHV
FT                   GCVDKWLLGHSNKCPICRAAI"
FT   gene            complement(<35632..>36675)
FT                   /locus_tag="Eint_070280"
FT   mRNA            complement(<35632..>36675)
FT                   /locus_tag="Eint_070280"
FT                   /product="putative polyadenylate-binding protein 1"
FT   CDS_pept        complement(35632..36675)
FT                   /codon_start=1
FT                   /gene_family="HOG000149373" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070280"
FT                   /product="putative polyadenylate-binding protein 1"
FT                   /note="similar to ECU07_0340"
FT                   /db_xref="GOA:E0S7V7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V7"
FT                   /protein_id="ADM11792.1"
FT                   /translation="MIIVKDEKLLQDIEEVSNTKKNELGKLDTAYRSVVEYNRWVIPNE
FT                   GIKASKFDSRLLNKVYIGNFTGSRSSIQDLLSVFGPVSVTCIGNKECVFADFDNPHAAY
FT                   LCIAEINGVSFNGKTLKAGRTSTFPSEIPKELGPPNEVIVYISNIDLDIEEEQLEDIFG
FT                   KMGEIKEVRLAYGSSFIHKGYGYVEFLRRIDAKRALGYSNKIILYGKRIRIGPCVTKME
FT                   LPEKNYFAIPKEVFEIKKRIESAIFGKGKMVVLRNLIDINDADDDFDQEMENEMKKYGD
FT                   VVEFGVHKKEEVAVYCLYSTEDEARHAFNILNGRFFGGRRIRARKCHVESFPCENSETI
FT                   SACKQIL"
FT   gene            <36742..>39066
FT                   /locus_tag="Eint_070290"
FT   mRNA            <36742..>39066
FT                   /locus_tag="Eint_070290"
FT                   /product="separase"
FT                   /note="protease involved in sister chromatid separation"
FT   CDS_pept        36742..39066
FT                   /codon_start=1
FT                   /gene_family="HOG000149372" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070290"
FT                   /product="separase"
FT                   /note="protease involved in sister chromatid separation;
FT                   similar to ECU07_0350"
FT                   /db_xref="GOA:E0S7V8"
FT                   /db_xref="InterPro:IPR005314"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V8"
FT                   /protein_id="ADM11793.1"
FT                   /translation="MLSNHQEEFLEKIRFKGKGNPRRATWIKRGTEAIKAINSILRAPT
FT                   HDLALFGLEIVKCLYMYEHILGIPRYSLDKALVSLCSKVFLEEIYNEIERRIQLHLEKM
FT                   LNKEIHSIDECMSYLSSHRSSLDEIIVGYLMIRYRVYKEYKKETYCIVERVDSKLKVKA
FT                   RKAFGFLVDGCRTCFLESKVKELLAQRIHTEFIIAKREEISHDLTKDEIEYIRENYPLV
FT                   SCFYNIPEDIGVPYLRLRKSFDVRYFVDVFCWNGFVESIETFYGAHEEKLLDTAFLRGL
FT                   CFQMCIDRKYNLNLMEKFIDRSTSFEKAFMEGYRKVVFQEYKTAKERFRMVLEIIRDLR
FT                   LGIVPEIQLWVYDLLSMCHMFCGEYFESVFYLNKGIELSHRYQLGFVSLHFLNCKFIVE
FT                   RIGGIQGPFPKIRLDLEETINSRFVIESEQKAINNRILTNLLLKDDMSNLREMRTLEIF
FT                   AMFKPSTLYKDIERTLSRLKKFTVVSLYSIDGCLFINDFRGFVKVDRGFGDTKVKMNEI
FT                   LAKSRNVLKGNVTSDLDKARWWMERMELDTQLGEILRSVGDKFDRLSIGKDVILVLDET
FT                   TTEFPFESIPAFKGKSVYRVPSLEYLEDVPGLEIDRKSFFYLLDPENNLFKTRERISGF
FT                   LRSSGIKNGITGRPPSDLECKEADGYDVLLYFGHGSGLKYLKVSGEGKIMFLFGCNSAK
FT                   LLCVENYKRNGSILKHLRRNSMIVGCLWEVTDKDIDNFSVKVIESLINGSTNIGEVVSR
FT                   FRDEFKLRYLNGASVVIYGFR"
FT   gene            complement(<39485..>40303)
FT                   /locus_tag="Eint_070300"
FT   mRNA            complement(<39485..>40303)
FT                   /locus_tag="Eint_070300"
FT                   /product="Ser/Thr/Tyr protein kinase"
FT   CDS_pept        complement(39485..40303)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070300"
FT                   /product="Ser/Thr/Tyr protein kinase"
FT                   /note="similar to ECU07_0360"
FT                   /db_xref="GOA:E0S7V9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020663"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7V9"
FT                   /protein_id="ADM11794.1"
FT                   /translation="MVEYWTLDKFEIGRLLGRGKFGQVWLAREKEKGFIVALKIIPIKE
FT                   IQTAETARQIRREIEIHSNLKHPNILRMYGHFHDKDNIYLILEYAGKGEFFKFLSEKGG
FT                   KFGEKEASLYIRQVILALMYMKECNVIHRDIKPENLLLGSDNLLKIGDFGWAVYNADKR
FT                   RMTFCGTMEYLAPEMVNNSIHDSGIDLWCLGILTYEFLIGKTPFESKNRNMREAYKKIN
FT                   SLKYSIPETISSNASDFISKLLMLNPSDRMRLAEALNHPFIVKHHGRPDD"
FT   gene            complement(<40346..>41050)
FT                   /locus_tag="Eint_070310"
FT   mRNA            complement(<40346..>41050)
FT                   /locus_tag="Eint_070310"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(40346..41050)
FT                   /codon_start=1
FT                   /gene_family="HOG000150024" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070310"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0370"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W0"
FT                   /protein_id="ADM11795.1"
FT                   /translation="MESMSTRKREHSQHIETKGSLRLYEQLVILLRTRSEIKFLCNRVS
FT                   LSLRACIVIELALCGAIGLKEGRVVGKDNTLNNSLLLEAMSKIYQVQLPPDELMYRLNG
FT                   EKRGGSVHMKNVRLRVYKDLEERRICRVENKNLIFNKITMSDYNIRIELINYIKEYLTC
FT                   SKEIDYRAEALVVCLTFCSAIDSILICMTEKEAAASSAHISRIKEKYMVKRTYGSRRET
FT                   IIYSVLNALLSS"
FT   gene            <41183..>42295
FT                   /locus_tag="Eint_070320"
FT   mRNA            <41183..>42295
FT                   /locus_tag="Eint_070320"
FT                   /product="putative RNA exonuclease"
FT   CDS_pept        41183..42295
FT                   /codon_start=1
FT                   /gene_family="HOG000149370" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070320"
FT                   /product="putative RNA exonuclease"
FT                   /note="similar to ECU07_0380"
FT                   /db_xref="GOA:E0S7W1"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W1"
FT                   /protein_id="ADM11796.1"
FT                   /translation="MPKTPELKRLTVYDIQRILCWAFNLAKRPSFLPLKASDRPSTINI
FT                   IKLEETPESISKLLSKLKIEHIALVNERLPLNSIVECIQRDGGYDSIVPSLEYVRMENL
FT                   KFIPMVRFEDICSSGIFVDDKRSLLEIDPSKYRRARIPSSYDIIALDIEKVKTQRGKDP
FT                   GRITMVDSNGNAVYDKIIKPKEPILDYLTRYSGLTKEIIDKGIDVEVVRNEIFDFIGTN
FT                   TVIVGHGIENDLSSLELYHNKIIDTAHLFLNPSGRKISLAQLAKIYLSKDIHAETHDSR
FT                   IDATTCLELLSMKVQYMLRITDPESPKLKLQAKTKRRCILDILKHNRGYLNITACSYRD
FT                   LAKSLRSYKKTKECLWMLIYEIDNNVYLSF"
FT   gene            complement(<42310..>45252)
FT                   /locus_tag="Eint_070330"
FT   mRNA            complement(<42310..>45252)
FT                   /locus_tag="Eint_070330"
FT                   /product="Rad18-like recombination and DNA repair protein"
FT   CDS_pept        complement(42310..45252)
FT                   /codon_start=1
FT                   /gene_family="HOG000149369" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070330"
FT                   /product="Rad18-like recombination and DNA repair protein"
FT                   /note="similar to ECU07_0390"
FT                   /db_xref="GOA:E0S7W2"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W2"
FT                   /protein_id="ADM11797.1"
FT                   /translation="MSCEKFKKTIASIELIKFMCHDHLLINLRKPLTIVTGCNGSGKSA
FT                   IMVAIGLVLGQRAYNLERGSCFRDMIKSGESNAVVRVVLENHRGFKREFFGGTIIIEKR
FT                   IGLKSATSSIVNGERKVWSTRKEDLELVLEFFSLRFENPLNFLSQEQAKKFLNMTNAET
FT                   LYELFMEGTEIAEICKLNDESMSSVDAMRKRINLVDEELKGIDKQIKDEEGRLEGIKSV
FT                   KAMEKAILELEEEILWAKVNERKAQMEKCFEKFQSKQEEMDRDSERMEELTRVVKDAQE
FT                   KLVSIEISEGEKKKSKDKRREEIDETIGKLRMKHREIGNDCEELKEARDFKKRIISDFE
FT                   KQDGTVKNLLPQLEEKHKEAASEIESQNGILESLEERAKECRAKAREEEEMISERQGRI
FT                   FHLRRQIEFYSKNDKNSFFGPNFPNVIDEISKTRFNGKIIGPIGFEVKLKEQKWSKAVS
FT                   IVLNNFLSTFIIMDKRDKDILLRIFRKHKVDFPISTLSSKEPNVIKYRANEKYKTVLDI
FT                   LEVRSPFVINYLIITASIEQTILVEDRKEAYEIIRSRPASVECAYTKNGDKIRLVGGSM
FT                   SDFVTRGVDRFYFENTREKLERCRAEMKNLVEGRIEKSWGKKLEEISNEMEKVREKIEG
FT                   LQRTCKTLEIEMNQEKQIYNAQMEVVQNDDLYEETKSLENQISLLEKKQYEINKEIEIL
FT                   EKEYKEIKEHKVENTEKLRQEIYRKSAEVSSIERKMGVSRGEVVKLKEEHLKQVDLYNA
FT                   EKGILLKSGKKEIESRTEDEVRREIVSIQAQIDMCKGIDDEEKALATVAHLKKAKKGKE
FT                   DLLSEHNGKIEKTLENITARIAKRDFMRKEIANNAAKEFSRVTKARGYEGVLEFNHDKK
FT                   RLDVKMKVDGETSVGSRSMLSGGERSFACVSLLLSLWPSLSCPIKILDEFDVFMDDLNR
FT                   KQAIRLLLDFFQESGFQGILITPLGVEDLFEDFCDVIVLDKPGKGEWVER"
FT   gene            complement(<45404..>46045)
FT                   /locus_tag="Eint_070340"
FT   mRNA            complement(<45404..>46045)
FT                   /locus_tag="Eint_070340"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(45404..46045)
FT                   /codon_start=1
FT                   /gene_family="HOG000150023" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070340"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0400"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W3"
FT                   /protein_id="ADM11798.1"
FT                   /translation="MKFTTFKLAACYLYKVAASEKTTSGKEEFAGDSDSNYQNEYLVTR
FT                   TTMKDTFTPEMTRKMVLENGLAIVRETTTYVNPYEVKFVPGPVLESLDRVAFASERFGA
FT                   SNKFIPKPDFSYMEGYNNMTKKAGNANAKTPESKEGAKGKEKPTTPEDEKASEEAKGGE
FT                   DSGLEGGQEQAEGENGMEKDNASKSSEKAGFFPSGGSYMRPSFGKYSSLA"
FT   gene            <46291..>47178
FT                   /locus_tag="Eint_070350"
FT   mRNA            <46291..>47178
FT                   /locus_tag="Eint_070350"
FT                   /product="ubiquitin carboxyl terminal hydrolase"
FT   CDS_pept        46291..47178
FT                   /codon_start=1
FT                   /gene_family="HOG000149368" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070350"
FT                   /product="ubiquitin carboxyl terminal hydrolase"
FT                   /note="similar to ECU07_0410"
FT                   /db_xref="GOA:E0S7W4"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W4"
FT                   /protein_id="ADM11799.1"
FT                   /translation="MVVQERKDNLPPKGLRNRGNTCFFNSAMQCILSIGELNTFYKNTD
FT                   FPKEKVISNAFKQFISEYESRGHNDPKSLIDKLSTKIKLFNGMQQDSHEFLIQFIDLLY
FT                   TESDRNKGRFESREEFEEVRKHNLIAKTLFSMDRQVLTCEACSYSSVTLAINSTILVEP
FT                   RETIQLGIDQCYEEVKLEGKDAWKCDKCGKKKSSKKKIEILVHPEVLIIHISRFHPQGW
FT                   KNTASVNIDDTLFFNNRKYSLFGVVCQNGTLSGGHYFAEAKRSGTWNVYNDEQVTKGSK
FT                   TYSGAHPYIVFYAL"
FT   gene            <47336..>48142
FT                   /locus_tag="Eint_070360"
FT   mRNA            <47336..>48142
FT                   /locus_tag="Eint_070360"
FT                   /product="hypothetical protein"
FT   CDS_pept        47336..48142
FT                   /codon_start=1
FT                   /gene_family="HOG000150022" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070360"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0420"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W5"
FT                   /protein_id="ADM11800.1"
FT                   /translation="MVFCMENFWSIVPCRSKREEKVIKSTYLKSYEATQSECESDFFSD
FT                   SGGLDEARGKDNSRRMKRNERNISKKIRKTSSSMVSEPRIDEKKKQKPRTNSTVSSEEL
FT                   WSGEDEEIVDQTESFSGFKERKRDRNRRGKSEGNREVSSEDSHFEDIQGPRRSSRTIDA
FT                   SAKKTEILEKYRSRIYRDNKKSRDPEDISRESGIESNDYGKEERFSKSQGLNRFGDSKV
FT                   NERDARNFDDSESEINFIMDVYDKSSLNNSLREKMFEYLNQIGRKG"
FT   gene            complement(<48187..>49104)
FT                   /locus_tag="Eint_070370"
FT   mRNA            complement(<48187..>49104)
FT                   /locus_tag="Eint_070370"
FT                   /product="putative vesicular transport protein"
FT   CDS_pept        complement(48187..49104)
FT                   /codon_start=1
FT                   /gene_family="HOG000149367" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070370"
FT                   /product="putative vesicular transport protein"
FT                   /note="similar to ECU07_0430"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W6"
FT                   /protein_id="ADM11801.1"
FT                   /translation="MEYLERSSVGNERSSGNVPDTDSSITILDIPLSISNAPQLKASSE
FT                   TQQNSFPKNLDSAFANHYFVFPQTLERFVNKIKDRKFVYKFSADQSLEIVECNNHKTVY
FT                   SLGVIDLEKDGIEACGRNISFVVNRNKYRSSVKAREDKEYRKALEEGKKYVRKKNEYEK
FT                   KMEEIYLTQIKNGRNFVFIDDPEDLPRELKAIVRHLYSESVHVPKTKTFSSNQKIEHLQ
FT                   NVLQNIPGIGINAARSLSLHFQSISNLHSFLKGDNSGLLKEFKVWDSDGKNSRPLGEKQ
FT                   SDKIRNIFVGNQERLVHPVQMEQN"
FT   gene            complement(<49160..>50653)
FT                   /locus_tag="Eint_070380"
FT   mRNA            complement(<49160..>50653)
FT                   /locus_tag="Eint_070380"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(49160..50653)
FT                   /codon_start=1
FT                   /gene_family="HOG000150021" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070380"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0440"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W7"
FT                   /protein_id="ADM11802.1"
FT                   /translation="MDAGSEVEFESFFQSSSNSEEETEDSFSVLDSIQVSCDDMIFFSS
FT                   DNACRKDNTAGEEPDVSESLEQENQTFYDFNSDSSRIPESPEDGCKAMNANSTNSIGVT
FT                   STDENNPNTFPQKRLSLDSDHILDIDLGEGGNTNEDMMFSGFTTGSKKKIQVRRESIRS
FT                   AYKIFEDGMEKVDTNGEAQDNLSRRVEREEVEIDPERVYREMKKRFPAEDTNRVFAQFT
FT                   WAWIYFFLGRRRLEFNDFVDRIEEQVRIRLENEYSVLRRILEGDDVPWRYMILLVVGID
FT                   GEKIEVFDGYHSLYASYDEALQKKIEKKEIRVGFRLKVFGADLEGSTPISIFDCENVRL
FT                   KLHYNGVRVVHSKRRLGYRKRIGFRLKISEILSNGGPVCCIEGVVIKIIETKYFVKVEN
FT                   YSNTTDDLEPELDRIEDLARKAERVFSSHDVRITMYTKLLVRDSSGECTVTWWNPSPDI
FT                   KVGQAIRMFYLNPSRSKELHLNTNRRGYIKLLPENPKRG"
FT   gene            complement(<50703..>53393)
FT                   /locus_tag="Eint_070390"
FT   mRNA            complement(<50703..>53393)
FT                   /locus_tag="Eint_070390"
FT                   /product="hypothetical integral membrane protein"
FT   CDS_pept        complement(50703..53393)
FT                   /codon_start=1
FT                   /gene_family="HOG000150020" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070390"
FT                   /product="hypothetical integral membrane protein"
FT                   /note="similar to ECU07_0450"
FT                   /db_xref="GOA:E0S7W8"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W8"
FT                   /protein_id="ADM11803.1"
FT                   /translation="MADADKENMGKAVEKPPLKGADNAVLTNIVSQGFITVCILIVYII
FT                   FRKRARWLYSPNVKDRPCHPCYNYTGFLSWIIPVVTVSDTILLSIIGLDAFMMLQTLKM
FT                   LYRILFVLSFFVIPSLGYLFWTNQRENVENSDQWLVRLSLGSLDPKSESYGFIIPVVYL
FT                   ISAFIMYSIFIYYKRYIVLRQAYLRNPAIMTSIITLKRLSNNLGSAEKSTEYVNLPNRT
FT                   LILSRLPSYVNNDIDLFEFIDSLGVGEIDDCVLVYDTNTLQSLYSEKDSYIYNIEKEIN
FT                   EKFAKMQDWSEKNQEACAESISGFKESILKTVEEANIEGVFDSSQKRQLIVLFLDGAKQ
FT                   FENTLKEDIPKVNFYLEKLNNVNGRISKEKEIIKNEEARNKDVRIVELVSHNNTLFLQG
FT                   DISQDASFFSFHHILNYSNYKMYFTLDLPSKTKRGFVTFKDQRSANIVKQSQIGSRIFS
FT                   VASEDAPAPNDVIWENITNSEVENYMYSVFGAVFFILFIILFSSIVANIVTLLVSTEMF
FT                   RENKLISSFLDKHETITDSLRGILFPLIYNSMMVFVPTIITALVNMEGIYSYSTFQQKL
FT                   MDKLSNFLFFNGFVSVFFASSFYRLFADVLFRNERIYNVIKAFSNESLESSVFFANTII
FT                   QRTLVGTALTLLKPAPLLINYIIFPFTGRKTRRERFDAEFSPPFDFGTIFPSCLTVFSM
FT                   SIVYAVICPPILLLGAFFYLCNYLTFKSEFLYASRNQYESGGGYWDSACQNIMFSLIFF
FT                   QVATFAKMSSDKRFYLSMFLLPIILITFIFRSSLKKMFYKSCHFYPLNIKEEEYLDTFT
FT                   ERVLVERVNLLESWSEMGGGPDVDILPLSELGIKDTKEIEKESYYNDPNTAKSNSSLIL
FT                   PEHFFKTVWFLVNNDRNNLFGLRTE"
FT   gene            complement(<53925..>54287)
FT                   /locus_tag="Eint_070400"
FT   mRNA            complement(<53925..>54287)
FT                   /locus_tag="Eint_070400"
FT                   /product="50S ribosomal protein L7Ae"
FT   CDS_pept        complement(53925..54287)
FT                   /codon_start=1
FT                   /gene_family="HOG000055226" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070400"
FT                   /product="50S ribosomal protein L7Ae"
FT                   /note="similar to ECU07_0460"
FT                   /db_xref="GOA:E0S7W9"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7W9"
FT                   /protein_id="ADM11804.1"
FT                   /translation="MTMTQTYSPVSDSKVQNILKLIQGATRSKNVRKGINESTKCLNKG
FT                   TALLVVIACDAEPQEITAFLPIICEDKGVPFVHIPSKSALGVACGIHRPIAACTIYLPK
FT                   GSESLRLEEKIKEALQ"
FT   gene            <54324..>54710
FT                   /locus_tag="Eint_070410"
FT   mRNA            <54324..>54710
FT                   /locus_tag="Eint_070410"
FT                   /product="hypothetical protein"
FT   CDS_pept        54324..54710
FT                   /codon_start=1
FT                   /gene_family="HOG000150019" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070410"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0470"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X0"
FT                   /protein_id="ADM11805.1"
FT                   /translation="MNIKSKYDKVVKALSIRQVDLWAVPKLMTPLENSFQTEAIGDEEI
FT                   CIVPKEANFQLPNIFLRTRLNPECQKLIDSSKSSENWNDIIEGVIEMLEEADLTTGEHS
FT                   PTTRKCPVDQDTLNKLVFERYGHI"
FT   gene            <54900..>56246
FT                   /locus_tag="Eint_070420"
FT   mRNA            <54900..>56246
FT                   /locus_tag="Eint_070420"
FT                   /product="hypothetical protein"
FT   CDS_pept        54900..56246
FT                   /codon_start=1
FT                   /gene_family="HOG000150018" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070420"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0480"
FT                   /db_xref="GOA:E0S7X1"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X1"
FT                   /protein_id="ADM11806.1"
FT                   /translation="MNLTVEEPSKVIKMRVNGGKHHKEPRYKKTVSGEEGELYPSIYGQ
FT                   KSEEKRVLQKRALFELYDDENCPDGAMFNTKEVSIDFFDLNPMKRKQQKEGNPKSGGVR
FT                   EVENPWGGKDKGMILERSFIESMLENDIRVKDIKYGEDLVFIYFFTVEDSISFYKQFLP
FT                   YAEVHFSEAYDFEQALSLSSEEWASIALLNMCCDSSKIKENSVQPPDEKIHLETSNALE
FT                   NGFQADERSESIKDEETSLFRCTGFGSSGWDCELSQEEIFTRKIEHFTHLRNFFSKSEV
FT                   KAMSQSLEMGNVDFVFKNTKELAVGNQSNKVMQEAIGLLPETGIARIIQNLGHDIAPIA
FT                   ANKHGAYTIQMLISMSKTSLTQNLLSKYFRRFGEFLITHEIGNYTIQKILRFDANLVFE
FT                   LFISRIGDVVKNELGIKVLKRCIEFFPDKKGFLAQKAKEHGKNLTTLLF"
FT   gene            complement(<56260..>57948)
FT                   /locus_tag="Eint_070430"
FT   mRNA            complement(<56260..>57948)
FT                   /locus_tag="Eint_070430"
FT                   /product="DNA replication licensing factor Mcm7"
FT   CDS_pept        complement(56260..57948)
FT                   /codon_start=1
FT                   /gene_family="HOG000149366" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070430"
FT                   /product="DNA replication licensing factor Mcm7"
FT                   /note="similar to ECU07_0490"
FT                   /db_xref="GOA:E0S7X2"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X2"
FT                   /protein_id="ADM11807.1"
FT                   /translation="MVLEEEKELDLIELCSKNPELANSIALEVSAHHYIYKRTLKGIPY
FT                   ALFTDKACYSKNINRIITVSGTLIRAYETLIRNVTSELVCLKCNSKAYQCSSGKRKGKM
FT                   LCESCGSSLLKDRRCFGEAIPSQKIRIQDIGNPNSMSETLEVVLEEDLAGKFFPGDKIL
FT                   VTGVILVRWKPFKIGEPMASSIYMHALAVHKQDDESMGDPLGRAFISRLDGLECFQRRL
FT                   FLINSFGEEIQGLENVKLGLLLALVSGFHEEQKGCTRSNSHVLLVGDSGTGKSHLLKTC
FT                   TKLLSPAVLTNGVGTSQAGLTACAVRQGKEWVLEAGALVLADTGICCIDEFNKLKVNEK
FT                   NGLLEAMEQQTLSIAKAGIVSSLNTRCSVIAVVNTRHKYNFDKSVSENTMIATPLASRF
FT                   DLIFGLFDGNSHSNDLMIVDKILGRNPEKRLSEKKQETKYWGSGILKSYIGTVRKKSTV
FT                   IPDSLNSVLMSYYHYKRKAEGANEFNTVRMLESLARLTEAHSKLLNSGKPSENDVYGAI
FT                   LLLETTLGTKPLVEFDPCRVFVDEAYHNKVISDLKAKVGLVEYEK"
FT   gene            <58164..>58730
FT                   /locus_tag="Eint_070440"
FT   mRNA            <58164..>58730
FT                   /locus_tag="Eint_070440"
FT                   /product="hypothetical protein"
FT   CDS_pept        58164..58730
FT                   /codon_start=1
FT                   /gene_family="HOG000150016" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070440"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0500"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X3"
FT                   /protein_id="ADM11808.1"
FT                   /translation="MMEDKQEKVLDAANVVEAKAMNAIDNVEKSSIGNSIPLEVSLPLR
FT                   ELTKYLMFFTIFESIPIYLITCEGNKNEFLHWISKATGFVFLIIAITAAVLDLVTFYGK
FT                   LFYLYKFVVPVTLVKSAIAFVVVVFSNISSMYVVILAILYSLRITVFDALFLYYLAILL
FT                   RRIESDDYDNDGERLKAKESKGEKV"
FT   gene            complement(<58842..>60026)
FT                   /locus_tag="Eint_070450"
FT   mRNA            complement(<58842..>60026)
FT                   /locus_tag="Eint_070450"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(58842..60026)
FT                   /codon_start=1
FT                   /gene_family="HOG000150015" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070450"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0510"
FT                   /db_xref="GOA:E0S7X4"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X4"
FT                   /protein_id="ADM11809.1"
FT                   /translation="MKPVLMGGVGEELAEGLQDDIEEDVGDVLVILGHYARKMEDERGD
FT                   TKRIFPGDPLPLEKTLRHLNEKQRLSIKKLLRKSISSHLIQALNPMSRAEVYYYLGLSY
FT                   EKGLFGIKRDDRKAFENYIVAAQLGSAVGTFRVAQCYEKGIGKARNIEKAVYFYRCAAK
FT                   LGLIDAMHTYGVIVLFERMERDCDLKIGYFYLRLAAKKATYTYPYALYDLGRCHEKGKG
FT                   PDIISPDDLYAFKLYLKGASLDCPNCQFRVGKCFENGEMGHEKDMRRSIEWYIKAADLG
FT                   QSDAQTRLSALFLNGLDGVVEKNIKLGFRLGLKAATRENVFAAYLVSECYKQGIGVKKN
FT                   ALLALWWSRIAEEFGVNQGNPLVERIKIVIPDEDEGKEQFDFEDGMITGLIKAQ"
FT   gene            <60255..>61229
FT                   /locus_tag="Eint_070460"
FT   mRNA            <60255..>61229
FT                   /locus_tag="Eint_070460"
FT                   /product="cAMP-dependent Ser/Thr protein kinase subunit
FT                   alpha"
FT   CDS_pept        60255..61229
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070460"
FT                   /product="cAMP-dependent Ser/Thr protein kinase subunit
FT                   alpha"
FT                   /note="similar to ECU07_0520"
FT                   /db_xref="GOA:E0S7X5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X5"
FT                   /protein_id="ADM11810.1"
FT                   /translation="MLKIQDFDFVKVVGEGAFGKVYLVRPKRNPMLIFAMKILDFGEIL
FT                   KQRLADQLENEISILKRLYGCPFVAKLYSTDFHRGKVGLTLEYVGGGELFYWLKKCGRF
FT                   DEKMTRFYAAEIVLALKFIHGKGILYRDLKPENILITSTGHIKLIDFGFAVYENESIYM
FT                   ISGTPEYMSPEKLRSEDDGRASDYWGLGIIIYEMLCGDPPFYDASADTIYHKILECQIV
FT                   FPHYVSPVARSLISGLLDKSRTTRLGAKGIFEIMNHPFFKGLDWGEIEDRTVTPPFIPS
FT                   PSSVLGFSGSSSEYSSIDYGETAVFKPYKYVKHFRKDKIPKRI"
FT   gene            <61432..>62583
FT                   /locus_tag="Eint_070470"
FT   mRNA            <61432..>62583
FT                   /locus_tag="Eint_070470"
FT                   /product="hypothetical protein"
FT   CDS_pept        61432..62583
FT                   /codon_start=1
FT                   /gene_family="HOG000150014" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070470"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0530"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X6"
FT                   /protein_id="ADM11811.1"
FT                   /translation="MRTESNSGSKGTFKTMKLGFLGLVGMVVVYYVLLFIFGIKYLDPE
FT                   YYGSYFYAWRVNFADKIMTHGRYKLIKKNEHPDTEDRKKFYKISQDETGPYLIRFDRPE
FT                   HFPRGHEHQFTLNFPGYEDFLKMRERFIVESEGLQSEMDLSHSDLIDRMKKKKEGGGQF
FT                   LAEYKGKSIEEMKSILFPKNNEEKNPWFEVSNILINAISNIMSDKAEDREGYLFDGEKI
FT                   GDKMMKDIRSALEELDSRAEDEDEKLSEKISDSDINNFFINNGRVSATPHETFAYSRIY
FT                   YLFNFLTAGIEFKSQKLADLREGEDENEFREERMNYVANLFARIFSSIYPNQHRKDVSS
FT                   IGVLEKIRNYYSPKTVVEEKKEVDEEDLNLIKDKFSTSSRVPA"
FT   gene            complement(<62620..>63378)
FT                   /locus_tag="Eint_070480"
FT   mRNA            complement(<62620..>63378)
FT                   /locus_tag="Eint_070480"
FT                   /product="putative ATP binding protein"
FT   CDS_pept        complement(62620..63378)
FT                   /codon_start=1
FT                   /gene_family="HOG000207661" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070480"
FT                   /product="putative ATP binding protein"
FT                   /note="similar to ECU07_0540"
FT                   /db_xref="GOA:E0S7X7"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X7"
FT                   /protein_id="ADM11812.1"
FT                   /translation="MGYAIFVFGPAGSGKSTFCRNIQEHGESVGRTYKVINLDPAQIAP
FT                   GEGYALDLRDFITVGDVMEEYDYGPNGGLLLALEELYENIDELRLEDFEGAFLVFDCPG
FT                   QIELFAHSEIMPKIIDHVGRHFKCGVVYMMESQYLVDINKYVSGCFCALVSMSRLNIPC
FT                   INVISKMDLVKSEDLEMFYTPTEELSALIGRGKYSRICKRMLSFVAENSMLNFHPLDWN
FT                   KEESVEELFYSIDNAVQYYEDAEPKTKDFD"
FT   gene            <63390..>63881
FT                   /locus_tag="Eint_070490"
FT   mRNA            <63390..>63881
FT                   /locus_tag="Eint_070490"
FT                   /product="hypothetical protein"
FT   CDS_pept        63390..63881
FT                   /codon_start=1
FT                   /gene_family="HOG000150013" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070490"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0550"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X8"
FT                   /protein_id="ADM11813.1"
FT                   /translation="MRKINKAVHSDPNIEELLLSLQIENESLEEGEAFESSSSLMDEPE
FT                   CRLAGDIVHRDLRATDADMKALIEGGKCKISGNSLPFSLFEVIKKKESTETAVVSNQKF
FT                   LIEGGRYDYGFTPKDLERYRIKRKRRIKETCPNWEDISEEKRNEPRKVHVRSLKLRNKR
FT                   "
FT   gene            complement(<63927..>65681)
FT                   /locus_tag="Eint_070500"
FT   mRNA            complement(<63927..>65681)
FT                   /locus_tag="Eint_070500"
FT                   /product="ABCG transporter"
FT   CDS_pept        complement(63927..65681)
FT                   /codon_start=1
FT                   /gene_family="HOG000149365" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070500"
FT                   /product="ABCG transporter"
FT                   /note="similar to ECU07_0560"
FT                   /db_xref="GOA:E0S7X9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7X9"
FT                   /protein_id="ADM11814.1"
FT                   /translation="MDPTNGKVEIVWRSINVESIKGPFKETVIHRVQGKIGPSEMTVLV
FT                   GASGSGKTTMVNAIIGKPMEGLRISGEVLLNGHFADARVWEHAVGFVGEHLHSYETQTV
FT                   EETLRFAVMASRNRDQRIIVAEEVPNLIHSLGLYKVAHIPVSSISTGERVRLSLGIILA
FT                   KRPSVLIIDEVTNDLDLLNIIHILNILMDLKSKGKGIMVSFQRVPKEILSFFDRIIMIC
FT                   QGEIVFSGSLRECKSFLKKCGYNLKKHENPLDFFMKILSIDMASPVSERESTRRIERLK
FT                   ASWKRIEPLAISSIIEKIELPVMLQKSFLSFLLVLERNLSDFSRRRGLMRTLSVQKLVT
FT                   LLFLVLVYFRLDYTQKGIRDRFGILSFMVISGLERSIASSIIFIDSHKKALRREVCAGM
FT                   YGAVESYFANVMSSFFISGIPSVLYTVVVYWVVGLNPGLLQFILFVFVFVMLVLFSISF
FT                   GVIVSLHTKTLIHAQVVSSTVAALFIMLGGMFVNPEEAPEFVKWTVWMSPVYYAFETIL
FT                   QSQFENLTFECKDSERCIPNGREALHLYGFRRVRYSTSIGIFFLITLMSFIFGIVSMKK
FT                   VIKPKNVI"
FT   gene            <65819..>67351
FT                   /locus_tag="Eint_070510"
FT   mRNA            <65819..>67351
FT                   /locus_tag="Eint_070510"
FT                   /product="hypothetical protein"
FT   CDS_pept        65819..67351
FT                   /codon_start=1
FT                   /gene_family="HOG000150012" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070510"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0570"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y0"
FT                   /protein_id="ADM11815.1"
FT                   /translation="MKRSIKVCHSKTYGFPSGENICHQELAESFQILSAVNLLVLPESF
FT                   VRIEFFSTRRSVFTNDSFNATDIYSVYRNGELFFNSSPLPWESDAQIPWAEYRKRLVDY
FT                   ISKRLAHGIENMEGLNDRYIFYTKYRLANSINPRQCRKDLQKLSKEFKLLERIEVLRLS
FT                   TQKEISGPLADEVYNIFLSYKSDPELEIRFILEVIDILPLSVIVRMARSISKARRYQAV
FT                   LLYYEVYLRSLQKERYRTAFLFAISASRLLKQGVNLNFEGTIKSDSIRCIKEKNWQMVL
FT                   KNVIKGIEELDSLRYGVNPYILHDIDRCEFTVDSVELDWSNITKCSDTVLFNGESTRTY
FT                   FTDRFRIRILFSRISCANLHGISGSIAGGPDIFIPIYQVLNESPAVVQVFFDLAKVLPS
FT                   AEDRASELELNLKRLVFSENIVVPIDLEITWVRRKSTVHVKDASTIDDEGKIIVLLVLS
FT                   NQEGFESRILGPDVIERNGCETTVSLHVSKGFKVCLRHEISESIFETFELTY"
FT   gene            complement(<67388..>68251)
FT                   /locus_tag="Eint_070520"
FT   mRNA            complement(<67388..>68251)
FT                   /locus_tag="Eint_070520"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(67388..68251)
FT                   /codon_start=1
FT                   /gene_family="HOG000150011" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0580"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y1"
FT                   /protein_id="ADM11816.1"
FT                   /translation="MKEAEEFPRNSLTSRKACVYTISHAMGLYGEHRKQILRELAVREV
FT                   QKRITNKILGRKDDDFDLIFLKSRHDTSMDGVCCMSSDDECFSSSKQMEDQDETEAQPL
FT                   HHSSSSSLGSSSEAKSKSGKSKGFKRFIDLEAKTSEDGESSYEEDGGDSDALSFIASSD
FT                   EDYEEPSKKHNHDMLEINRNILRKLKKRFIRKPRNRVFFGEEDYTEKASSEEAIEDEDM
FT                   DVSENTVEDIVESFVFPKEEVEYPPEARCSFTKSEQVEFVEDIKIAEKKLGEGQYTWDS
FT                   GANGGK"
FT   gene            <68297..>69466
FT                   /locus_tag="Eint_070530"
FT   mRNA            <68297..>69466
FT                   /locus_tag="Eint_070530"
FT                   /product="26S proteasome regulatory complex component"
FT   CDS_pept        68297..69466
FT                   /codon_start=1
FT                   /gene_family="HOG000150010" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070530"
FT                   /product="26S proteasome regulatory complex component"
FT                   /note="similar to ECU07_0590"
FT                   /db_xref="GOA:E0S7Y2"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y2"
FT                   /protein_id="ADM11817.1"
FT                   /translation="MIEELKGIVRNKETVLEEKEAAVLEIFRILISKGDYQEIGATIIS
FT                   LRETWEDITTPRITKIIRNLFEMIPYSSDNFGNVLELLTVLVEWADKENKKMLRLDLEC
FT                   KKIYALLKTGRYSEALAQIGPVAHELKKYDDKINLITLYVYESKAFYEIKNISKSKSSL
FT                   TSARVLAVSAYCPPQLQAQIDLLSGIYICDERNYGVASSYFIEALEGFTLGKMDPEACI
FT                   SLRYLILSKIMANKREEINTVMKNKSTLKHLGDEIIRVLLKVSNSFANRDLKSYTNVLQ
FT                   EYSEQIHSDSFICSHLQYLYDLLLDKNIIKIIEPYSVIRISFIADVLGFGVDVIEKKLR
FT                   KMILDRAVNGTLDHIDECLILQGEKADESFADECMKQVKALNCIVSPRY"
FT   gene            <69505..>69891
FT                   /locus_tag="Eint_070540"
FT   mRNA            <69505..>69891
FT                   /locus_tag="Eint_070540"
FT                   /product="adrenodoxin"
FT   CDS_pept        69505..69891
FT                   /codon_start=1
FT                   /gene_family="HOG000244518" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070540"
FT                   /product="adrenodoxin"
FT                   /note="similar to ECU07_0600"
FT                   /db_xref="GOA:E0S7Y3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y3"
FT                   /protein_id="ADM11818.1"
FT                   /translation="MDMANAPDKTSGKVGLLFKTMGKMIPVNAVYGDTVLETAHKNGVD
FT                   LEGACEGNLACSTCHVILEEPLYRRLGEPSDKEYDLIDQAFGITSTSRLGCQLKIDKSF
FT                   EKTVLTIPRATKNMAVDGFKPKPH"
FT   gene            complement(<69925..>73647)
FT                   /locus_tag="Eint_070550"
FT   mRNA            complement(<69925..>73647)
FT                   /locus_tag="Eint_070550"
FT                   /product="Rad50-like DNA repair protein"
FT   CDS_pept        complement(69925..73647)
FT                   /codon_start=1
FT                   /gene_family="HOG000149364" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070550"
FT                   /product="Rad50-like DNA repair protein"
FT                   /note="similar to ECU07_0610i"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y4"
FT                   /protein_id="ADM11819.1"
FT                   /translation="MSSLKKLMIRGIRSFSHREGSILEFYSPLTLIVGPNGTGKTTIIE
FT                   SLKYISTGSLPPNSRGGAFIYDPRVARLVEVQGQVKLLFTNVHGETMVCSRSLQLTQRG
FT                   GKKEQKTLESMVWAEKDGGGVSGRSGDVDTEMPQHFGVSSSVLENVIFCHQEESTWPLG
FT                   EPIVVKKKLDEIFASVKYGKALDSLKSSKKECSSDIRMKMQELEFLRKMKERKESLESR
FT                   IRNGCGSIERNEIKLEAYGNEIRRCERIVEEIDMELEKNGEREKRAYLLRNEHKELKSF
FT                   IDGLKEKRLELEEAREILSREFLKRVEERYERMKMDAEEKEARFRSLSEKRSSYLRSKG
FT                   ELDGVFSEISVKSSLLDEAKRQKTEAFKNLSLELRVEKDFRETALEVFRKVEEDIGDKK
FT                   KRINELEEELRKLKEEEGNRTKILFEKRRIVDEYEGLEDNGSIDVSVSYLEEMERLKME
FT                   ISGDREMEALEERLEDYQRRLNDAYSIAEKNFMVSQIRNRKKEIEGILSEVNVSELHQK
FT                   LERQRIELRKKERKAKKIETEINLKKAEMMQREKENERIKREIGRKCEELRAMQLKAGD
FT                   QAVLELEVSGFYYKNECEVEKAREIVERNRTFFGADSAMFGVDLLNFEGFYGKKEAFEL
FT                   WDMTSESESLWREKIYREMLEDGRRSHGCPICHRSFSMEEEIGFKRRLELAIERVSLEG
FT                   KENTSKRQSRGKTEIERINEGVMDRNRKREEIVGLILKYEPSEGIVDEEVLEEMELDIL
FT                   DESEGIKKTEFYLSLVSELFSIEGKLKDEKEGESVQELKSMIDGIKKIYEEKRGEMKRK
FT                   KERIEYLERKQEVVRAEKEIREKINFREDAKEAIRQIERSSIRARIAEVSEEVLRKKGR
FT                   VEKILEKFSRKRVELEMSMEIFYQKEKEIAVLEKEIEELNSKVKKLLHIEYCDEAKDEG
FT                   KFDAVRNELLEKKNEVLEAGQKIRTMHEMRVLAEESVKYYERQRIIEEIEKELSEIDFE
FT                   YLTRLREKKQLLEEKKMKLIAQKSLLLGECKQIALGIKSCRQELQKDHEKTVEDYNKCF
FT                   IEVKALEISSLDLEKCIQALDKAIVDFHTSKLEEVNATLKDLWMNTYRGDDVDWIEIKT
FT                   ESSGQRTYNYKVVFIKGGVELDMRGRSSAGQKMIASILIRLALADSFASNCNILALDEP
FT                   TTNLDRDNIESLAFTLSKIISKHKKDSNFQLIVITHDEDFVQLLSRDGPEYFYRLSRNG
FT                   NGDSTIVRHSVYGME"
FT   gene            complement(<73708..>74352)
FT                   /locus_tag="Eint_070560"
FT   mRNA            complement(<73708..>74352)
FT                   /locus_tag="Eint_070560"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(73708..74352)
FT                   /codon_start=1
FT                   /gene_family="HOG000150009" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070560"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0620"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y5"
FT                   /protein_id="ADM11820.1"
FT                   /translation="MGSEEEIEFFGFAPVTLVSELQGEIEGILKEGIEKLSFLGKKKIH
FT                   RMSGTILESFRRNYFIFSNFVLRNILRFPSSFQPERRVSDVVVTVDLQTITDDLMNVLE
FT                   SEDYYRAEIEGVRESIEVERYREEWYRSLLECSESVDGLARRITEVCLELENVTRLYSQ
FT                   MSMVSCIGDEDYNTFLEYREVKSSLARNERDELLGVASEEVLSMMNKCVEK"
FT   gene            complement(<74394..>75521)
FT                   /locus_tag="Eint_070570"
FT   mRNA            complement(<74394..>75521)
FT                   /locus_tag="Eint_070570"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(74394..75521)
FT                   /codon_start=1
FT                   /gene_family="HOG000150008" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070570"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0630"
FT                   /db_xref="GOA:E0S7Y6"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y6"
FT                   /protein_id="ADM11821.1"
FT                   /translation="MALKYTPKLCTVPKIEQITTPNKNIQSFFMRSDVSFYVDEKYRMG
FT                   NYKADEEIIHIVVWNNKLLVESESIDLGDFFFPTGMNTRRFRNLEECIGWLGNQVSGAL
FT                   HKLGIKPKNSFVSLIFQDLLGRTEILAMCNLFINVLSFKGILITPRSLSQAIGTLSPNC
FT                   VVVNVYENYTTVCLVEDFWMLDGICVSKESNKGFELADSIDFVDEFNKIKVFEEKNIFS
FT                   CGKCDYKDETEEKMETHFQQQHQKENECHPDVDPQEHFKMHLKMYDEKGDIYEIIGKRI
FT                   NHVLSKEKMKKIGGKVIVFNHGGTLLSETSLKKVFEECGIYPEVCMYPDSAEDMIMNVM
FT                   GVFSGLDCIKEMWMTDKEWNSTGLRILKEKVLFII"
FT   gene            <75558..>76199
FT                   /locus_tag="Eint_070580"
FT   mRNA            <75558..>76199
FT                   /locus_tag="Eint_070580"
FT                   /product="hypothetical protein"
FT   CDS_pept        75558..76199
FT                   /codon_start=1
FT                   /gene_family="HOG000150007" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070580"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0640"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y7"
FT                   /protein_id="ADM11822.1"
FT                   /translation="MPMTSKYSGVSLESDEEEKIHPNIDEKSYKEWKRRQRELKRKELE
FT                   RRLEEINSVEFPSKELAEEREEIEKILKPSYVCLGTESFRTPSSNEEKDYIQELSHLIV
FT                   HNELDNFIELMDQCKIDMEEFEVVVLHNLAEQIKEGNDAGGLILSKISLYVKYALSHGK
FT                   EFLLKLRAQLTNKERRRQFEEDCRKDFEETRRMFLEQFGTLDSTCSQTPK"
FT   gene            complement(<76227..>76655)
FT                   /locus_tag="Eint_070590"
FT   mRNA            complement(<76227..>76655)
FT                   /locus_tag="Eint_070590"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(76227..76655)
FT                   /codon_start=1
FT                   /gene_family="HOG000150005" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070590"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0650"
FT                   /db_xref="InterPro:IPR008506"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y8"
FT                   /protein_id="ADM11823.1"
FT                   /translation="MRGSKSQIRVFEKNKTTRKLILRSIALYNICALAVYLMNKEKNIL
FT                   VYLVRSIPEALAVYYLYRISTPVISHDGKTTTLVSPGASLNGKGHVSVAFDFLFISMVV
FT                   KLLLLYSSKSWLLYVFFVISCCYEFLYKPFAALKTNTK"
FT   gene            complement(<76759..>77061)
FT                   /locus_tag="Eint_070600"
FT   mRNA            complement(<76759..>77061)
FT                   /locus_tag="Eint_070600"
FT                   /product="ubiquitin-like protein"
FT   CDS_pept        complement(76759..77061)
FT                   /codon_start=1
FT                   /gene_family="HOG000149363" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070600"
FT                   /product="ubiquitin-like protein"
FT                   /note="similar to ECU07_0660"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Y9"
FT                   /protein_id="ADM11824.1"
FT                   /translation="MGSPDSGNESKTKENIPQITSSEKMPLKLIDQDGTMLVFNVKPAT
FT                   TFKKILDAFSSNVGKNSSEFRLLFNGKNIDPGKTPGDLGFEGNEELEVVTSQVGG"
FT   gene            complement(<77104..>77817)
FT                   /locus_tag="Eint_070610"
FT   mRNA            complement(<77104..>77817)
FT                   /locus_tag="Eint_070610"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(77104..77817)
FT                   /codon_start=1
FT                   /gene_family="HOG000150004" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070610"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0670"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z0"
FT                   /protein_id="ADM11825.1"
FT                   /translation="MDPEKAFRELEESICWANAPPAPTPGMCYIEPQIKRDFTSFDGSL
FT                   EKIVPRRLHTDLLEALDIDFVEMVMDYIEREASSTGKPGHRLGASSGLERRGEALERER
FT                   IKKSMSKIFDYQKYIQESFEDVNTIVHPTDENIKAEEVYSLFPSTEDESVIIQSDGIDF
FT                   QKDSFTILEEGSSQLFKKACMSDGRVFTCSPQKIDNLLVLCIRDGNAYYSEASTLYRLQ
FT                   EPRNQKKKMEDREEG"
FT   gene            <78075..>81515
FT                   /locus_tag="Eint_070620"
FT   mRNA            <78075..>81515
FT                   /locus_tag="Eint_070620"
FT                   /product="chromosome segregation ATPase"
FT   CDS_pept        78075..81515
FT                   /codon_start=1
FT                   /gene_family="HOG000149362" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070620"
FT                   /product="chromosome segregation ATPase"
FT                   /note="similar to ECU07_0680"
FT                   /db_xref="GOA:E0S7Z1"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z1"
FT                   /protein_id="ADM11826.1"
FT                   /translation="MPFRQCVSSQTFPRAEPLIESFQPPTGVGEEKFMNGRKALLMNLR
FT                   LESITIHNFKSYKGTHVIQGLDPRFTAVVGANGSGKSNIIDSILFVLGFRARRMRHSSM
FT                   AGLIYSGDGNQDMCYVELGFNKFQIRREVSLAGRTRYFVDGEEVPCTMVESLLKSEGVD
FT                   MEHNRFLILQGEIENIAMIKPMDGGLLEYLEDVIGTGEYKAEIEKEESELRRVSEECES
FT                   KSAALKFYEKEYKHIERKQEECLRTAKRRAECLCLDRDLHLLFSERGKKKLEGLLLEKK
FT                   KIEEDLQVLEKKNKENGGKLEVLEGKGANARVSAREAEERFLKARKEYQRAERRNKMME
FT                   EDLERESKRIEELSREISEIRCLEDKRQKEGLKWTEEINRNVEEISRCSELSEKLRSEI
FT                   GEGQRRIEKEARKSIEEIYREEERMMKLLKRKGEIGEKQRESESRLGILMSRKEEILRR
FT                   VGDIDGRLSKMDEGKIEMGRSEEEISREIEEIERDLAKTRKEMSRRMQRAEEHRENEET
FT                   SWKEREILRSIEHVKGVYGRLSDLGSVESQYDRAFRIAGKGLNSIVVDTTCTAEECISI
FT                   IKSLGLGRATFIILDRISSEPSLPKESVPYLYNLVKCPKEFRKCFYFALKDTLVCEGLE
FT                   VAERLAFGKTRKRVVTIDGKLIEKSGVMSGGKGNGRIKSIEELEKACLKMMELKKKKVS
FT                   EMDMVRDLKERGALWKTRERLASDLEEVCREIGRVEKRINRKEIEDIEVEIEKIKKKVS
FT                   SLREGIESLTDMETRRKKENLRNLNERIEVFEKRNLELRLHLESSGSGELREKELEVER
FT                   RKKDFERISIEDISGMKSKMIECEREYKECAERLRGILKEIANVKASLGNDYHMEIDLK
FT                   NRLDDACDKIEEWTQRIKESETKIASLEEESKKYMRICRLEIHSTVKVEEMNEEEIDRT
FT                   IGRIGGTVARLKGEEIGEIDLDVFEDCERARVEYEKAKGEHGWFESRQKEIKESLEYLK
FT                   KKRYDEFMKGFTQVSENLKEIYKSITHGGNAELELVDHLDPFSEGVVLSVMPPKKSWKN
FT                   IGNLSGGEKTLSSLALIFALHKFRPSPFYVMDEIDAALDYRNVGVISHFIKEMSRTAQF
FT                   LVISLRSDMFELSETLLGVYKANNASQSLIVNIGKLAGQ"
FT   gene            <81560..>82609
FT                   /locus_tag="Eint_070630"
FT   mRNA            <81560..>82609
FT                   /locus_tag="Eint_070630"
FT                   /product="putative proline hydroxylase"
FT   CDS_pept        81560..82609
FT                   /codon_start=1
FT                   /gene_family="HOG000150003" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070630"
FT                   /product="putative proline hydroxylase"
FT                   /note="similar to ECU07_0690"
FT                   /db_xref="GOA:E0S7Z2"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z2"
FT                   /protein_id="ADM11827.1"
FT                   /translation="MKRYQEPFLHFIKDGFLAPKDLENIRNIHGKCAFREIYTDLFRFL
FT                   QTAELRERKDLQFFRDSLMRAFEEIGDVKGGWIDLFGSYYRKGDYLLCHDDRTESRKFA
FT                   FSYYLEDHSSGELILYENDGMSVSKKVEVKSNRLVIFEVSDVSFHEVGYCSKDGRRAFT
FT                   GWLNFEYIKHNDHSECVNMESPNVCGTFPMEIDFNESPLVFYPGVEYDFEHTSGSVEGP
FT                   FCFRRVKRIEVKSPLAPCLDGWELKGGGFYHFRVGDYILLNDGCNAFEGDVCDVFFIGG
FT                   DEHVFEDRPNIFEDSKNPIKYLDEEGRFVFGLPIAKGMFAIKRNGLSLFVERSGTEFFM
FT                   GHFIYVSKN"
FT   gene            complement(<82644..>83240)
FT                   /locus_tag="Eint_070640"
FT   mRNA            complement(<82644..>83240)
FT                   /locus_tag="Eint_070640"
FT                   /product="preprotein translocase subunit Sec62"
FT   CDS_pept        complement(82644..83240)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070640"
FT                   /product="preprotein translocase subunit Sec62"
FT                   /note="similar to ECU07_0700"
FT                   /db_xref="GOA:E0S7Z3"
FT                   /db_xref="InterPro:IPR004728"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z3"
FT                   /protein_id="ADM11828.1"
FT                   /translation="MVEELKKYEAILRQVGTEEKTLRYRRRVGTFKGSSGLALLAKKGL
FT                   EPLKAKSVMQELLNESVLFKVSINKKNARECDVVLDQKFQEDQYYVFANEKTSNISLIL
FT                   CVVFVLMTFTIVLFRMWPRNLQQRLFSYMVYPLGGFITFIIVLAIIRLILFSITYFLYS
FT                   PGIWLFPNLFEDVGFFESFVPLWEYHGSKKVKNEK"
FT   gene            <83307..>83819
FT                   /locus_tag="Eint_070650"
FT   mRNA            <83307..>83819
FT                   /locus_tag="Eint_070650"
FT                   /product="hypothetical protein"
FT   CDS_pept        83307..83819
FT                   /codon_start=1
FT                   /gene_family="HOG000150002" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070650"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0710"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z4"
FT                   /protein_id="ADM11829.1"
FT                   /translation="MRLKALIKKRTNDLLVALRSLRGKICSEDVLRQVLGNIHKSYIRL
FT                   EVLLNKPGLSHQEPVEVDSTNGVVRYKTGNLEFLYHEEHGVISVSTGDTGINNYLLCLI
FT                   RGKPVDTHLETASAMLGMYAGNERALCDVCGNYATVPGLLTPICRSPEEDFVLVHHAQC
FT                   KVESLEK"
FT   gene            <83861..>84373
FT                   /locus_tag="Eint_070660"
FT   mRNA            <83861..>84373
FT                   /locus_tag="Eint_070660"
FT                   /product="hypothetical protein"
FT   CDS_pept        83861..84373
FT                   /codon_start=1
FT                   /gene_family="HOG000150001" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070660"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0720"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z5"
FT                   /protein_id="ADM11830.1"
FT                   /translation="MIECSVFGYLMEVDCICNHLKLHKRTDKTVSEAVYSNGTNVLLVS
FT                   KEDDGIYLSSRGPPDRNKNRMSFCSRVQKSRIRTLDTLKEFLSSFGFELVREGQVELTT
FT                   FEKGAGRIEISRSISDEGNSQEVDTGRYWLVKVFVTSENTQNGERMLSRLIEELEDQVQ
FT                   LIKPSIK"
FT   gene            <84482..>85474
FT                   /locus_tag="Eint_070670"
FT   mRNA            <84482..>85474
FT                   /locus_tag="Eint_070670"
FT                   /product="hypothetical protein"
FT   CDS_pept        84482..85474
FT                   /codon_start=1
FT                   /gene_family="HOG000150000" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070670"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0730"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z6"
FT                   /protein_id="ADM11831.1"
FT                   /translation="MAREYKETVYSILASLCLVGGLSLESFVCKTANCSFFLSSTLFIS
FT                   MALTLLSLAHMVRTKAKVTLFSAYKGSISALMDIMIVFIYTKILCTNSLFFCLSFLTYQ
FT                   MTVSILTCFTSFSSSGFMVCICVIFLSPLFDLWFVEEHGFSRSQIPDFMKYYITNGSMN
FT                   IIFFIPIVGIRVMFGEFFGRLENRESSTLFNSLGMVAIGAILGLIDRSAFLEEFRKMYQ
FT                   VSIPFVVSNIMLVTSLAIFRWNKNINFTSVYPPVSVLSILVSGLFCYTSAPLFWRKTIL
FT                   ECSLNAPYLFYLLTFSLFTLYIIVVYKSNIVSRPARDGFIPGVTWWLWG"
FT   gene            <85710..>86465
FT                   /locus_tag="Eint_070680"
FT   mRNA            <85710..>86465
FT                   /locus_tag="Eint_070680"
FT                   /product="aquaporin-like protein"
FT   CDS_pept        85710..86465
FT                   /codon_start=1
FT                   /gene_family="HOG000124687" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070680"
FT                   /product="aquaporin-like protein"
FT                   /note="similar to ECU07_0740"
FT                   /db_xref="GOA:E0S7Z7"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z7"
FT                   /protein_id="ADM11832.1"
FT                   /translation="MAKEALKTLQSMFGEMVASFVFGFAVYSAILGSSISQSSADKVIV
FT                   GLTVGFSGIGVIYSFCDVTIAHFNPAITLAAILTSKIDVLQGLGYMLAQYIGFMLAVCA
FT                   LLVCSPVEYKETLDTIRPGPTDFGATSLNVFFAEFFLTAIFVHIVFATAVNPYKPKVDT
FT                   EGKFVDPDEKEPVDRRITAPLCIGLTLGFLAFMGLASSGGAFNPGLTFAPMAMSNTWSH
FT                   FWIYLGGQYLGGLTGGLLQVLVLYKLSSD"
FT   gene            complement(<86518..>87672)
FT                   /locus_tag="Eint_070690"
FT   mRNA            complement(<86518..>87672)
FT                   /locus_tag="Eint_070690"
FT                   /product="putative histone acetyltransferase"
FT   CDS_pept        complement(86518..87672)
FT                   /codon_start=1
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070690"
FT                   /product="putative histone acetyltransferase"
FT                   /note="similar to ECU07_0750"
FT                   /db_xref="GOA:E0S7Z8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z8"
FT                   /protein_id="ADM11833.1"
FT                   /translation="MNNQVLEQKIINEEYKIWKKNVPYLYDLMFCHTLQWPSLSVQWFP
FT                   DVKRDEEGGRTVQRLLLSTHTSGVEDEYIMIAQVEFPDEFDESQNEEVNGDMRFKIVQR
FT                   ISIMDEANRVRYSPFACNVLAVRSDLSDIHVYDYTKHLSHEKIPRPDMVLRGHEGGGFG
FT                   LSWSPQSSGELASCGEDKQICVFDISQESSLISPTVVLRRHRMTVNDCSFSFLDKGLLS
FT                   SGGDDGMVVFWDTRSRDCIHAIEEAHTSDVLSVRFSPLDGNIVSTSSGDKSVKVWDRRN
FT                   LEQPLHILLGHSKEVLSTEWSPHDKGILASGSTDRRVIIWDLNRIGAEVSEEYKAEGPP
FT                   EMRFLHGGHTSTVCDLSWNPAEPFEIVSVSEDNMLQIWQVPRTE"
FT   gene            complement(<87760..>88956)
FT                   /locus_tag="Eint_070700"
FT   mRNA            complement(<87760..>88956)
FT                   /locus_tag="Eint_070700"
FT                   /product="DnaJ-class molecular chaperone"
FT   CDS_pept        complement(87760..88956)
FT                   /codon_start=1
FT                   /gene_family="HOG000149361" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070700"
FT                   /product="DnaJ-class molecular chaperone"
FT                   /note="similar to ECU07_0760"
FT                   /db_xref="GOA:E0S7Z9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniProtKB/TrEMBL:E0S7Z9"
FT                   /protein_id="ADM11834.1"
FT                   /translation="MSKDPKGYYKILELSPGASIAEIRKAYSKQQAKYHLDSPFIKNRL
FT                   RNAANDEEREKIKKECGEMSAKLNSAKSVLFDEKKKREYDSGLGEFGAHFSGGGYSDIF
FT                   DIFSQFTGGRGHQRTNKVNSTKYVITISLRESFVGKVSKFNVRTEKICGTCDGKGGKDV
FT                   ETCKRCNGSGVCTSRRNLGGFVTLAETRCDGCGGSGHKIKGKPCGTCNGSEYIQDKTMF
FT                   EVNIKPGARKGEKIVFEGMGDQRRNHVPGDVIFIIDVQEDSRFERRGSDLVGKIDIPLY
FT                   TAVGGGVVYFTHIDGRVLEINVNPFKTFDTVLKIRNEGFKGNKQGSLILKPNVIIGSES
FT                   DRAKIMQVLAEPPRKPYGTFTKVNGEFGTMPEEEREHEEASDDGMHNPRSFFNSFSFF"
FT   gene            complement(<89072..>90589)
FT                   /locus_tag="Eint_070710"
FT   mRNA            complement(<89072..>90589)
FT                   /locus_tag="Eint_070710"
FT                   /product="NPL4 nuclear pore protein"
FT   CDS_pept        complement(89072..90589)
FT                   /codon_start=1
FT                   /gene_family="HOG000149359" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070710"
FT                   /product="NPL4 nuclear pore protein"
FT                   /note="similar to ECU07_0770"
FT                   /db_xref="GOA:E0S800"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007716"
FT                   /db_xref="InterPro:IPR007717"
FT                   /db_xref="UniProtKB/TrEMBL:E0S800"
FT                   /protein_id="ADM11835.1"
FT                   /translation="MIFIVRGPEGQRRVEVDESRILETQLLAFFNVGQISISSTPDGKD
FT                   KMDKTQTPTALGLRNGQVLYVEYEKKKEEPKKNPEASKNIKRERDRMMCQHDSNAMCSN
FT                   CAPLDPWDEKYYKDNMIKYLSFQSYHEMIKSKNKGLSAEDYTIKTCTDHGSNTRCNRCQ
FT                   EKNIILAPQVFRMVDHVEFDGQHLVENFIRNWRESGRQRFGFLVGRYMDHEMIPLGLKA
FT                   VVSGIWEPEQENYPDGFVITGSMDGPFLGTGLEIVGMIYTDILMEKGGITSDKLGRSYF
FT                   LSSLEIEFIAKMQLMHPYVVRDGEQEIEFGSRFATIVVTVEKDGNIGLQEYQVSNQCMA
FT                   LFKGDWIFPTENPLMLLTTRDILYRTKTKESMVKANPYLPGEFFLVKLTHGCKTNPLFK
FT                   NTEFIPKKFGERKMAEYFGGDFSMEKFSNFTLLVRVKEIFPNWKDLFMCIAKQDKVKFK
FT                   AISNSQDFRSFVSSMEKYRCTVWECKACTFANERNTSLCEMCGGGRD"
FT   gene            <90642..>91238
FT                   /locus_tag="Eint_070720"
FT   mRNA            <90642..>91238
FT                   /locus_tag="Eint_070720"
FT                   /product="DnaJ-like protein"
FT   CDS_pept        90642..91238
FT                   /codon_start=1
FT                   /gene_family="HOG000149999" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070720"
FT                   /product="DnaJ-like protein"
FT                   /note="similar to ECU07_0780"
FT                   /db_xref="GOA:E0S801"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniProtKB/TrEMBL:E0S801"
FT                   /protein_id="ADM11836.1"
FT                   /translation="MPKRKDPYKTLGVKWTSSGTETKEAYRRLQRLYHPDSKTGNKEKY
FT                   EEVCKAYEETLKDPPVEIVPIKDVARIYKGSQEEVGDIIALYNKYKGKMGKIVDNLLLS
FT                   DDGDEERLRGIIDELIGNRTLKQYCSYSKKVKEDPKRRRRKAEEERMARQIAEEMGIDL
FT                   DAPLEDILGGHRRREERLLISLEERCLEGPGKEGR"
FT   gene            <91288..>92736
FT                   /locus_tag="Eint_070730"
FT   mRNA            <91288..>92736
FT                   /locus_tag="Eint_070730"
FT                   /product="exocyst complex component Sec3-like protein"
FT   CDS_pept        91288..92736
FT                   /codon_start=1
FT                   /gene_family="HOG000149998" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070730"
FT                   /product="exocyst complex component Sec3-like protein"
FT                   /note="similar to ECU07_0790"
FT                   /db_xref="InterPro:IPR019160"
FT                   /db_xref="UniProtKB/TrEMBL:E0S802"
FT                   /protein_id="ADM11837.1"
FT                   /translation="MEKEIDDLFLYGSVKKVGKDRIRTLEKCMGDLPKINPNLEQVWTK
FT                   CKEIDSSLELYSIKLESLAREMKGIEKENTKLENEIQYQTSIYEHLKELLINVEIKEDH
FT                   FITLESESFDSIDGLCRIEKALEVLDGFHVDEYDIRIVREKKERINDALREFYKRFITY
FT                   MGSFMVDSESSGDLKVHKGLYGAIKRFKKIFQHSKRYRDYYVVLCSIYMARSKKLYERE
FT                   FGFHLKTVLRLLKEDVTQDKMDRIFETLFESYRSIVKCEDRFLKSMEIDGTCQEIFRNT
FT                   GLLIVGFVEDAYDIADIEVLNGLGKIWKEVEPDEDVYGSFQKELREVYGRLEEEYLKKK
FT                   MGKGENGVGKLEEILSRSSNEDLKRKAIVMGTQRIMEEEDKGDLRRIVKRWRLLDYMGK
FT                   KCTKEIEEVLDAERKTESEFEKSCADMILGSGKTVDNVKKVLSLINGEKGFKTKVIRKM
FT                   REMVSNDVEEKDAEDADKLLREAM"
FT   gene            complement(<92815..>93795)
FT                   /locus_tag="Eint_070740"
FT   mRNA            complement(<92815..>93795)
FT                   /locus_tag="Eint_070740"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT   CDS_pept        complement(92815..93795)
FT                   /codon_start=1
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070740"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /note="similar to ECU07_0800"
FT                   /db_xref="GOA:E0S803"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniProtKB/TrEMBL:E0S803"
FT                   /protein_id="ADM11838.1"
FT                   /translation="MKVGINGLGRIGKLVYRILREKGVEVPLVNDPLLKPEQAEYLLKY
FT                   DSVFGRCKECKVEGGKILYKGKKTSLSAFDRPEKIPWTEYGVDAVVEASGVFTTLKDCE
FT                   GHKDVKIVVITAPSKDAPMFVYGVNHQDYVSQRIISNASCTTNCLAPLAKIVDDNFGIV
FT                   EGLMTTVHAVTATQKIVDGVGKCLRSGRSGLANIIPASTGAATSVGKVIPSLAGKLNGM
FT                   AMRVPVANVSVVDLVCRTRKETTIEAIVDAIERFSESNEGIIGTTKDDVVSSDFIGDSR
FT                   SSVFDINASISIGPNFFKLISWYDNEYGYSCRVYDLLKYAYSRKK"
FT   gene            <93977..>94996
FT                   /locus_tag="Eint_070750"
FT   mRNA            <93977..>94996
FT                   /locus_tag="Eint_070750"
FT                   /product="hypothetical protein"
FT   CDS_pept        93977..94996
FT                   /codon_start=1
FT                   /gene_family="HOG000149997" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070750"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0810"
FT                   /db_xref="UniProtKB/TrEMBL:E0S804"
FT                   /protein_id="ADM11839.1"
FT                   /translation="MILNSLFKNFKNIKRYQKPIKAILVVVPLLTFKVSKETHVSTNEP
FT                   VQHYIDRNIELEKPSDSTPLFTCNRFILNDLPPRRTLRIQGLPDQKENYYPIISTLKSM
FT                   AIKNINVIIDLNPPDEKCMYLFEIDLRFAGSTCMLIHPLKNHQPNSDFFLVAGDFFPSK
FT                   MSFDPMDILVTNKPSNRLHILLKGTPRSLKMLICFIKSISFIRTHPYGSYFYIPVSHGY
FT                   IDITIFMPLVICVLVYYILDWIWTPHHVSVPRIFLGSLLYSFFPISFLFFTRKNEFLCL
FT                   STIFMVLNPKIGLAYIGICYLRMVYDTFSIAIQMLKSSRMSPMDERSFINYKAKHKVE"
FT   gene            complement(<95004..>95804)
FT                   /locus_tag="Eint_070760"
FT   mRNA            complement(<95004..>95804)
FT                   /locus_tag="Eint_070760"
FT                   /product="60S acidic ribosomal protein P0"
FT   CDS_pept        complement(95004..95804)
FT                   /codon_start=1
FT                   /gene_family="HOG000210987" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070760"
FT                   /product="60S acidic ribosomal protein P0"
FT                   /note="similar to ECU07_0820"
FT                   /db_xref="GOA:E0S805"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniProtKB/TrEMBL:E0S805"
FT                   /protein_id="ADM11840.1"
FT                   /translation="MTRKDSKERKEQVYEKARRLFGTYTRFALVGIENVESTQLKNIKK
FT                   GWGEDVEFLMGKNSAIKRAVASLENPKLSSILELIKGDVCFVFFKGDVRDVKKAIDDNV
FT                   REACAKVGNIAQKDVWVENCITGMTPDKTSYFQVLGIATKITKGKVEIISPYKVLSVGD
FT                   KVGPSQANLLGMLNIKPFSYKMVMHQVYEDGVIYDSSLIDIGTEDIVSSLRSAISSIAA
FT                   ISLGAEIITQASMPYNIRNSFKDILHVSFGADFAIKEQSMVMAN"
FT   gene            <95923..>99090
FT                   /locus_tag="Eint_070770"
FT   mRNA            <95923..>99090
FT                   /locus_tag="Eint_070770"
FT                   /product="Ski2-like ATP-dependent RNA helicase"
FT   CDS_pept        95923..99090
FT                   /codon_start=1
FT                   /gene_family="HOG000149358" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070770"
FT                   /product="Ski2-like ATP-dependent RNA helicase"
FT                   /note="similar to ECU07_0830"
FT                   /db_xref="GOA:E0S806"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S806"
FT                   /protein_id="ADM11841.1"
FT                   /translation="MDGVVRRISNRLGTMPKETTEMISQALKDPSYQERLVEILGYEMM
FT                   EEVEMICANKEYFVSQEEVEDHGFYVEYNFPESIPIEVDCSEIVSTDVMGGYKKYFDYK
FT                   KFNGVQSKVFNSAYQSDGNMLVCAPTSSGKTDIAFLCVLRALGKGDKVVYVVPMRALAT
FT                   EIASKYRKKLGEQRVVEYTGDTEIKTEDVARCDVIVSTPEKFDVATRRQCNVFQSRVGL
FT                   VILDEVHMLQDERGPVLEAIVCRVLRYVELRQRPIRVVGLSATLPNYEDVGRFLRAEHV
FT                   FSFDQGYRPVPLKMQVVGMKKRSKLQLEDEFLKKKVERYLSDGKQVLVFVHSRGETSRT
FT                   AKLLSDDGERRDVKGGVVGGILLELARRGVGIHHAGLPRKIRLYMEDEFKAGRLRILVT
FT                   TSTLAWGVNLPAYAVVIKGTRFYDSSQGGFRDVGILDVLQIFGRAGRPQFDSRGEGCLI
FT                   TTGDKMDHYVSLLKNSRDVESRLLRHVADIMNAEIYLNTIEDVNTAVEWLRSTFMYVRM
FT                   SKNPMCYGLSKEDLYDEYKALSDYAILTCRRLEECSMIRIHRKRIGDFQTWRFCSTEYG
FT                   RIASMYYLSHETMERWLREIEDIYDEDSILRLCFEDRELSVLGCREEDEESIKELCMEV
FT                   GVKYEVSIGCKLMVLVKAHIKRLPIQRFSLACDSEYVVKNLRRILMGLCQILIFQCKHL
FT                   FVAKCCILLKRIERQKEKPWDANNRVEVDLFRVLGMVRMEVSLKMKGEYWIFVWDGDSA
FT                   IYSGLFAHRANLFIKTKCDVLRIEIVARDEWARTEERCWVSRDTSTRSLYHNGVHECDQ
FT                   GWSLVGEKQSCSHFCVIKSLSDLSDMMDGWRLDGISEPGRLIMTNRRINFSSMRKGDIS
FT                   IKGWDKRDLRDAPGVSVGYLMPEVPPRYVKYILCDFSLRIKFVQIDCMLFRERLQLMSS
FT                   CITFMDNYESKKVVIVAPDTSDMERTAQDLETRMTLKSLSCGKCDVKVRRGRPMAGDTG
FT                   IFVTAFDRRLEIQKDFTVIFKGCSNSNGYFPIFEVLRICDSREALIYEGRDYIEYFNSC
FT                   VLNGDEE"
FT   gene            complement(<99137..>99502)
FT                   /locus_tag="Eint_070780"
FT   mRNA            complement(<99137..>99502)
FT                   /locus_tag="Eint_070780"
FT                   /product="RNA polymerase subunit 8-like protein"
FT   CDS_pept        complement(99137..99502)
FT                   /codon_start=1
FT                   /gene_family="HOG000149357" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070780"
FT                   /product="RNA polymerase subunit 8-like protein"
FT                   /note="similar to ECU07_0840"
FT                   /db_xref="GOA:E0S807"
FT                   /db_xref="InterPro:IPR005570"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:E0S807"
FT                   /protein_id="ADM11842.1"
FT                   /translation="MQILADSFKVVDIDKEGKLYTKVSRLYMESPKISISLDYNTTLCR
FT                   LQVGHAVEVRIFRGIHENIDCFYLAYGRVYSLERKGPRTIVRVSLGGLLLIIDAPEEVT
FT                   RGLGDKDDISLALTFVL"
FT   gene            <99540..>99863
FT                   /locus_tag="Eint_070790"
FT   mRNA            <99540..>99863
FT                   /locus_tag="Eint_070790"
FT                   /product="hypothetical protein"
FT   CDS_pept        99540..99863
FT                   /codon_start=1
FT                   /gene_family="HOG000149996" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070790"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0850"
FT                   /db_xref="UniProtKB/TrEMBL:E0S808"
FT                   /protein_id="ADM11843.1"
FT                   /translation="MEGNKGREEEGKELFDEECSSEFLPIDFYDKSRRPRDDQGIEFVV
FT                   TKNGFPEGTRGVCFEGVVDGLEFENRKMEAEIEGLSKKERRIEKENAALKDVLLGLLSK
FT                   LSS"
FT   gene            <99916..>102141
FT                   /locus_tag="Eint_070800"
FT   mRNA            <99916..>102141
FT                   /locus_tag="Eint_070800"
FT                   /product="E3 ubiquitin ligase subunit cullin"
FT   CDS_pept        99916..102141
FT                   /codon_start=1
FT                   /gene_family="HOG000149356" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070800"
FT                   /product="E3 ubiquitin ligase subunit cullin"
FT                   /note="similar to ECU07_0860"
FT                   /db_xref="GOA:E0S809"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniProtKB/TrEMBL:E0S809"
FT                   /protein_id="ADM11844.1"
FT                   /translation="MDIGRKPLSDEDFGSAWKSIEKELRKLSSGGLCSGLEIYNNIYTV
FT                   CTSSTPRLENKLYWKIGDFVYMRAREIRKEVFEAKDWIKEYNEGFRKFRQMVFAIDELC
FT                   DFLNECVKGRTMRDLGFLLWERCVLQQTMKYKHTTLGFELVNQERIEVIKDAIESFRLI
FT                   VPDLKKPMLYYTQRYEQFALQKIGSKYQEEIRSMCGEVEKYSFYVREKIWYEKSIREKI
FT                   FLEESWEKMEEILEEVFILNKREYLFAEIYKIMSMHRLPVEILDKISKEMEHDKHREVG
FT                   GYRTNDFYELQNDDEPKVKHSDVFLERMSVLYRNLSGLKSACEIFREVFTRYVREESER
FT                   HVDVYSKGIETLYIFHCMLRHVVDVGFLGDHEYFKILKREFSTSCMKLRPSLEARLLEF
FT                   SDWIVGENSNVFRFLDREFEKNTGGSHLDLPFLGPGKVKEEGLELGRRFEGKNEFLRQV
FT                   FGTLYKMIENKHVFYEMYLSGLGRRLLEKGPNLYEEKKLISLMKRKGNQDFIKKAETMV
FT                   ADINISLSYNKDTDRFVWVLTQAYWPQQAEAPLIRIPESLEMIKRVYDSKFNKKKLCWA
FT                   WNLGSVCVEIYGVEIQMNVLQYSVIDLFNRHEQVDFEKALSATKMGTKVIGDVLKSLVD
FT                   SGLLVCAEGWYRIGDIFGIEKDIRGFYCSESVSMVHEIDKNSYYQSLASRILKRRKRMC
FT                   MDDIVKETQAEHTERFGYDEVIFSEAIRILGDKGIIEEVEDAYVYLP"
FT   gene            <102631..>103218
FT                   /locus_tag="Eint_070810"
FT   mRNA            <102631..>103218
FT                   /locus_tag="Eint_070810"
FT                   /product="hypothetical protein"
FT   CDS_pept        102631..103218
FT                   /codon_start=1
FT                   /gene_family="HOG000149994" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070810"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0870"
FT                   /db_xref="GOA:E0S810"
FT                   /db_xref="InterPro:IPR010301"
FT                   /db_xref="UniProtKB/TrEMBL:E0S810"
FT                   /protein_id="ADM11845.1"
FT                   /translation="MDIQKIVDAIRSNDIDANRAAIESIYANCSQLDDKDIIEITPSVI
FT                   YYLWKLPKFTAQKQFVLELLSHADQRLRYSLFMYLIDHWSSIQLVRMDKFYYLVKRILE
FT                   YYVLDVETVSSLFNISTSMDLRTFIIRCVVDRLKETTEDMEHFLAGFASTCPPALLLPL
FT                   ESLRLRKEVALEYAGNKDIGKKNRAALYSMIK"
FT   gene            complement(<103242..>103883)
FT                   /locus_tag="Eint_070820"
FT   mRNA            complement(<103242..>103883)
FT                   /locus_tag="Eint_070820"
FT                   /product="RNA polymerase II transcription
FT                   initiation/nucleotide excision repair factor TFIIH subunit
FT                   TFB4"
FT   CDS_pept        complement(103242..103883)
FT                   /codon_start=1
FT                   /gene_family="HOG000149993" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070820"
FT                   /product="RNA polymerase II transcription
FT                   initiation/nucleotide excision repair factor TFIIH subunit
FT                   TFB4"
FT                   /note="similar to ECU07_0880"
FT                   /db_xref="GOA:E0S811"
FT                   /db_xref="InterPro:IPR004600"
FT                   /db_xref="UniProtKB/TrEMBL:E0S811"
FT                   /protein_id="ADM11846.1"
FT                   /translation="MILFLLIDLKKENWEMTGRDLFNDVVVFLNAYHKSSRNNRIVVVS
FT                   GKKILFDSLESSIEEIYRITQHQSSYDVGDLGYALCLHRLGESQIVIFTLEKERNDEYL
FT                   RYLKCMFAAQRFGVRISAFSLFENKTILQCCAATGGGYSTSEDGCLRFLLSLLGTKGDS
FT                   KPLGFPATCYCHNKQVLLGLVCPICLSVFCRFVPVCKKCKSKFSFVKHES"
FT   gene            complement(103929..104009)
FT                   /locus_tag="Eint_070830"
FT   tRNA            complement(103929..104009)
FT                   /locus_tag="Eint_070830"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA Type: Leu, Anti Codon: CAG, Cove Score: 46.97"
FT   gene            <104101..>105324
FT                   /locus_tag="Eint_070840"
FT   mRNA            <104101..>105324
FT                   /locus_tag="Eint_070840"
FT                   /product="Fcp1-like phosphatase"
FT   CDS_pept        104101..105324
FT                   /codon_start=1
FT                   /gene_family="HOG000112561" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070840"
FT                   /product="Fcp1-like phosphatase"
FT                   /note="similar to ECU07_0890"
FT                   /db_xref="GOA:E0S812"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="UniProtKB/TrEMBL:E0S812"
FT                   /protein_id="ADM11847.1"
FT                   /translation="MDGCSHPVRLGTLCGVCGIEIPEDSHLFCALYNTDNVKITHKEAV
FT                   SIYKEKMKTLETQMKLILVLDLDQTILHTTYGESRIHGTVRFIMDGSKYCVKLRPNLDH
FT                   MLRKISRLYEIHVYTMGTRAYAERIVGIVDPSGKYFQDRIITRDENEGVLVKRLSRLFP
FT                   HNHKNIVILDDRPDVWDYSENLLLVRPFWYFNRTDINDPLRLKRKIEEEGRTSRDLEGF
FT                   VDKKKRVEEIEDPEIVSKLDDIVLECSSGSKEPRKDIESTEEKEVSRCLEDCELLRVTK
FT                   VLRRIHKKYFSSSHRNVKKILRNIRKKIFGGDRFLVPPAPNRMWLVKTIEMNGGTVSSL
FT                   ENEVDFIISSSKEEVKALAQKLECLVVSPKWIADCVYSLRRVRHGRYIVCDYRPKDEYE
FT                   EELERLFS"
FT   gene            <105435..>106553
FT                   /locus_tag="Eint_070850"
FT   mRNA            <105435..>106553
FT                   /locus_tag="Eint_070850"
FT                   /product="alpha/beta hydrolase fold protein"
FT   CDS_pept        105435..106553
FT                   /codon_start=1
FT                   /gene_family="HOG000149992" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070850"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="similar to ECU07_0900"
FT                   /db_xref="GOA:E0S813"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="UniProtKB/TrEMBL:E0S813"
FT                   /protein_id="ADM11848.1"
FT                   /translation="MEGIVQEVIQCMLGAIVRNNAIQMIILYSVFYFTRCAKRPDVFYS
FT                   GMKRDSVFKMGSLHRSYYPLFFAPFGTIQTVLQLFRRPMFLERISIQVKTPHNGSILLD
FT                   LVEGDKNSKKNALLVHGFNGSGNSTYMRGLAGHLSKEGYRVFCFNARGIRSKLNSPVFF
FT                   HIGWTVDLKAAVEFILCDYQGTLEIFGFSMGANWVAKFFGEEKLDPRIIKGGAVCLPFD
FT                   FFKIGIHFLKNPYTRLFNKLLAMNFVKYINRNKDVFRDAGYDMNMIRKCSSVQQIDMMV
FT                   TTKIFDIKDVNEYYKNQSCVNYIDQISVPFIILNTYDDPIIPPFSIDKEVCMRNKNILL
FT                   VIAHKGGHLGFLSNRLDRTWAEDVLMDFVKHF"
FT   gene            complement(<106627..>107199)
FT                   /locus_tag="Eint_070860"
FT   mRNA            complement(<106627..>107199)
FT                   /locus_tag="Eint_070860"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(106627..107199)
FT                   /codon_start=1
FT                   /gene_family="HOG000149991" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070860"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0910"
FT                   /db_xref="UniProtKB/TrEMBL:E0S814"
FT                   /protein_id="ADM11849.1"
FT                   /translation="MPVIILMGRSRMYLEELRSCLSAHFRVVHLDDEFRVIRSKLSNMD
FT                   PDTAYIVENCEMKPQRYEIYCLAKRNETSYCILADGELSSSKHDAPIFYAKESLPTKEI
FT                   LDCLELKLNCSAAHKKKIVGPNYLMDLKKIINQVNNEMPEGSRPVLKDCEDKILRMIKL
FT                   NPMELDGLEGVYREIVRSELAARGFDL"
FT   gene            <107378..>108313
FT                   /locus_tag="Eint_070870"
FT   mRNA            <107378..>108313
FT                   /locus_tag="Eint_070870"
FT                   /product="hypothetical protein"
FT   CDS_pept        107378..108313
FT                   /codon_start=1
FT                   /gene_family="HOG000149990" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070870"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S815"
FT                   /protein_id="ADM11850.1"
FT                   /translation="MLLSLIFPLVVLGEKFDGYGPTAFDISLSPEIPLEELTGYGTKHA
FT                   KERKNKGFGDLSLVDFNMETEDSFDRNKLVEIAWNVLDSSHGTIMTMQSIRKGEIDALS
FT                   IRALGHYEVLNSSEGSYNVQEAPITYLPIVFDTLVLDHKKSGYVRNPENNKIIYASWAI
FT                   FEHKRTKRWFTVVNVDMYSAYSEKTDVQMANILEDMNREHTVDSNPVFFMGHINAISDR
FT                   LQKVIEDKYINPLDVDRNAKEGPKFTMKNLPDILGNFQRDFVLVRDASSKVVRVNYARI
FT                   LRKGLPTLHYPIHAIVSFEAGDQHRTPSAA"
FT   gene            <108374..>108676
FT                   /locus_tag="Eint_070880"
FT   mRNA            <108374..>108676
FT                   /locus_tag="Eint_070880"
FT                   /product="60S ribosomal protein L24"
FT   CDS_pept        108374..108676
FT                   /codon_start=1
FT                   /gene_family="HOG000149989" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070880"
FT                   /product="60S ribosomal protein L24"
FT                   /note="similar to ECU07_0930"
FT                   /db_xref="GOA:E0S816"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="UniProtKB/TrEMBL:E0S816"
FT                   /protein_id="ADM11851.1"
FT                   /translation="MIEGLSTFSGRTMPKGSGIYSVMNDGRTILTASNKERKLIQRKIN
FT                   PRDIRWTTTSREFFGKESQYVVEKMNVQKVKIVRGFRHISAGLLEKARQTESSRK"
FT   gene            <108748..>109368
FT                   /locus_tag="Eint_070890"
FT   mRNA            <108748..>109368
FT                   /locus_tag="Eint_070890"
FT                   /product="oxidation resistance protein"
FT   CDS_pept        108748..109368
FT                   /codon_start=1
FT                   /gene_family="HOG000149988" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070890"
FT                   /product="oxidation resistance protein"
FT                   /note="similar to ECU07_0940"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniProtKB/TrEMBL:E0S817"
FT                   /protein_id="ADM11852.1"
FT                   /translation="MGIGNHQDSSDGRLPALPELEFRMTYGGERYKTSILSKEIVMGLR
FT                   EALQDKYKYSLSWKLLFSTFENGFSYRTFLSSFERDELPFVLACRTRDGELFGAFFEDR
FT                   IRVSRTMYGRPSTFLFTTAQNMISESEDGKVAVFPVSQGSGANIYCTPDFLAFGCSGER
FT                   FGLLIDRSLSSGETHPVETFGKAILASNSHFQISYLELWLIQL"
FT   gene            complement(<109466..>109750)
FT                   /locus_tag="Eint_070900"
FT   mRNA            complement(<109466..>109750)
FT                   /locus_tag="Eint_070900"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(109466..109750)
FT                   /codon_start=1
FT                   /gene_family="HOG000149987" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070900"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0950"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013970"
FT                   /db_xref="UniProtKB/TrEMBL:E0S818"
FT                   /protein_id="ADM11853.1"
FT                   /translation="MHSLDPRNCEGQTVVVIGRLERVEDGIVVLKCMEREIQVKHQDVG
FT                   LYKSGLVRVSGVVEDGVLVENSVHPVGNGFDMETYCRFVDVAAKYPDLF"
FT   gene            <109749..>110393
FT                   /locus_tag="Eint_070910"
FT   mRNA            <109749..>110393
FT                   /locus_tag="Eint_070910"
FT                   /product="DNA-directed RNA polymerase I"
FT   CDS_pept        109749..110393
FT                   /codon_start=1
FT                   /gene_family="HOG000205213" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070910"
FT                   /product="DNA-directed RNA polymerase I"
FT                   /note="similar to ECU07_0960"
FT                   /db_xref="GOA:E0S819"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR005571"
FT                   /db_xref="InterPro:IPR014381"
FT                   /db_xref="UniProtKB/TrEMBL:E0S819"
FT                   /protein_id="ADM11854.1"
FT                   /translation="MGTEYQTGKIIPNQMALELRALCLSRNTTIEMIKDRGYTTTQEVQ
FT                   TLDEFHEKYPFALTKRSTLNFVCVDTNRPVAIHFGEDEKMGKKVFEGLLTQYEKDNIFH
FT                   LILILPLAPSPTVMSMISLNPKFCIEIFLVEEMIFNKTKHSWVPPHRILSREEKEKVFN
FT                   TLKLGPGDLPRILKSDAIARYYGARQGDVVEIVRKSKTAGESIYYRIVVEK"
FT   gene            <110646..>110972
FT                   /locus_tag="Eint_070920"
FT   mRNA            <110646..>110972
FT                   /locus_tag="Eint_070920"
FT                   /product="hypothetical protein"
FT   CDS_pept        110646..110972
FT                   /codon_start=1
FT                   /gene_family="HOG000149986" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070920"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0970"
FT                   /db_xref="UniProtKB/TrEMBL:E0S820"
FT                   /protein_id="ADM11855.1"
FT                   /translation="MLGDRSLSRRKPDQERTSSLATKVDGYLWPKKAPRMGKARRAYEL
FT                   EITKILAKTMQNSYRKKQVEELITRIFQKMQTIIGPSKNHEELETLKSEFHLLKQEAYS
FT                   LMKT"
FT   gene            complement(<111013..>112056)
FT                   /locus_tag="Eint_070930"
FT   mRNA            complement(<111013..>112056)
FT                   /locus_tag="Eint_070930"
FT                   /product="diphthamide synthase subunit DPH2"
FT   CDS_pept        complement(111013..112056)
FT                   /codon_start=1
FT                   /gene_family="HOG000164743" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070930"
FT                   /product="diphthamide synthase subunit DPH2"
FT                   /note="similar to ECU07_0980"
FT                   /db_xref="InterPro:IPR002728"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="UniProtKB/TrEMBL:E0S821"
FT                   /protein_id="ADM11856.1"
FT                   /translation="MVVLEQKEVPECQRYLPRNYNFEMGKVLRTIRRQSAKKVTLQFPD
FT                   GLLKYSFVIIDIIEKYTDAECIILNDVVYGGCCVDDESIGSDLLVHYGHSCLIPVGEMS
FT                   TRVLYVFVDIRIDVDHAVEMIKRNFQGRVGVIGTIQFNSSISRLRRALNDEKSGVECIL
FT                   PQVKPLSSGEVLGCTSPKIEGVSAVISIGDGRFHLEGAMIRNPHLKFYKYCPFSRRMTQ
FT                   EFYDYNKMLSDRRSEIRTAFKGRSFGVILGSLGRQGNKNILRSVVNRLKGYKIYLIMQD
FT                   EISPKKLERYEFIDSFVQISCPRLSIDWGKLFKKPLLSPFEVFYQGGEYLMDYYSKEGD
FT                   GEWKNYR"
FT   gene            <112477..>113811
FT                   /locus_tag="Eint_070940"
FT   mRNA            <112477..>113811
FT                   /locus_tag="Eint_070940"
FT                   /product="hypothetical protein"
FT   CDS_pept        112477..113811
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070940"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_0990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S822"
FT                   /protein_id="ADM11857.1"
FT                   /translation="MKRRAYICFFLGIATCEIFLTTIRPIDNPNVLMVSGKNVVLTANR
FT                   EDEMATFRVETQDRKSRFLGIKFGKRKHTVLISPGDNPNLYMKYSKSDGRPTMGKKKKY
FT                   WEYKEMKDGGYMLSSSKNKCLGVVGNSFRISECGTGKGQVFVFERRDYSESSSTSNFEE
FT                   QISISSEVPLVPPVSQTSLVSSTSRSSLVSSTSPTSLTSRIPQSSFVSQTSPTSRVPQA
FT                   IQASQAFEALFPFDESNDSDSNSDDMKPVFINLDMKDKKTNTETQESSSPISISTMTVY
FT                   VSVTKSLSAGAVSSSPIVTIIDKFPPVSAKLPPNVTLIRNRIASSEESQSSCESSDSYL
FT                   GNETVSHKSSSRSLGGAKNDANLDFDLEFYPELGRLLDDSIRKKKEEELRKEATAKRAR
FT                   GNPLGEERKDGEFFSALAYLDTSIPNPLRQNLAEAQSACADIGQV"
FT   gene            complement(<113846..>114499)
FT                   /locus_tag="Eint_070950"
FT   mRNA            complement(<113846..>114499)
FT                   /locus_tag="Eint_070950"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(113846..114499)
FT                   /codon_start=1
FT                   /gene_family="HOG000149985" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070950"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1000"
FT                   /db_xref="UniProtKB/TrEMBL:E0S823"
FT                   /protein_id="ADM11858.1"
FT                   /translation="MLLLFFAFAYSFQRGYGPCGRSNRHLRNSDYDGVMMLNVLHRNQP
FT                   LTVFDTIHPERISLPALLSEFSKEMMENQVFDLKYESFSKKVWLELKKERCIEIADVHS
FT                   SLKGVRMKISPSSIYLKRLPNSVKFQLISEGKCLTVGNEINYEGVSGWALSFTDCNPGD
FT                   NSQTFVMIPSLKAVLKLNEKARTRKMIHKMYDIFRKIEKIIGVVDITRLRRAPY"
FT   gene            complement(<114569..>114933)
FT                   /locus_tag="Eint_070960"
FT   mRNA            complement(join(<114569..114883,114931..>114933))
FT                   /locus_tag="Eint_070960"
FT                   /product="60S ribosomal protein L37A (L43)"
FT   CDS_pept        complement(join(114569..114883,114931..114933))
FT                   /codon_start=1
FT                   /gene_family="HOG000229493" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070960"
FT                   /product="60S ribosomal protein L37A (L43)"
FT                   /note="similar to ECU07_1005"
FT                   /db_xref="GOA:E0S824"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E0S824"
FT                   /protein_id="ADM11859.1"
FT                   /translation="MGKTKKVGIAGSFGARYGSTLRKRMKAVLETQRAKYSCEACGKKS
FT                   VKRTAVGIWKCKSCRRIFAGGSYAHLRLQGRFLLTWSSSTMRNKLSSSDLTYVSGEQPC
FT                   F"
FT   exon            complement(<114569..114883)
FT                   /locus_tag="Eint_070960"
FT                   /number=2
FT   exon            complement(114931..>114933)
FT                   /locus_tag="Eint_070960"
FT                   /number=1
FT   gene            complement(<115275..>116546)
FT                   /locus_tag="Eint_070970"
FT   mRNA            complement(<115275..>116546)
FT                   /locus_tag="Eint_070970"
FT                   /product="nucleosome-binding factor SPN subunit POB3"
FT   CDS_pept        complement(115275..116546)
FT                   /codon_start=1
FT                   /gene_family="HOG000149355" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070970"
FT                   /product="nucleosome-binding factor SPN subunit POB3"
FT                   /note="similar to ECU07_1010"
FT                   /db_xref="GOA:E0S825"
FT                   /db_xref="InterPro:IPR000969"
FT                   /db_xref="UniProtKB/TrEMBL:E0S825"
FT                   /protein_id="ADM11860.1"
FT                   /translation="MEVLTLNNCFLKSKADKKATVKISRDGIAIKTEDGEVYTMEKDEV
FT                   KDAELFYGVRKMAIRIFGSTVYELNNVDQNYIDELKRMFSEYFKVSLYVKELEIVDVLS
FT                   GELGINGQRALEFRNTKTILEIPVEDIESVVDIKNELSVSLKDVEIRFISNKKTIEGVK
FT                   EGCSSSVDDEIFKMEGLSFAYPRGKFNLIFFRDYLRLVGSSYDHKIYYKSIKQLYVLEK
FT                   GYIRDEDKYAVVCVDPPIRQGQTKYDCIVVSFDDSEGEISASDERLKEEYSGLFSEIFS
FT                   EVMEALCVTKSVRSAFESRDGMRCLRCAMKAYEGQLYPLEDCVLFLPKAVKLDLSEISL
FT                   VEFSRINLSSMQAKTFDMTLFCEGPYAFSGLSKDEFGLLEQYFHSKGIKARSEVIDDGA
FT                   SSDFEEDEYESENDSMIVDSDEYD"
FT   gene            <116579..>117772
FT                   /locus_tag="Eint_070980"
FT   mRNA            <116579..>117772
FT                   /locus_tag="Eint_070980"
FT                   /product="WD40 domain-containing protein"
FT   CDS_pept        116579..117772
FT                   /codon_start=1
FT                   /gene_family="HOG000149983" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070980"
FT                   /product="WD40 domain-containing protein"
FT                   /note="similar to ECU07_1020"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S826"
FT                   /protein_id="ADM11861.1"
FT                   /translation="MDGRHEMSEEEYKRLRKSQPKKKKVPREDFGDPSEIGGFKGPWSR
FT                   FVGICEDTKTPRDVKEEYSLKKIVNKHCLTAGKERSRSSYFLSMKDPSLGRVPSKKFLV
FT                   PKSNVMLFHDHKDMVSSAILFRKHKLFLSSGFDGKAYLYNLKDRELVTTYMGHSKGVSS
FT                   AIVSECESKFSTVSFDGFLKGWDVETGRCNTKVDLDCPLTCQTSEALDKAIFVGGIDGR
FT                   VRTVDMRSRAVLDAMIEERISEKDAFKTFSIRDILTINDSSLVFTRREGSLHYLDLRNN
FT                   QIVKSLRNSYSFVGFSHGKNAIMATGQDEIVLLDAHTLEKKEEEIKAPECSTPAKASED
FT                   GGILCYGSSKGLVSFFTSKSTASFGSAGEMITAVDWIDGSSSSFISGDILGNVKIWE"
FT   gene            complement(<117840..>118700)
FT                   /locus_tag="Eint_070990"
FT   mRNA            complement(<117840..>118700)
FT                   /locus_tag="Eint_070990"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(117840..118700)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_070990"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1030"
FT                   /db_xref="UniProtKB/TrEMBL:E0S827"
FT                   /protein_id="ADM11862.1"
FT                   /translation="MNVYILLHLGMVVSRMGIAIKSMMSGRYLNLRTLRLEPVDKRRRE
FT                   DYVFGYDWNRNVPYGFKLYTREGYLTVDSKYRRMTIYRGHKRRGKDIPSGFEFHFVSPT
FT                   KCKSIVIGHDSGLCMADVGREVKFKECMPPGRESLEFRFQIKVFRDRCEYLEKSRRGLH
FT                   GDRDKDGEKDTKEKDQEERISSETTDDEEPGCKKNLEEDEKKEEEEREEKKEKTKKKEK
FT                   KKKKHREPKSDEESLEEFMEHVRFKKPRIKKKMKRLGSRFKKKLAKSLLKVDKKKKKSR
FT                   DSSTS"
FT   gene            complement(<118834..>119508)
FT                   /locus_tag="Eint_071000"
FT   mRNA            complement(<118834..>119508)
FT                   /locus_tag="Eint_071000"
FT                   /product="26S proteasome subunit alpha-4"
FT   CDS_pept        complement(118834..119508)
FT                   /codon_start=1
FT                   /gene_family="HOG000149354" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071000"
FT                   /product="26S proteasome subunit alpha-4"
FT                   /note="similar to ECU07_1040"
FT                   /db_xref="GOA:E0S828"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:E0S828"
FT                   /protein_id="ADM11863.1"
FT                   /translation="MGFEEQLAVFSPDGRLIQVEYAQQASEQGSLVVFGVDSEKISVSI
FT                   ERKSGNKLFLEEEKVFLVNERQSIWMSYSGFKPDAYLVMNAARMICFSYKNTTGEDISI
FT                   DQLARRLSEYKQRYTVVYHQRPFGVRTVLFGLKPRPVAYVIEPDGNFSEFFCGAIGQKS
FT                   QRVCEYLEKKDKGDLVRLTILGLMEVVQSDSKKISSFVLSRRGCERVEESAIMDVIDSV
FT                   VQ"
FT   gene            complement(<119571..>120290)
FT                   /locus_tag="Eint_071010"
FT   mRNA            complement(<119571..>120290)
FT                   /locus_tag="Eint_071010"
FT                   /product="nadF-like NAD kinase"
FT   CDS_pept        complement(119571..120290)
FT                   /codon_start=1
FT                   /gene_family="HOG000149982" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071010"
FT                   /product="nadF-like NAD kinase"
FT                   /note="similar to ECU07_1050"
FT                   /db_xref="GOA:E0S829"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E0S829"
FT                   /protein_id="ADM11864.1"
FT                   /translation="MGRFLLVTKNDVNEELIERVKSSLDCDVYDHGINYDGIIVIGGDG
FT                   TVLRAIAPYRDPPVVYAINRGKVGFLCPISYSSVDELIARLRGNGEIKFMETKRLCLQP
FT                   KHYFLNEAIIKPSSLGLGTFKIFIDDTMIELRGDAVIVSTRIGSSAYNASLNGPLLLDE
FT                   GIVINVVAPNRCNFKPIVCRMGTRIRVEIDRDPQIILDGIVCEEKSFDVCYDGSSVRFG
FT                   YLNHYDRQKQIEELFLL"
FT   gene            <120338..>121588
FT                   /locus_tag="Eint_071020"
FT   mRNA            <120338..>121588
FT                   /locus_tag="Eint_071020"
FT                   /product="DEAD box ATP-dependent RNA helicase"
FT   CDS_pept        120338..121588
FT                   /codon_start=1
FT                   /gene_family="HOG000149353" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071020"
FT                   /product="DEAD box ATP-dependent RNA helicase"
FT                   /note="similar to ECU07_1060"
FT                   /db_xref="GOA:E0S830"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S830"
FT                   /protein_id="ADM11865.1"
FT                   /translation="MEDILLRGIKQKKKRILKEEVEYNVDGERLPLLNTFDSLKTKAPF
FT                   SSPLLAQKVVVPYFMKKYNIIVQAFTGSGKTLSYCLPLVETARNENLFGMILVPGRALV
FT                   RQVYRVVREIKHRELEIKGIYRDGSEDFFVEEDEEGGLVERRIDSRTQKEIAGFPREGG
FT                   RIVIGTLPSILSLMDLFEMKAITHLIIDEADLLINPETIDVFASILQEIDVEKTHVGCF
FT                   SATMNEYVEQVIETVKNITKIHIVSRKHIDHEFVFGTNRKIKHLSLLQIVADGIESPTL
FT                   IFVRNEETGEFLSKLLDRSGVYKEGSGESAEVLDDFRLKKIWYLFATDALSRGIDFYNI
FT                   RSVINYDLPDTKTQLVHRVGRVNRNCQGQKVYTIYSGEDFGRISLVAEFLEENGHEIPS
FT                   HITRIIEKSRKRIGRRS"
FT   gene            complement(<121585..>122109)
FT                   /locus_tag="Eint_071030"
FT   mRNA            complement(<121585..>122109)
FT                   /locus_tag="Eint_071030"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(121585..122109)
FT                   /codon_start=1
FT                   /gene_family="HOG000149981" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1070"
FT                   /db_xref="UniProtKB/TrEMBL:E0S831"
FT                   /protein_id="ADM11866.1"
FT                   /translation="MEFIFLLLLSGACGHIKNPVEIRLFLKPDLELKVGRIPLINTSIE
FT                   EKEGKYAITIGNLYISGNDSVSIGDDEFYWNVYDRQLGTIICSEDQCLTYTEEGLEMSP
FT                   CFDPSDFRSASQLFQIDSTTRVSKNSNGIRRKMDLVGKVEGLVDPVSTRIAEMVDDMDS
FT                   FCTDSEEEERS"
FT   gene            complement(<122180..>122938)
FT                   /locus_tag="Eint_071040"
FT   mRNA            complement(<122180..>122938)
FT                   /locus_tag="Eint_071040"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(122180..122938)
FT                   /codon_start=1
FT                   /gene_family="HOG000149980" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071040"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1080"
FT                   /db_xref="UniProtKB/TrEMBL:E0S832"
FT                   /protein_id="ADM11867.1"
FT                   /translation="MILILVLGMAFSYPLYLDSFTNKPIRILAAEYHLLVSELKRDFGS
FT                   NPFRAVDELNLTYGHNTRSQINRNGRVFKIRVGDSWLCRKGRDLLKCEDSIDFWEISKS
FT                   GDGFTVSQEGYCLSTRDENKLVLERCNGRSRSHVFLFEDMGVESCLDSVDLNAKPRTEA
FT                   EMVQQLKLKKKLENLGRKNRDEVEKIKKNLEDKNDFSKYAKKNLPDLDGKDDVKDVLRK
FT                   LWDFNWRRPKFGPSSFSMPWFSFPFCKKLW"
FT   gene            complement(<123048..>123887)
FT                   /locus_tag="Eint_071050"
FT   mRNA            complement(<123048..>123887)
FT                   /locus_tag="Eint_071050"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(123048..123887)
FT                   /codon_start=1
FT                   /gene_family="HOG000149979" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071050"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1090"
FT                   /db_xref="UniProtKB/TrEMBL:E0S833"
FT                   /protein_id="ADM11868.1"
FT                   /translation="MEPGLILMFMSIFVSARDRELEEFVEKDIKVFFSSYPTQILGLEE
FT                   ENGLLVSHSKYVNPSKYKFVTRARLVKSGEKYVVIFGENNICKDGNSVVKCKEERPWDI
FT                   DRKEFGYTISTDNKCITKGPEESIQMKICVNTDDQIFSFKLADLGGCGDIGSLLRNEGR
FT                   KNMTTNVNIFHPESECPSSIRIKTKGDVNKNIILPIKREKNRNTSFSQQGDVSSYSGDE
FT                   ADFPLYEETLPKEEEVTVTHVLTRNPHSGVKRVHLDHHHSPHHYRSKNLVRRDPIIF"
FT   gene            complement(<123994..>125190)
FT                   /locus_tag="Eint_071060"
FT   mRNA            complement(<123994..>125190)
FT                   /locus_tag="Eint_071060"
FT                   /product="glucose transporter type 1"
FT   CDS_pept        complement(123994..125190)
FT                   /codon_start=1
FT                   /gene_family="HOG000149352" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071060"
FT                   /product="glucose transporter type 1"
FT                   /note="similar to ECU07_1100"
FT                   /db_xref="GOA:E0S834"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E0S834"
FT                   /protein_id="ADM11869.1"
FT                   /translation="MKHQVFSKRELASLILVVLTAFTFGVSLISLSCLYGLIEDHFTES
FT                   TGKTYTIYHEALIPGTHFLGAFIAGIIFKFVSFTNDKVKLIVANVIYMIVFATPLMTLD
FT                   FAHYLTSRFILGFALDLTSGSISSYIDAIAPDHIRGFLASLQPVGIVGGLFVGSMFNFF
FT                   GNKESYRIPFVAMLVFLVLQTIGFAFIRSPHPRTPNTFNTRPSMKELIRTPGSAKSIAI
FT                   TVVFHAFHHLSGINFLTFQQSCLFSSSKYPNLMTSSSLFVSFITTAFCGLIVDRFGRKT
FT                   MSIISSTIMAFGMIPLAMDRFPLLGVIICFIGFNLGLAVIPWIISAEIFPSRYTSTGFE
FT                   FGVSFNWLFGFITTTLLHPLNYNHAQVMSGIYGGLCLVFSVFVLLCVRETKGKPKLFQ"
FT   gene            <125243..>125791
FT                   /locus_tag="Eint_071070"
FT   mRNA            <125243..>125791
FT                   /locus_tag="Eint_071070"
FT                   /product="hypothetical protein"
FT   CDS_pept        125243..125791
FT                   /codon_start=1
FT                   /gene_family="HOG000149978" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071070"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1110"
FT                   /db_xref="UniProtKB/TrEMBL:E0S835"
FT                   /protein_id="ADM11870.1"
FT                   /translation="MPVKEKEEVLLKDIKEDVQSVRDAVVLSDDVSRIDEYNFESLFGI
FT                   YKNPQQQVVFVRTIYRQLVGEILKFFSSKCVAEAMTNICILEEVFRSQRGYIDIEMSLE
FT                   DVECINQHAYSLGKKENSGVVREGIRAWNCLKQRKAIRICVMPFPDDERSLMLIEEELE
FT                   AISKTLDGWEDSRDGNCTN"
FT   gene            <126031..>127287
FT                   /locus_tag="Eint_071080"
FT   mRNA            <126031..>127287
FT                   /locus_tag="Eint_071080"
FT                   /product="hypothetical protein"
FT   CDS_pept        126031..127287
FT                   /codon_start=1
FT                   /gene_family="HOG000149977" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071080"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1120"
FT                   /db_xref="UniProtKB/TrEMBL:E0S836"
FT                   /protein_id="ADM11871.1"
FT                   /translation="MQCTEEYLFDRDKQLGRCLREILLEDYCFELGGEERTPFEIKKGF
FT                   LWYGRYKVIKIDGDWAYLHGYKLFVAKDRLRVYELPLGQSRSLGDLIVKEGSMVLAERD
FT                   GKRWNLAAICEEKVLDVAFSKDKAWIWYSEGEEEEYLCKSIYLLKDSEWVKWKKETYRE
FT                   SGEEILRIQDIVVRKKTVVRNPLRVWSKVLMNEVVSIVVTEDMVYVECGGYISLKPCCG
FT                   GIYDMDGCRLLGLSSWENISDLYLTLLLFTDIAVENLELERIEEYLFKLFVFTEEGERL
FT                   VKWLMESGMDEKKEMIVCKLYRKIDDRGKRKIEGWVRRVKNLDALKLVIIYFPEEMERY
FT                   IRMCIEEKREYEIEEVIEHYRGSEMMKEISRVLLQNNCFYLFSQCMPEYEGSFGDVVLV
FT                   EKYNMESQKNIRLERDRKI"
FT   gene            <127336..>129624
FT                   /locus_tag="Eint_071090"
FT   mRNA            <127336..>129624
FT                   /locus_tag="Eint_071090"
FT                   /product="ATP-dependent DNA helicase"
FT   CDS_pept        127336..129624
FT                   /codon_start=1
FT                   /gene_family="HOG000149351" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071090"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="similar to ECU07_1130"
FT                   /db_xref="GOA:E0S837"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="UniProtKB/TrEMBL:E0S837"
FT                   /protein_id="ADM11872.1"
FT                   /translation="MNKGKYEMESDEFFINAILEDREVNDFSWEFSEITSCSDMRSSIK
FT                   VEKIDSDSDVEFIDRIDVEPPLWEKSGEDDTSSGSRLKKNLGRLELNGESVLGRADACL
FT                   RSGLGSKDLGKGREVEKGGVDYEYYSSLGEDISDISIVSGSSMEGSSDIEILSGEENEG
FT                   ERMERHPDSCSLNNDCIRATFLRSSGEDKEDVDNSFPAHVLEESSLSSHEDFEPKSIEE
FT                   FYLREVFKMKEFRTNQREVIQACLSGKDVFVLMPTGGGKSICYQLPALVYEGVTIVVSP
FT                   LLSLVQDQILNLLQKDILALPINSNLSRTERRLVFEALGSDELICKIFYVTPELIAKSG
FT                   HFHEVVSGLVRRGRLKRFVIDEAHCVSQWGHDFRPDYKELGSIRRRYPSVPIIALTATA
FT                   TKKVELDILENLGIRGCETFKMSFNRANLRYEVRAKTSTVELDIVSFVQTHFPDCCGII
FT                   YCTSKKECEMISEKLKKHMKTAFYHAGLSKNERNSVQEKWNKGEFKVIVATIAFGMGID
FT                   KKDVRFVIHYCIPKSLEGYYQETGRAGRDGLESVCVLFYTYGDKKKISFMIEKGDGGYE
FT                   QKQRQKEDLEAVIQFCENKTDCRRMQVLAHFGEKFDPQLCRKTCDNCRRETIVKRDYSK
FT                   EARDLILLVYTSSRITLCQAVDVYKGLSNKKSREYSWSEYYGKGKLLRKITIERILRSL
FT                   ISHGYIQERVEFMERRFSWSYLVARKTKIDRLELDEEEDSANKTAKDNGRKEAPKSRGN
FT                   RKGIKKIKR"
FT   gene            <129714..>130817
FT                   /locus_tag="Eint_071100"
FT   mRNA            <129714..>130817
FT                   /locus_tag="Eint_071100"
FT                   /product="splicing factor 3a subunit 3"
FT   CDS_pept        129714..130817
FT                   /codon_start=1
FT                   /gene_family="HOG000149976" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071100"
FT                   /product="splicing factor 3a subunit 3"
FT                   /note="similar to ECU07_1140"
FT                   /db_xref="GOA:E0S838"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S838"
FT                   /protein_id="ADM11873.1"
FT                   /translation="MDRCDVRKQVKILENMERISNWLIEMGGAKDKKDKMVKRYVRNIL
FT                   KRKYKRYKRMGVLNIEGKLDGGVGRLSDLGYYELKARKEVEEVLRDSKLCGSGLELERI
FT                   FKEYMDVHLCSGYKEFLRWVHKLEADKTKFRYLEYLNELKEYLCRLMKIKYFRMFKRLM
FT                   ASRMEIIKKIEAQRYIEKDFTKEGGFPKVYCLGCSREVAGSVLKYHLKGKKHSKKGDGE
FT                   VLYSDIETLEAENLIRRAFSVLDRERKYSISLFSRRKKLVGDGVPKWKRKQKDLDIEFE
FT                   CEICGYLGYGRDGFDRHFGEDLHRKCVEEYGIRYSPIFKGITRIGTLIRMKDRVEESES
FT                   YSEEFEDRDGNVFDRRTYEDLKRNNLI"
FT   gene            <130841..>131176
FT                   /locus_tag="Eint_071110"
FT   mRNA            <130841..>131176
FT                   /locus_tag="Eint_071110"
FT                   /product="hypothetical protein"
FT   CDS_pept        130841..131176
FT                   /codon_start=1
FT                   /gene_family="HOG000149975" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071110"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1150"
FT                   /db_xref="UniProtKB/TrEMBL:E0S839"
FT                   /protein_id="ADM11874.1"
FT                   /translation="MIRLKEQATFGKIYQIRYRDRMLLKRLREITVIQTYGIRMEGSIT
FT                   CTNEGDLLRILRSLAPKKKDIAILSPSTLIINEEIYKMFRILNAAGISLFLFVLQDNPV
FT                   WYIDEVL"
FT   gene            complement(<131195..>131476)
FT                   /locus_tag="Eint_071120"
FT   mRNA            complement(<131195..>131476)
FT                   /locus_tag="Eint_071120"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(131195..131476)
FT                   /codon_start=1
FT                   /gene_family="HOG000149974" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071120"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1160"
FT                   /db_xref="UniProtKB/TrEMBL:E0S840"
FT                   /protein_id="ADM11875.1"
FT                   /translation="MPSIPLQMENSGAWSAKECFKKVNSVDILIRKKPTKPLKRSRSLK
FT                   IKKAVETPKKIGTPKKRVKVLSPSSRIEIMGSPESKRYSSARKINFSN"
FT   gene            <131540..>132613
FT                   /locus_tag="Eint_071130"
FT   mRNA            <131540..>132613
FT                   /locus_tag="Eint_071130"
FT                   /product="tRNA-dihydrouridine synthase"
FT   CDS_pept        131540..132613
FT                   /codon_start=1
FT                   /gene_family="HOG000259834" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071130"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="similar to ECU07_1170"
FT                   /db_xref="GOA:E0S841"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0S841"
FT                   /protein_id="ADM11876.1"
FT                   /translation="MVRTDALPMNLGIEISLAPMMDVTTAHFRRLIRLTSSSTILFTEM
FT                   IVSNTVIHISRDRLREKLGEYDDKTVVQIGGSDAGQIVEAVKILQDLGYRMFNLNCGCP
FT                   SSRVKKGSFGAVLMLNKELVAEIINKVYKETGEILSLKIRVGVDNHEGIDFLKEFVGYI
FT                   KENTPNRTFYVHARKCWLEGLSPEQNRKLPPLDYDSVYMIKRLYPELKIVLNGCIGINN
FT                   LDRIKDLDGVMVGREAIRDILVFWDIDRKLSMKCDKGERRDCEELFPFDMDMKKIECRS
FT                   DSEAKEWRAQKIRSVVREYFEGFPPSDQLKSIHIQPIINLMRGKKGCKEYRRKLNSLLM
FT                   ERVKAGEAYGLIVEHLK"
FT   gene            <132643..>133065
FT                   /locus_tag="Eint_071140"
FT   mRNA            <132643..>133065
FT                   /locus_tag="Eint_071140"
FT                   /product="hypothetical protein"
FT   CDS_pept        132643..133065
FT                   /codon_start=1
FT                   /gene_family="HOG000149969" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071140"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1180"
FT                   /db_xref="UniProtKB/TrEMBL:E0S842"
FT                   /protein_id="ADM11877.1"
FT                   /translation="MTEPITRETRFNELPQQIKQKLINIYRSSHQQYLSMEMLKPTKFN
FT                   LLYSQTQDLQTRNLQKNFRLLVESAEKLKRMWYLCKDEVDFRYLHENLKKALDELKGEV
FT                   MLYKKNEGNTEFLDEISMTYGMLKNKLESLTKEKRM"
FT   gene            <133259..>134584
FT                   /locus_tag="Eint_071150"
FT   mRNA            <133259..>134584
FT                   /locus_tag="Eint_071150"
FT                   /product="alpha-tubulin"
FT   CDS_pept        133259..134584
FT                   /codon_start=1
FT                   /gene_family="HOG000165711" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071150"
FT                   /product="alpha-tubulin"
FT                   /note="similar to ECU07_1190"
FT                   /db_xref="GOA:E0S843"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniProtKB/TrEMBL:E0S843"
FT                   /protein_id="ADM11878.1"
FT                   /translation="MREIISLHIGQAGVQIGNACWELYCKEHGILPDGRLDQNKMDDES
FT                   AESFFSQTSVGTYVPRTLMVDLEPGVLESIKTGKYRELYHPGQLISGKEDAANNYARGH
FT                   YTVGKEIIEPVMEQIRRMADNCDGLQGFLIYHSFGGGTGSGFASLMMDRLAAEFGKKSK
FT                   LEFSVYPAPKIATAVVEPYNSILTTHTTLDYSDCSFLVDNEAIYDMCRNLGIQRPYYTD
FT                   INRIIAQVVSSITASLRFPGSLNVDLTEFQTNLVPYPRIHFPLVAYSPMLSKEKAAHEK
FT                   LSVQEITNACFEPQNQMVRCDTKKGKYMACCLLFRGDVNPKEANNATANVKAKRTNQFV
FT                   EWCPTGFKVGINSRKPTVLDGEAMAEVSRAVCALSNTTAISEAWKRLNNKFDLMFSKRA
FT                   FVHWYVGEGMEEGEFSEAREDLAMLEDDYERISSNAEPIDEY"
FT   gene            <134574..>135047
FT                   /locus_tag="Eint_071160"
FT   mRNA            <134574..>135047
FT                   /locus_tag="Eint_071160"
FT                   /product="hypothetical protein"
FT   CDS_pept        134574..135047
FT                   /codon_start=1
FT                   /gene_family="HOG000149968" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071160"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1200"
FT                   /db_xref="UniProtKB/TrEMBL:E0S844"
FT                   /protein_id="ADM11879.1"
FT                   /translation="MSIKFIWSIDISSVPTLKSKLFSCHKARLYPLKMEGEGNMEKVKE
FT                   MLQRYSSRGGSFSEGSFLSDIDMSDASFGSWEEELVGRIMKSLRHCKEMAEMGRRRKIR
FT                   LSPKETAECALILDSIKRNIKGFGETRKNWILWGIPIGLSFLGIAYISAKYYF"
FT   gene            complement(<135110..>135445)
FT                   /locus_tag="Eint_071170"
FT   mRNA            complement(<135110..>135445)
FT                   /locus_tag="Eint_071170"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(135110..135445)
FT                   /codon_start=1
FT                   /gene_family="HOG000149967" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071170"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1210"
FT                   /db_xref="UniProtKB/TrEMBL:E0S845"
FT                   /protein_id="ADM11880.1"
FT                   /translation="MEEQREHHAKEKGNTDGIVERDDIMHEQVASNIQPSANAQNPPKH
FT                   SEKSRGYTINELKEYITEIPFPIGEKTGIMKQFLSGIEKLFAIVKSSLQRAMQWLTRKT
FT                   SKDEEKV"
FT   gene            <135580..>137619
FT                   /locus_tag="Eint_071180"
FT   mRNA            <135580..>137619
FT                   /locus_tag="Eint_071180"
FT                   /product="formin-like protein"
FT   CDS_pept        135580..137619
FT                   /codon_start=1
FT                   /gene_family="HOG000149966" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071180"
FT                   /product="formin-like protein"
FT                   /note="similar to ECU07_1220"
FT                   /db_xref="GOA:E0S846"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S846"
FT                   /protein_id="ADM11881.1"
FT                   /translation="MESWKSKSLEHINIQFRSIMEGMGIDEEKQHKLAAKLNLSKKIRT
FT                   ITSMQSLDERKKKIKEYVIKLKDRNSVLNLLSLSVSLETGPKVLYDIFNSEGGHDVLVR
FT                   CMRRMDEEFGDVVCDALYIVLSKYGNRFPPFLRPLLDGFLGGKIHETRSFFKILEFLVN
FT                   ENKADELFFSTDFNKCVCNTYLSRIMEFIKGIPTIEEELNFLVPLLKSPKAVHVRYILF
FT                   VSDLSQLEQRVSNKEVFETIIKEIKPGVRQDWKRGRINEVVRLAEMEGVLDIACCVFEA
FT                   FAFRDSKVFADVEKAVEKMSILEGVEGEKKELPKVEKKEEVVRKPEAGKTKGPKKIIKK
FT                   AVKSGGPTKRYVQVKWTKMGKGNSLWSKINIEEMEKTFGTEEFDGFEVKGEKPKISHGE
FT                   AEKRRPSVFSEKKNYAINIALGRVKESNRDLKRAILDMREGLNENLVKQLLFYFPTDEE
FT                   IELLQNTENVFGRGEEFFKESIEEIELMKRCLYYLYFMISFRNQNVCKTLRILERYYTV
FT                   LLESKEFRRFLGITLVAGNHLNRGSFLGNAEGFTMESIPKILEVKNDGESLLSLLKRKI
FT                   DGEQLLKDLSVVYDASGVNFEALCMEVEELKKNYINASGSTFLKIQERMESIQEEYEKI
FT                   CSLHDKVGKLHRDCKEYFGEKVDDEFNSWIILLLDRMSHDMKKK"
FT   gene            <137646..>138017
FT                   /locus_tag="Eint_071190"
FT   mRNA            <137646..>138017
FT                   /locus_tag="Eint_071190"
FT                   /product="Frq1 calcium-binding caltractin-like protein"
FT   CDS_pept        137646..138017
FT                   /codon_start=1
FT                   /gene_family="HOG000149350" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071190"
FT                   /product="Frq1 calcium-binding caltractin-like protein"
FT                   /note="similar to ECU07_1230"
FT                   /db_xref="GOA:E0S847"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:E0S847"
FT                   /protein_id="ADM11882.1"
FT                   /translation="MRTMKEQWDSFETGNLTKETTKDLLRLCGFAPREKDISIPRTFDE
FT                   FEQLASSIASPIPKDEMKKMLKMFIHETHITKQDLGKYMSMGDKLSEEEMEEFFRSCPF
FT                   DRNGEITADELLDFLYGSQ"
FT   gene            <138022..>138324
FT                   /locus_tag="Eint_071200"
FT   mRNA            <138022..>138324
FT                   /locus_tag="Eint_071200"
FT                   /product="hypothetical protein"
FT   CDS_pept        138022..138324
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071200"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1240"
FT                   /db_xref="UniProtKB/TrEMBL:E0S848"
FT                   /protein_id="ADM11883.1"
FT                   /translation="MFCFRLPCFCLEEIFTDNDGPLMLTIDEIVGEKDLVQLFRTIVRK
FT                   GEVKFLNRQYIVKRIREFAPLSMEDLEGLYDEDILEELERNRRWSILRRLKRDRK"
FT   gene            <138395..>139009
FT                   /locus_tag="Eint_071210"
FT   mRNA            <138395..>139009
FT                   /locus_tag="Eint_071210"
FT                   /product="hypothetical protein"
FT   CDS_pept        138395..139009
FT                   /codon_start=1
FT                   /gene_family="HOG000149965" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071210"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1250"
FT                   /db_xref="UniProtKB/TrEMBL:E0S849"
FT                   /protein_id="ADM11884.1"
FT                   /translation="MVVLTTQGNSNRKIFEIRDGTALGDLLRDYVRALELYSIDMESVR
FT                   ESLSSIFAYIFLLTVQIFGFLWVVSWTEGKKGISSAAGLSFGAFCVMTMFFFGAGYIYK
FT                   EILKKRADSSYISYVYVVGLSVVHYPYLMFIGLLAKNIWMFLCMMAITSISQFLIRSSM
FT                   LRNHNFESSRDGFMFDIASFILQCGFCFGSLSLFSFLSPGN"
FT   gene            complement(<139058..>140038)
FT                   /locus_tag="Eint_071220"
FT   mRNA            complement(<139058..>140038)
FT                   /locus_tag="Eint_071220"
FT                   /product="Golgi nucleoside diphosphatase"
FT   CDS_pept        complement(139058..140038)
FT                   /codon_start=1
FT                   /gene_family="HOG000149348" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071220"
FT                   /product="Golgi nucleoside diphosphatase"
FT                   /note="similar to ECU07_1260"
FT                   /db_xref="GOA:E0S850"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="UniProtKB/TrEMBL:E0S850"
FT                   /protein_id="ADM11885.1"
FT                   /translation="MDTMLLLLLPGIILGLSSPSNSKAFSPSKMTYSGVIDAGSTGTRL
FT                   NIYGFVDGEIKHQGLFTNSQGLAGAKSDEEIQNSIRELFTHAKPFYNNIKEMPIGFYGT
FT                   AGFRTLDKSRSDHILDLVRNELKEYNLKEIEVINGIDEGRFALMALILSNKGKENEQKS
FT                   LGIIDMGGGSTQISFLEKNGRVTSESIDLGITSLGLSDPEECKSKDDNSQELCATNIVL
FT                   KLANVVRKPFLNDVDSLYLLSYFHDEFGKIARGEKTSMKEVKDKFYKKCNLLESLECRR
FT                   LFYLISFIKNLGIEDGKTIHQVDTNNGINIAWASGKGYELNKTYN"
FT   gene            <140182..>141126
FT                   /locus_tag="Eint_071230"
FT   mRNA            <140182..>141126
FT                   /locus_tag="Eint_071230"
FT                   /product="Mrk1-like Ser/Thr protein kinase"
FT   CDS_pept        140182..141126
FT                   /codon_start=1
FT                   /gene_family="HOG000149347" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071230"
FT                   /product="Mrk1-like Ser/Thr protein kinase"
FT                   /note="similar to ECU07_1270"
FT                   /db_xref="GOA:E0S851"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S851"
FT                   /protein_id="ADM11886.1"
FT                   /translation="MATLSQKKLVESIKLIEREWIKMHKALARSRCGEVKEVKYKYVEM
FT                   IGRGSFGVVVKIMDDRLNFFALKRVYQDRRYHNRELSILMEVDHPNIVRLVSYFYTDKT
FT                   PSGMYLNIITDFVGMNLEEYMKANRNVEIDTIRPIYRQILEGLEYLHEKKICHRDMKPS
FT                   NILIGPNGLVKICDLGSAKVIGNGEKNITYICSRFYRAPENLLDYKEYDFKIDIWSVGC
FT                   VVAEFRHSGPMFKGDTSGSTLNRILEIVKASEDDLIGLGCQRTDYKPGVGVRKYLEKLF
FT                   DDPDLLEVLEKSLVFSPSKRSTASSLLKSRFFQ"
FT   gene            complement(<141251..>143344)
FT                   /locus_tag="Eint_071240"
FT   mRNA            complement(<141251..>143344)
FT                   /locus_tag="Eint_071240"
FT                   /product="glucosamine fructose-6-phosphate
FT                   aminotransferase"
FT   CDS_pept        complement(141251..143344)
FT                   /codon_start=1
FT                   /gene_family="HOG000258898" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071240"
FT                   /product="glucosamine fructose-6-phosphate
FT                   aminotransferase"
FT                   /note="similar to ECU07_1280"
FT                   /db_xref="GOA:E0S852"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniProtKB/TrEMBL:E0S852"
FT                   /protein_id="ADM11887.1"
FT                   /translation="MCGIFGYANFSTEKTKDEIANIMINGLKRIEYRGYDSAGFCITDN
FT                   SDRDFVKIRSVGKVDKLREIKNIQAPIDFSRKVSNHVSIAHTRWATHGQPSVENSHPLS
FT                   SDKENNFLVVHNGIITNYKDLKVYLEKRGFTFESSTDTECAAKLALYFYKEMEKEGKKP
FT                   DFVSVVKRVVRHCEGAFAFVFVSSLFPNELVVVRKSSPVLIGLKPSGKMSFDFFGVNYD
FT                   DSMDHSISPLGSPLMSPNFDKYKFNPNIETISKGVQECSLHTYNKEPLEIFVASDASAL
FT                   VEHTRKVIYLEDNDIAHVSNGNIFIHRMHSKIKETGSSTREVKTIETELAEIMKGSYDH
FT                   YMLKEINEQRESVVNTMRGRINFENFKVSLGGLKDHIDDIRRSQRIIFVACGTSYHASL
FT                   ANRGLLEELLEIPVSVEIASDFLDRRPPILRSDCVFFVSQSGETADSVMALRYCLSKGA
FT                   LCVGITNVVGSTISRETECGIHINAGPEIGVASTKAYTSQYVALVLVALQLSEQSLPKQ
FT                   ERRREIMEGLKNLSSHIDKTLELSNSTRDLADVLKNDANLLIIGRGHQYSTCLEGALKI
FT                   KEITYIHSEGLAAGELKHGPIALVDDKFRIIFVITKDTFYDKARNAMEQILARGGKPIM
FT                   ICTEDISKDYAGHHLLVIPKTVDCLQGILAVIPLQLLSYYLAVARGYNADFPRNLAKSV
FT                   TVE"
FT   gene            <143490..>144164
FT                   /locus_tag="Eint_071250"
FT   mRNA            <143490..>144164
FT                   /locus_tag="Eint_071250"
FT                   /product="hypothetical protein"
FT   CDS_pept        143490..144164
FT                   /codon_start=1
FT                   /gene_family="HOG000149964" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071250"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1290"
FT                   /db_xref="UniProtKB/TrEMBL:E0S853"
FT                   /protein_id="ADM11888.1"
FT                   /translation="MRISLKDEKFFRTMIGVFADKGNIEFDIRPEEITASSCGQSNFYL
FT                   VINNDVFTADGECLSFVVKAQHLLEGINALGRYDLVIEDDLKLLDGGNTIFIPFLPAPK
FT                   SEYEEPDTPVAKLVVSPELLEAFGMLKGVVTYEIEGNKLFIRKAGSDVLEEIEFLTGGF
FT                   IIAGDLQFKCNNRWTDVLAGIKSYVDSIMLTFGANTLCIQFLFKKYSRSYLELQVWRSL
FT                   GD"
FT   gene            <144207..>144977
FT                   /locus_tag="Eint_071260"
FT   mRNA            <144207..>144977
FT                   /locus_tag="Eint_071260"
FT                   /product="Hsp90 ATPase activator"
FT   CDS_pept        144207..144977
FT                   /codon_start=1
FT                   /gene_family="HOG000149963" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071260"
FT                   /product="Hsp90 ATPase activator"
FT                   /note="similar to ECU07_1300"
FT                   /db_xref="UniProtKB/TrEMBL:E0S854"
FT                   /protein_id="ADM11889.1"
FT                   /translation="MESKGSNYHWAESDLSGWAKDKIKETLEHRGYKVNEMDVMVKICQ
FT                   RMNTLGLVYMIGFECTKDGKYCSIRNFYSVSEKAEGMEDFEWFPGFFSELEEEAILKFG
FT                   SRVLDTNRQVEERKPCVRSIDAEDAKTVDISYKASINCEINEFKNFILSQEYISMWSGY
FT                   RATFDGDDILIDGVIIRRLREENGCIRMEWKLERWSHFTEVKISLESFLNSSKVTVKQK
FT                   AVPIKEEKSIRMWWHEKVFASISTCFGFILKPLE"
FT   gene            <145028..>145459
FT                   /locus_tag="Eint_071270"
FT   mRNA            <145028..>145459
FT                   /locus_tag="Eint_071270"
FT                   /product="hypothetical protein"
FT   CDS_pept        145028..145459
FT                   /codon_start=1
FT                   /gene_family="HOG000149962" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071270"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1310"
FT                   /db_xref="UniProtKB/TrEMBL:E0S855"
FT                   /protein_id="ADM11890.1"
FT                   /translation="MWTPASTDMVAWKDGRGDCIIRCFGCGNVVCRRARRAMLLSNVKI
FT                   EVYSANVPTECVKCVRDGYLAYSCQCIVVDAECRCCRMILGYHILHPCKLCEEIGGIRH
FT                   AWIFDTSSVISSIRRERSEACLNVSAAWNGEGDNEVKIR"
FT   gene            complement(<145552..>146562)
FT                   /locus_tag="Eint_071280"
FT   mRNA            complement(<145552..>146562)
FT                   /locus_tag="Eint_071280"
FT                   /product="hypothetical transmembrane protein"
FT   CDS_pept        complement(145552..146562)
FT                   /codon_start=1
FT                   /gene_family="HOG000149961" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071280"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="similar to ECU07_1320"
FT                   /db_xref="GOA:E0S856"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:E0S856"
FT                   /protein_id="ADM11891.1"
FT                   /translation="MAEDYNKQKVYLTDISREPNAGGRKQARIELRALKDAYALKIETD
FT                   MMPKEENTVPDTKLFRVTAYCTADGYDLKNLYKYLKSNSLCNKVSMYFGECLYTLMNFK
FT                   GSGERHDCFFYEYGVVVCWGMSEMQESMIVKLVEKYEENGHEPSEVEIESFKYGITDNP
FT                   FIINDVIYLNSENHFTKMVISIAIAKSVKLDYFENLVDNTIDAVKEFPEEVEREGKVSK
FT                   SKKEILKMIGKLHRLRFNLNLGSNILDEPEFVWDYPAFSSLYETCKRYLDIKPRADLLN
FT                   RRCDVINGILEILNENTNRSSIEKFEVVLIIIILSNVVLIISQMIEMYIRLLNKS"
FT   gene            complement(<146637..>147482)
FT                   /locus_tag="Eint_071290"
FT   mRNA            complement(<146637..>147482)
FT                   /locus_tag="Eint_071290"
FT                   /product="eukaryotic translation initiation factor 5"
FT   CDS_pept        complement(146637..147482)
FT                   /codon_start=1
FT                   /gene_family="HOG000149346" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071290"
FT                   /product="eukaryotic translation initiation factor 5"
FT                   /note="similar to ECU07_1330"
FT                   /db_xref="GOA:E0S857"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="UniProtKB/TrEMBL:E0S857"
FT                   /protein_id="ADM11892.1"
FT                   /translation="MIDINRTNNDFYYRYKMPRAVVKQEGKAGNTRTVIVNLEDISSSL
FT                   KRPPLYILKFMSYELATRTDIGKGRYAVNGRYESSRIQDLIYDFIDAYVMCPFCNNPET
FT                   FYINNGGLSLECLACGKISDVKSSKLNGMILKDVERNSLERDDAYFNPGDEEDDKYQDE
FT                   MKRLMESGEDKSEDIVNLLRSHGLSDESIGKEVLMFDGGLRKCKGIGNLISTKALLSSA
FT                   EEIVENGKEKKKIQEYLRMFEDEKIFKRSELFKYFTRPQGNRKRSPEFKKEVSEYFSNQ
FT                   "
FT   gene            <147561..>149213
FT                   /locus_tag="Eint_071300"
FT   mRNA            <147561..>149213
FT                   /locus_tag="Eint_071300"
FT                   /product="23S rRNA methyl-transferase"
FT   CDS_pept        147561..149213
FT                   /codon_start=1
FT                   /gene_family="HOG000149345" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071300"
FT                   /product="23S rRNA methyl-transferase"
FT                   /note="similar to ECU07_1340"
FT                   /db_xref="GOA:E0S858"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniProtKB/TrEMBL:E0S858"
FT                   /protein_id="ADM11893.1"
FT                   /translation="MGKSKSTGRTRLDKYYNLAKEKGYRARSAFKLLQINRKYAFLEKA
FT                   HVLIDLCAAPGSWCQVAAQEMPLRRKIVAVDLEPIKFMGDVDTITADITSDECRLRLRE
FT                   ILGTHKADVVLHDGAPNVGTSWENDAFNQNLLVLHSARLTAEFLKKGGVFVTKVFRSQD
FT                   YFSLLNILSQLFETVETSKPLSSRSQSAEIFLVCLGFIGEEEVDYSILDPSAVFTEMKE
FT                   TGGYEDFNFHKKLKLTEFLKEENPEILSEMLLKYSEIVVDIDEKDIEKILEPEFLYLFK
FT                   DLQLLGKGEVRKILAKRKKIIRAVRKGDVDIPALDFLGRNEEEEIEMKEKSVEEKIEEI
FT                   EMLLEKKKKQSRREECKTKNEQPAECFFKDSVFDKLNIISDNEEELEESPEQDIEVSSC
FT                   SDSLDLDEEELMCIAKLKEDPEGFVEDTIDRYIRDPNEKLPNYLREDQEAFFSRPSKAE
FT                   ERRLTKKEKEALSRRKTRAERRAEMFMKDLVIDDSEEEGKVAKKIYKSSFKKTKTKPRV
FT                   VFPKKGRCGVPRGKGRVVMLDRRLKKDKRKGKA"
FT   gene            complement(<149311..>149775)
FT                   /locus_tag="Eint_071310"
FT   mRNA            complement(<149311..>149775)
FT                   /locus_tag="Eint_071310"
FT                   /product="putative vacuolar ATP synthase proteolipid
FT                   subunit"
FT   CDS_pept        complement(149311..149775)
FT                   /codon_start=1
FT                   /gene_family="HOG000149344" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071310"
FT                   /product="putative vacuolar ATP synthase proteolipid
FT                   subunit"
FT                   /note="similar to ECU07_1350"
FT                   /db_xref="GOA:E0S859"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="UniProtKB/TrEMBL:E0S859"
FT                   /protein_id="ADM11894.1"
FT                   /translation="MELDEKTLSLIISKLGPGLMISLSAIGGGLGFIAGSEGICKAAEN
FT                   VVNTTYSLVPIIFITAPTMYSVILYFMVYDKKIESLKDGLLVLSACVVNGVSSGVAGYS
FT                   IGYSAKVACVTRSQQKKFNSIFFLILIFGEVVGLLGLVCAMAISSSIGNE"
FT   gene            <149876..>150367
FT                   /locus_tag="Eint_071320"
FT   mRNA            <149876..>150367
FT                   /locus_tag="Eint_071320"
FT                   /product="hypothetical protein"
FT   CDS_pept        149876..150367
FT                   /codon_start=1
FT                   /gene_family="HOG000149960" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071320"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1360"
FT                   /db_xref="UniProtKB/TrEMBL:E0S860"
FT                   /protein_id="ADM11895.1"
FT                   /translation="MECPMGKSDFLAKFEEMKDGTFTPKDQSQNWCRHFGVKKDKRLHL
FT                   YPEEMLYLYDRNPKEEYSVRTKAYFFIRNNCYNLLLGEDGRFLLYRRHKNFNRKKDKPI
FT                   CLMRYVHRDEWMEDSTKDIVDESFCVLSDDVFTFLRIRKVLKLGMDTPENLRKWDGEPF
FT                   "
FT   gene            <150407..>151165
FT                   /locus_tag="Eint_071330"
FT   mRNA            <150407..>151165
FT                   /locus_tag="Eint_071330"
FT                   /product="hypothetical protein"
FT   CDS_pept        150407..151165
FT                   /codon_start=1
FT                   /gene_family="HOG000149958" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071330"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1370"
FT                   /db_xref="GOA:E0S861"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S861"
FT                   /protein_id="ADM11896.1"
FT                   /translation="MSRNGQGDQGQLTKTIIAVGFNDQKHQEEVRGRVEKHFDVRESYK
FT                   IQNDHRVLCILFYDERRAREAISFLKEEGISSYHIISKYEIPRDMDKCDESRNQSTLLF
FT                   TFKNLAGSVDDKEFGEQVGRFGEVKDIRYVKTHQRCVEFYDSRSAVAAFHGMNELKFMD
FT                   GMMQAKWVWDLSTKTRWELIRLTDSILKECKLEIKTPTKRESEESKEEIKRKKKVQDSD
FT                   TAHPRNIFLKRFDSFIALNIDHITEGYVND"
FT   gene            complement(<151272..>151667)
FT                   /locus_tag="Eint_071340"
FT   mRNA            complement(<151272..>151667)
FT                   /locus_tag="Eint_071340"
FT                   /product="putative ubiquitin/L40 ribosomal protein fusion"
FT   CDS_pept        complement(151272..151667)
FT                   /codon_start=1
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071340"
FT                   /product="putative ubiquitin/L40 ribosomal protein fusion"
FT                   /note="similar to ECU07_1380"
FT                   /db_xref="GOA:E0S862"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniProtKB/TrEMBL:E0S862"
FT                   /protein_id="ADM11897.1"
FT                   /translation="MKIVVRFCGKTSFVQADPSEPILSLKGLAGNACGLSSSMVVLQHN
FT                   SRILEDSNTVASYGIRNLDTITMYPRLLGGGGNMSENDGAMAMKEKNDCLICRRCYARS
FT                   GKSAQKCRKCDSKDLRPKKPLKTMKKK"
FT   gene            <151765..>152025
FT                   /locus_tag="Eint_071350"
FT   mRNA            <151765..>152025
FT                   /locus_tag="Eint_071350"
FT                   /product="hypothetical protein"
FT   CDS_pept        151765..152025
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071350"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1390"
FT                   /db_xref="UniProtKB/TrEMBL:E0S863"
FT                   /protein_id="ADM11898.1"
FT                   /translation="MANPVHSAHGAYFPLLEPQCYAMRMEGVFTLAYAWLALDRMLTFY
FT                   AHLVKTLLAYPAYIAFYVPFPIVNRIDFLNLYFDHSIGQVL"
FT   gene            <152202..>152753
FT                   /locus_tag="Eint_071360"
FT   mRNA            <152202..>152753
FT                   /locus_tag="Eint_071360"
FT                   /product="60S ribosomal protein L22/L17e"
FT   CDS_pept        152202..152753
FT                   /codon_start=1
FT                   /gene_family="HOG000205045" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071360"
FT                   /product="60S ribosomal protein L22/L17e"
FT                   /note="similar to ECU07_1410"
FT                   /db_xref="GOA:E0S864"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="UniProtKB/TrEMBL:E0S864"
FT                   /protein_id="ADM11899.1"
FT                   /translation="MGIKYSYEIHDPSKAVKGKIDNAKVSFKKTRETCCTLRKRKLLDA
FT                   IQYLKNVISKTECVPFRRYNRGCGQTHQARKFSIPRKEIVKANGEKVIKRGHVQTRGRW
FT                   PKKSAEFVISLLESVKESAESKSLDVGSLVITHIQVSKAPKIFGRTFRAHGRVNPFNKS
FT                   PCHIQVVAEVLESNDVSIEA"
FT   gene            <152814..>153677
FT                   /locus_tag="Eint_071370"
FT   mRNA            <152814..>153677
FT                   /locus_tag="Eint_071370"
FT                   /product="20S proteasome subunit beta type-1"
FT   CDS_pept        152814..153677
FT                   /codon_start=1
FT                   /gene_family="HOG000149343" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071370"
FT                   /product="20S proteasome subunit beta type-1"
FT                   /note="similar to ECU07_1420"
FT                   /db_xref="GOA:E0S865"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:E0S865"
FT                   /protein_id="ADM11900.1"
FT                   /translation="MLNNKGRIHSMSGGFNLRAPREYGLFEDIDFPMSLDSMDELDTRS
FT                   SIGAMNGTELRKDGIESLFISKKNDYKEVKEEEKFNPYEDNSGTTVCLKQDDFIIVAGD
FT                   TRHSSDMVINSREMSKIFRMGNFLLTGTGFYADTYEVYRKMTDEILQYEVDGPMSIHSS
FT                   ANLLSKILYSRRFFPYYSFCTLSGFEKGKAYLYQYDPLGSYDLTTCVCKGSGRSMIQPL
FT                   LDSFIDKKNWNNASDAQISQEDCIRLVVKAFNSVAERDIKTKDNLEIYVVREHELTHQI
FT                   LPLRRD"
FT   gene            <153792..>155621
FT                   /locus_tag="Eint_071380"
FT   mRNA            <153792..>155621
FT                   /locus_tag="Eint_071380"
FT                   /product="hypothetical protein"
FT   CDS_pept        153792..155621
FT                   /codon_start=1
FT                   /gene_family="HOG000149957" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071380"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1430"
FT                   /db_xref="UniProtKB/TrEMBL:E0S866"
FT                   /protein_id="ADM11901.1"
FT                   /translation="MFLSLVCSENLGIRYEDVISKWVNYEKRRMRDGPLGVSPSSFTIE
FT                   NGMPKSRRLLDSKTIWNPVRMFEDDFEGLECKGVLKKISRDGDSKYLSEGYETLLDESG
FT                   INYLCLSTAVRPLRISIEGITNVAIGYRGYFDEQKAQKLGECLSRVLNGMEVCVIPESL
FT                   CGLVSKLEHVGEDVSLHCMVIMTSGRKTVFSLYKVEIKDKERRFENLFHESLDGISDWK
FT                   MERIVYDYIEEKLKEYISIKDDISETSRNVAFYPQIEEGRDSSLRIDMRPIYKEIRNAL
FT                   RYENPRGGVKMVNGVSVVDGEENVRFVIEAPIFNIEEIQKRLEEFVKENEGEFGRMVKE
FT                   IKKKAEEIIEPGGYSVMMRSEFYGNPIFDRIFGNFGKRDHIRSESIEKGAARIMRTEYM
FT                   VIDPKILRVKGRSGNGEAYLDEVKARREIGEILEKKKDKKLRDIFELVPDSCIEEADEI
FT                   FSDVSELDSIKRAVEKWKELEAKDGEIREEKRLREQALKDLKEAIISAEKLGKSNLEVW
FT                   DSGLKDEVTKALEHLNIMSADSKYKKKDIEEVEFNLIIRSKSLFNAYEEKARKEAEKKE
FT                   EEKAEGDGTEKEAEVNKDSEEKPESGEEGRSEL"
FT   gene            <155744..>160399
FT                   /locus_tag="Eint_071390"
FT   mRNA            <155744..>160399
FT                   /locus_tag="Eint_071390"
FT                   /product="dopey-like leucine zipper transcription factor"
FT   CDS_pept        155744..160399
FT                   /codon_start=1
FT                   /gene_family="HOG000149956" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071390"
FT                   /product="dopey-like leucine zipper transcription factor"
FT                   /note="similar to ECU07_1440"
FT                   /db_xref="InterPro:IPR007249"
FT                   /db_xref="UniProtKB/TrEMBL:E0S867"
FT                   /protein_id="ADM11902.1"
FT                   /translation="MDESRERYEAEMTKKLDAFKTAKEWSDFISLLSSLDNTIRKFSIP
FT                   EIPKKKLLFKRLNQCLNPVLPAGIHNKTLETYSLVFEKISRENFLKEFDFLTLGLFTFS
FT                   AHCRILVISSFLDLIEKYIVPLGADVERYSTSILIGLLPPMEFESGEHYSRAHLIVTEF
FT                   KSLVSLEVFYSSMWSILLNDERLRTSVVNYMLSLGWEEQILGNERLVVRALCAGLGSES
FT                   TLVVRNCLDLLIFVFPDKDHVCKEDMLDDLTEAVIRLFVKRDLSLNKRIYGWMCMADNF
FT                   NEADVALLSRALKRFLDRNSAEDIQLFFRIMMTLQDKGKLCEKIMENLLFDVLSCLQKH
FT                   QRKGVKENVDSDAFEERQGESIDVEKIARAFLTTDLDSIWKIFYLRLRNVLKEAKEKML
FT                   LDLNLIDDEELNDSVMREEIYSMHTMSLILNEGQIVLSEGSSLNNSQDRSSNEKISEAE
FT                   ERSSFEEISPRKEEIVAKALKVEKRHRNRRDSRRPTQVLSFIRFAVENYSVVDSEVFHY
FT                   HLPFLVHLVLSDFLLFDAQIVFSFLDFSAKIMKFKEKQVEGGRNLQKLIGRFYLEEDTS
FT                   VLDDVSSTILYSISDKIGIAIESNVELSLPLMSTFIKIYGEDVFPSGFIPNYHNFILKS
FT                   SNRLIKEHLEVYKIIDCTRLDSQAMFDVLWTRFCHVEKDLYLENPKESDTNNGMQRISR
FT                   RNITSRFFITGKGPHRRALVELLWKYNAIFGRSFEKFLLKRIGEGEVEEISYFLLLKIE
FT                   NFKGNFDFLELYYIINCKLDPEDLVLNTFLCSLTCFDDLFKFLLKKLEDSNIQTSDTFF
FT                   SESIDLNQIVGVFKCIKNLLEYSKGFKSMLVDSEEKLYSKVLPLEEPVSSREILYRILV
FT                   HLLVNRKEYDGRDFDLEIIKVLEALMRGGILDSSVMNVVDLSKIVDVAKGYRGDPAIVL
FT                   GIAPLIKHSGNSMAIQDLCSILDSQCFYYHEFLGFVFSLTDRLQRKVLSNVLFSLENQD
FT                   FALMIVSETITNMLVKRGVEGELPGFIDKSMKFIFEFFENQYVDVNEAESEGNKVRSVV
FT                   RKDKFDEQSIGGDDLVVFEERINTRMNALRFSTAKELSSLFFKKVPIGFVEMILGNPPC
FT                   IPFLKSIDFREQLYMSIMNLYSTNAMKVFKFLGVLNKVMDPQEMIGVFNKSKNLLEKIS
FT                   SYRIGSDYSPLNFVLDFLQSLDLQEDAEALVQSAIINSVYFLQKRLDLKIRNGEKEFED
FT                   EIGLLDRITNFKFQGVVLSAVPSLITVILTLVNSNSPNLKNVGIDTLAKLSSKGLEEKY
FT                   WKKEYIEIFHTLDFFTYRLYKKSDLMKKVVAKDPSIINDLIVRLDSGFFVSQASDANNK
FT                   TLVLKRISFIIFSAPYNYFASFSLKLIEKIASLINYPSSKVRREVFLLSKMLVLKISHD
FT                   KLINLYPILLYDIGIIIESSDFEDVMLLAEVLKLLDVVFLLNTPQFTETRVVFLGPRCT
FT                   TTMEGEGKKPGLENLRDLLNCKYGKEIPSEFRRPKKKIPFLGPGKKDIDEILDFTSNAL
FT                   EYYNWLDENCSEIDYEYLFNLTLEELTETTE"
FT   gene            <160451..>160816
FT                   /locus_tag="Eint_071400"
FT   mRNA            <160451..>160816
FT                   /locus_tag="Eint_071400"
FT                   /product="hypothetical protein"
FT   CDS_pept        160451..160816
FT                   /codon_start=1
FT                   /gene_family="HOG000149955" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071400"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1450"
FT                   /db_xref="UniProtKB/TrEMBL:E0S868"
FT                   /protein_id="ADM11903.1"
FT                   /translation="MGKASGPWTSRMKDTMAIFKKNQKIYSTGAFDPLILDAVTGLREM
FT                   ARMAYGDELLYVEARGWVISSLFGVNDVVVILVSRGLDSKKLKHIYESYRVCEAYKDIG
FT                   LMDILLRMYGKKAGAGR"
FT   gene            <160883..>161186
FT                   /locus_tag="Eint_071410"
FT   mRNA            join(<160883..160885,160917..>161186)
FT                   /locus_tag="Eint_071410"
FT                   /product="60S ribosomal protein L37"
FT   CDS_pept        join(160883..160885,160917..161186)
FT                   /codon_start=1
FT                   /gene_family="HOG000111076" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071410"
FT                   /product="60S ribosomal protein L37"
FT                   /note="similar to ECU07_1460"
FT                   /db_xref="GOA:E0S869"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E0S869"
FT                   /protein_id="ADM11904.1"
FT                   /translation="MSKGTASFGKKNKRNTEMCRRCGRQSYHKQKNSCSSCGYPTPKMR
FT                   NPGSIKARRRRTVGTGRMRYMKRELRAAKNGHRGNPILRPLWSGN"
FT   exon            <160883..160885
FT                   /locus_tag="Eint_071410"
FT                   /number=1
FT   exon            160917..>161186
FT                   /locus_tag="Eint_071410"
FT                   /number=2
FT   gene            <161290..>161952
FT                   /locus_tag="Eint_071420"
FT   mRNA            <161290..>161952
FT                   /locus_tag="Eint_071420"
FT                   /product="hypothetical protein"
FT   CDS_pept        161290..161952
FT                   /codon_start=1
FT                   /gene_family="HOG000149954" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071420"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1470"
FT                   /db_xref="UniProtKB/TrEMBL:E0S870"
FT                   /protein_id="ADM11905.1"
FT                   /translation="MITHEVERVLERPSEMEPLKTISNGMSSLHLYLQETEGDVYEPAF
FT                   SQLVQRLKNIPDFVMEQGDKIYRIVPFESIEIDSPGGKKNHGKFHEIASMGNEVVMTYT
FT                   SSGRDGEEGMYTTITVIFTSSDGEEKIEKIYSGWSESCLLRVSTPKLKVKHRKRILSMY
FT                   LEDLESKDPKEEAIGHWIEGVNSEGKGFNNDAILKEEMMIFEEAGRKDSGDSVKKAD"
FT   gene            162028..162098
FT                   /locus_tag="Eint_071430"
FT   tRNA            162028..162098
FT                   /locus_tag="Eint_071430"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA Type: Arg, Anti Codon: TCG, Cove Score: 54.48;
FT                   similar to ECU07_1475"
FT   gene            complement(<162138..>162872)
FT                   /locus_tag="Eint_071440"
FT   mRNA            complement(<162138..>162872)
FT                   /locus_tag="Eint_071440"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(162138..162872)
FT                   /codon_start=1
FT                   /gene_family="HOG000149953" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071440"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1480"
FT                   /db_xref="UniProtKB/TrEMBL:E0S871"
FT                   /protein_id="ADM11906.1"
FT                   /translation="MLHDVVIVALALAFCFFLVNRKRRLLDKKTLLLEPFKKHFERSAE
FT                   EFPSIHQSILKLVGHPSLDYLCGIITLKRDFCLSYILGSVPKESLILTGQLKVRTPCMY
FT                   VFRKTLPPKHYGLKYTKKCLLGNIPGYRTFGALGEKHLEFIKKYDVSIFFVSYAPQDIE
FT                   DSPSFESQVFLKAGLSLLENPEFIDDFLGLFDTIVPEPSKRVLEMKQGYNRDAEALKVR
FT                   ENRSFGEKMAFYLREKNKIRKK"
FT   gene            162949..163021
FT                   /locus_tag="Eint_071450"
FT   tRNA            162949..163021
FT                   /locus_tag="Eint_071450"
FT                   /product="tRNA-Lys"
FT                   /note="tRNA Type: Lys, Anti Codon: TTT, Cove Score: 66.68;
FT                   similar to ECU07_1485"
FT   gene            complement(<163072..>163731)
FT                   /locus_tag="Eint_071460"
FT   mRNA            complement(<163072..>163731)
FT                   /locus_tag="Eint_071460"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(163072..163731)
FT                   /codon_start=1
FT                   /gene_family="HOG000149952" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071460"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1490"
FT                   /db_xref="UniProtKB/TrEMBL:E0S872"
FT                   /protein_id="ADM11907.1"
FT                   /translation="MGSKFVKYLSDSIANLSSLVMSISSSTHAPAEESTVPLSSIDMNE
FT                   KTEGCRRTTNPDNETIVLKRSDYEKTCSELASSRTMIEDLKKKEEECNRMLRNYDATLT
FT                   YALERNEKEKILLESTIMNEEIERLKSNEYRLKSYIQALKRDLFASEDKMESLRKANNE
FT                   RIEFLVGQVEEAKGMYEEEKRKVSYLSKRLNELEDAFGVRCREMVELAEYCKYLLR"
FT   gene            complement(163782..163899)
FT                   /locus_tag="Eint_071470"
FT   rRNA            complement(163782..163899)
FT                   /locus_tag="Eint_071470"
FT                   /product="5S ribosomal RNA"
FT                   /note="similar to ECU07_1495"
FT   gene            complement(<164035..>167460)
FT                   /locus_tag="Eint_071480"
FT   mRNA            complement(<164035..>167460)
FT                   /locus_tag="Eint_071480"
FT                   /product="cation-transporting ATPase"
FT   CDS_pept        complement(164035..167460)
FT                   /codon_start=1
FT                   /gene_family="HOG000149342" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071480"
FT                   /product="cation-transporting ATPase"
FT                   /note="similar to ECU07_1500"
FT                   /db_xref="GOA:E0S873"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="UniProtKB/TrEMBL:E0S873"
FT                   /protein_id="ADM11908.1"
FT                   /translation="MFVGIKQERPFISIEGRRRRMSVRLYNILCMLTLGGLYMLCRYLP
FT                   RVKHFLLSSPCSLLDADCAIITSQNGKEEFVDVLFYDTAGIPSLRRYTLGGKARVIDSQ
FT                   FFRFIYDVVLGKFVVPPEQKHPSGDFEEFYRTEVSKSLETERIEGVQRNIFYGKNITNL
FT                   PIPSVSNIILKNILSITFLSNVTCLFVWKFIEYTSYALVMGVLMVYSFVFTNWEEILHS
FT                   INMKKLMKKRMVRILRGGKFMEVDSREIYPGNIMYIEPCKEFPCDALVILGDAITNECL
FT                   LTGEAVPIYKNAEQLSTVYSGTDVLKSINTMPIFNSLRNENLCRVRSLTGKNKPRLSGE
FT                   VGSINIPENFAIGMVLRTGFQTARGQILKNMLDSRPTRNRFIREAEMIIFSITGIAIII
FT                   SIGIAYMLNIMGFNKTMNLVYNLDLFFTLANPALPTYLKLGAQLCYRKLIKKNIYCNNL
FT                   SKIHLAGRVDTAVFDKTGTLTCEGLDLLCIDDLEEAVDDVEKVSILTRIGLSTCHLVYE
FT                   LDGRYSGDTLDLKMFIFSSSKLVQNENTRSVVIGGDSKIYGPILKEYNDSEEMVYYQKD
FT                   RIYGSKFAVGDTNTYEEDKDFSSVVLDTDEVNRYGLNNCTEEVKGDKINAVIMKTYEFD
FT                   SNIRRMSVVVDDGSKRYVFTKGSPESIQKILKSSPKEYEEKVKGYSLAGYRVISLAYKE
FT                   ISKSIDRATDESEMMFLALIVFSNKLKENSRRTIEELNEAGIRSIMCTGDNILTAISVG
FT                   KECKIVEGFVPVIFPVIEENAKSIFDVDWLCVGDEEEFTFDKVRLSLYRGNDRVSNNEF
FT                   VVACEGREFDFFRNTHYFQFILEKGAIFARFNPGQKKALIENLRAIGKITMFCGDGAND
FT                   SGALSSANVGLALAQNEASLAANFTSSDIGSVLDLIKEGRSAFVTSTATFKYVVSSCVI
FT                   GYVGLLFLLFKRNFLSDLQTMHTELFVSVPVAYMLTCFNTSDKLYPRRPDIFPLSKKDF
FT                   IPFWLTIAFESLTLLVLSRYGESSPVMNDQSIASELVFFAMTFIYILNGLYLSDCSPHR
FT                   QELRDNLLFKSFTCLSLLVTMGLLMTVYLFPRWTSWWLSKYKFVETNGFEVGLVLISVL
FT                   LTTVVIFVVQPLIGGMLGGKKIGKSKAVDSEEKI"
FT   gene            complement(<167894..>168436)
FT                   /locus_tag="Eint_071490"
FT   mRNA            complement(<167894..>168436)
FT                   /locus_tag="Eint_071490"
FT                   /product="putative Ser/Thr protein phosphatase"
FT   CDS_pept        complement(167894..168436)
FT                   /codon_start=1
FT                   /gene_family="HOG000149341" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071490"
FT                   /product="putative Ser/Thr protein phosphatase"
FT                   /note="similar to ECU07_1520"
FT                   /db_xref="UniProtKB/TrEMBL:E0S874"
FT                   /protein_id="ADM11909.1"
FT                   /translation="MAIKSKKGYSCDIPMKSINSPRKNTLHARLNPRFSFRIASRVIHR
FT                   IVDPKKLKKTEYMTILDFLRLLREKTSNAKNPKWKRILLMFVISKSSVKIFLSKEIPTE
FT                   AASIQVIGIIDMLIVNATKKHRMQNNSLLRKIFPRKLPIAPRTPPYSELIPRSLSCTLE
FT                   SEAIMHNPTIIDKQKFL"
FT   gene            168645..168716
FT                   /locus_tag="Eint_071500"
FT   tRNA            168645..168716
FT                   /locus_tag="Eint_071500"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA Type: Ala, Anti Codon: AGC, Cove Score: 76.86;
FT                   similar to ECU07_1525"
FT   gene            <168840..>171377
FT                   /locus_tag="Eint_071510"
FT   mRNA            <168840..>171377
FT                   /locus_tag="Eint_071510"
FT                   /product="hypothetical protein"
FT   CDS_pept        168840..171377
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071510"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1530"
FT                   /db_xref="UniProtKB/TrEMBL:E0S875"
FT                   /protein_id="ADM11910.1"
FT                   /translation="MRINLLAMFMMPASNRRVFYVNLKDVKSGEDLLSQLFEKAHHLPD
FT                   GSSELLEKEDGSSTHLSNLAQEVQAKEGASGSTASSGQKAPAQQSESGKSAQKKQQSGG
FT                   QESKAQGSAKKEEQKQQKEDKQQKQQKKEEQKQQKEEKQKQQKQQKEEKQKQQKDDKQK
FT                   EQKQQKKEEQKQQKEEKQKQKEAGNQKEEKQKQKEQKKSEKEDGKKETKKADKESKETK
FT                   TAQDKGSKDKTSTQGKTSTDGGEKASTAKAEGKKASEKATSVKSSDAESKGAESKDKGS
FT                   ASSAPSSNASTSGSASIASSSGSSLSGAASSNVSSAVSSRLSSSAIQSSSAGYSSSIPL
FT                   LSIMSSSMLSSAISSSVLSSAMSSSMLSSAISSSVLSSAMLSSMLSSSMPVSSMLSSAS
FT                   HSSIADVLKKASEINKVKNLSSVDVNDMLGKCQECERVDQVLVYKEGSQYSDYSGNINF
FT                   QEKDGKLVDSSGLFVGKDCGCSKEEIPQIGKITGTGLYQDQSVNSMSCQKQANAIDKLY
FT                   SSASNMALNSGVSGSKTVSAGASQAGGAASGASKAASASAGVSQAGGAASGASKAASAS
FT                   AGSSQAGGAGGGASKAASASQAGNSQGTQSIQPSSFQSGASGNLAQETGSKPQISSLPT
FT                   QNNAEESPGVSVAQSIESRPEDFSYIPPKISIKAVKVKYGDTCGDNSGLVVNTTLTQEL
FT                   PPEKTVTLPPKTVTKTEKVELPPTTIIKELTIIEPPCTVEKEEVIVQGSENIDEERTVT
FT                   HSTTVVEYKTVKVTATRTILQTTSPRDVEVPISTISFETIDGINGERPREDITTINTTI
FT                   VVEEPEDIECEQECECYEDNCENPCDRIKCVSG"
FT   gene            <171556..>173109
FT                   /locus_tag="Eint_071520"
FT   mRNA            <171556..>173109
FT                   /locus_tag="Eint_071520"
FT                   /product="hypothetical protein"
FT   CDS_pept        171556..173109
FT                   /codon_start=1
FT                   /gene_family="HOG000149951" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1550"
FT                   /db_xref="UniProtKB/TrEMBL:E0S876"
FT                   /protein_id="ADM11911.1"
FT                   /translation="MILALLLLGHIIRADIFDGVNLEKVLSEGLKGGGSGKSGPDSASL
FT                   SLSSKKEGMSSASSPASFSSSIPSMSQASSSTVASVKKSGEEMPIVIITQESPKDKGKG
FT                   KGGKEQEEEIASIVKNAIKGTKSNGLSTEKREEEDGQGESNYEEFKEESDKSKRKDKPS
FT                   MINNSFSPMMAKAVGNSSDLDSYWTTVIVDNKLKKVKVNVKVMTVVESIGEAAPCSKDG
FT                   DVKEKSKFWSKPGESSKSREIPSTVSVAYKKDEMKTSQDSKSSSKSNSDEKTKKTAEAS
FT                   RSVEPEIIPSVISSGKGTESKKESETLSASKPLSSSISLSVSASRKSNDSESASSKYRK
FT                   SAESVKTSTTSTKEKSSSKETESKSTPGISTKEDSKKGNSSTVMSKSQSLAKTFSSIAT
FT                   VSPSVKSKKKSSSSQGSASKESSSTVSIGQKKSKEMTKDAKSISVSKSEKEDKAESGKK
FT                   EVNPEMNELFYVLKNMPGKVNISKSGGKMFVEGNFVAPKEEKLKDKKFQFSGYIQAAHA
FT                   "
FT   gene            <173248..>174189
FT                   /locus_tag="Eint_071530"
FT   mRNA            <173248..>174189
FT                   /locus_tag="Eint_071530"
FT                   /product="hypothetical protein"
FT   CDS_pept        173248..174189
FT                   /codon_start=1
FT                   /gene_family="HOG000149950" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071530"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1560"
FT                   /db_xref="UniProtKB/TrEMBL:E0S877"
FT                   /protein_id="ADM11912.1"
FT                   /translation="MRAPNRIGTIRALCLLGIYSHSVALCQEDESTVEIVLLSNGTEKT
FT                   RPREDDKNDINTEDKSKALRSLLTTLVSHLMAGNKFQNSLLKSYDGGDRSDSPKESGDR
FT                   QTASPSQNSKANKSPAQEPTTEMLEKIKRVPMGYRTFCSFLQNLDLIRDKLKNKPGTRR
FT                   IRNVLVYEGYHLTDYWGRLKFRKEGDKLIDETGYFEGVKVNTFEDIIKEGKMTKTGFIQ
FT                   KKEIGETEVNENLITMKLLLNEIAKEKNTSIHGVINEGCNMSIVEELVFYGNSPSAHND
FT                   EIVHVCICSDSFCKEPCKDIVPMKMEELEFRG"
FT   gene            complement(<174238..>176178)
FT                   /locus_tag="Eint_071540"
FT   mRNA            complement(<174238..>176178)
FT                   /locus_tag="Eint_071540"
FT                   /product="threonyl-tRNA synthetase"
FT   CDS_pept        complement(174238..176178)
FT                   /codon_start=1
FT                   /gene_family="HOG000003878" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071540"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="similar to ECU07_1570"
FT                   /db_xref="GOA:E0S878"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:E0S878"
FT                   /protein_id="ADM11913.1"
FT                   /translation="MYEVKLKVKFENRVLEVSQGMTPYDILSEYCKDRKDVISCKINGI
FT                   YSDMVVEIPGDCELEFLTFEDNGAREIFWHSSAHILGNALVNLYPDAKLVHGPPTEEGF
FT                   FYDVDIKDSISSEDYQKIEMEMLKIMKKNYRFEKVIKSKEELLNAYKDNPCKTHFIKKG
FT                   VDKESSVYRNGDFFDMCLGPHVLSTGVVKAVKVLKNSSAYFLNDPSLKSLQRIYAITFP
FT                   SKEMLQEYLKRKEEAMERDHRKIGTELDLFFFSKYSPGSCFFLPNGAIMYNTLIEFLRE
FT                   EYRKRGFKEVITPNIFCTKLWEESGHLQNYKENMFLIEGDNFALKPMNCPGHCVMFKHQ
FT                   DHSFRDLPLRLADFGVLHRNELSGTLTGLTRVRRFQQDDAHIFCTRDQVKGEIKGCLEF
FT                   LSFVYGVFGFKFELVLSTRPEKYLGSIDEWNNAEKVLAEAMDESGMSFKINEGDGAFYG
FT                   PKIDITLHDALGRKIQCATIQLDFQLPQRFELKYRDSDGQCKTPVIIHRAILGSIERMI
FT                   AIILESFGKKLPFWISPRQIAIINMGNLDYVEKIKSVLSKFRLDVIDDGNTMNKRIRTA
FT                   ETCGYSLVCVVGEKEAKTDEINIRLSKSGKGGKSNENIGLYELRDILDRMVDEKIELED
FT                   ILPIDKIAINN"
FT   gene            complement(<176180..>177388)
FT                   /locus_tag="Eint_071550"
FT   mRNA            complement(<176180..>177388)
FT                   /locus_tag="Eint_071550"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(176180..177388)
FT                   /codon_start=1
FT                   /gene_family="HOG000149949" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071550"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1580"
FT                   /db_xref="UniProtKB/TrEMBL:E0S879"
FT                   /protein_id="ADM11914.1"
FT                   /translation="MNILRNEVKRAEGYPLSIKEILERSPDAAGFINLYLKRNPNKRHL
FT                   EFLDFYDDLDVSSQVLLYEDKKKMIRSDQFEEECLMKYCIGQKSELSYGIIKTVGNGEI
FT                   LFRVLGMSFLSTILDEEDDFFFTRCIVLALKTHNIDSNGMSLLITGIGNHFSDGRRKYY
FT                   EHGAIVASVLLNTCEFGVETMGETQRMIDDMPDSVMRKEKRENFSNPNDVFNSYRKVEN
FT                   NLSVLETNWKPKYLQEALKVISDEKDAGKVEMSFKCFPDLVQSSTERTLRHKSKEAFGV
FT                   LMNYDGCEEYKVDAISSLLQKSSKFIIDDVIDDFFNGRLCLKHKIILTFAFRKIIKEGS
FT                   YDQAVSLHRSIRFMFERTRNEMPKVIGRALECFVLEGIKRTGEELGRTLGPEIGFLKYQ
FT                   AYP"
FT   gene            complement(<177467..>180331)
FT                   /locus_tag="Eint_071560"
FT   mRNA            complement(<177467..>180331)
FT                   /locus_tag="Eint_071560"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(177467..180331)
FT                   /codon_start=1
FT                   /gene_family="HOG000149947" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071560"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1590"
FT                   /db_xref="UniProtKB/TrEMBL:E0S880"
FT                   /protein_id="ADM11915.1"
FT                   /translation="MLATQLFLRCFLIAGYVIAQTMILQASEGNPVPGISCNCRSDDQR
FT                   CRDSCFKVYNPENKGTKILGTVEVKSPPAMTIKKILQREERPFIKFVKKNIEKNTNNMT
FT                   LEKDDSIPRKPVQKIFDGDDNTIVYNGSTYRICDLHSWAIRNYGTKERLGMGDDIKALY
FT                   EYVLGNPRIEKICGKNSSEYPIGYQNSTDPLLISSRIPADHPEPIILEKNNLVPVFIKE
FT                   SFDFVPDSEGQNGGSGTPFRDSSRSVSVVTLKTTSVTTTTTTTTTKIRDQERIEPIKKT
FT                   KTQTILITRTITRQWSSLHRESGDDVKTVLKTVFVENSKNRRSKMELMENQELDTVLST
FT                   NPRKSSEKTAFGEVGNSSAYIEILEKIKSLLSIQGSSPINTSSSTSVTASKPRTSVDPQ
FT                   TITTTVERTRTTTASRLPSVDSYVKEAGGSFYDDHTKELIRSIFDMLKGGNSTAFTKRL
FT                   SSSTSRNTITKETTTTITKTSTKVKDYTIVNSAVPPVETKGPYILSISSFKKEEVPSIY
FT                   IYEDYAKKMDNLYQRIVANEEQYKNLMNTILSIRKKERDEDDSFELLKKLYEVYKDDSS
FT                   YEKSIASRLMSEKRLKLGPMPYTTGLDKRWKDNAYEIENASGNLGTPNRKDTIEEISSL
FT                   SYNQDGMAGGSGEESGNDNEIDPILSPISDFGPLNEKNHKEHSLPSVATLFKEFSSKEK
FT                   TNSRNKFMKEKTSIEKEDGIVTKPTNPKSYKYEILTLSRNGRKDIEYKTVTDTVRTTVI
FT                   REFDSSMHLSAVNSVVKDHVKRLEEKLNEFSSKVAHIGNELLSLKAAETRKSFAKEDGS
FT                   SLGRISSVVSKSAIYSGNNVSTKTVEPSEVFSSTTNIESSTTQKPLLESDLEEETTTFY
FT                   SSSTSSAYPQTMSVGEKSKSREIDRIVEKIKEKKIPNESMLVSDDEVIGDIVQKLGPLV
FT                   SDIEIVSLSTAARSREGTPLQSVV"
FT   gene            <180563..>181804
FT                   /locus_tag="Eint_071570"
FT   mRNA            <180563..>181804
FT                   /locus_tag="Eint_071570"
FT                   /product="hypothetical protein"
FT   CDS_pept        180563..181804
FT                   /codon_start=1
FT                   /gene_family="HOG000149946" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071570"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1600"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:E0S881"
FT                   /protein_id="ADM11916.1"
FT                   /translation="MFIYIIMRCALLFFLLKYVFSSVETASSDPKKGVMESPNQEISYR
FT                   PGGSNEKVGVKGTQVESDGLSLRRHTDEGGLVVFLAPNPYEEWSFSYTFTNAKLRFPHI
FT                   GGVYLWYTSEIQDQGSYRGGHDLFEGIMAGLEFRGSQPEIVMAINDGKTSLVGSEEMTL
FT                   YRDTVNPERLKGVKDITVKVISTHKNFKVELYDGDRLLYDSFRYYRKGTLAGIGSGKYF
FT                   NITSFYDKAPSDSVYKLKEAQLFERTETSDYEVHSIHAPSVDKTPRSPDGIMHEDEEVR
FT                   HLISKIEYLNEYLHLVVGEPHNSSFDKVVHILSEQLKAFTKKFEDTITPIRSVGGSETK
FT                   LMNLNEKMNGIDIKLQKIQKAFADLDHVVGSLKNDYSRSSNFLVYIILGVGAVGLGLMA
FT                   MKEYNALKFRQKAL"
FT   gene            <181868..>182893
FT                   /locus_tag="Eint_071580"
FT   mRNA            <181868..>182893
FT                   /locus_tag="Eint_071580"
FT                   /product="tRNA-dihydrouridine synthase"
FT   CDS_pept        181868..182893
FT                   /codon_start=1
FT                   /gene_family="HOG000203649" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071580"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="similar to ECU07_1610"
FT                   /db_xref="GOA:E0S882"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniProtKB/TrEMBL:E0S882"
FT                   /protein_id="ADM11917.1"
FT                   /translation="MRRFWEEIQKPYLAVAPMVGNSEEAWRRLSKRHGANLFYTEMVHC
FT                   ESFLRGSRNPVKNRWYTTSESDRPLVIQICGNSPKTMLEAALIMQNHCDAIDINFGCPQ
FT                   KVARKGGYGAYLQENWDLTERIVKVLSTGLNVPVSCKIRVFESIEKTVEYAKMIEKAGC
FT                   SLLAVHGRTRDQKGPAMGLASWDHIKAVKENLKIPVLSNGNIMTHEDVWKCLEYTKCDG
FT                   VMVGEAHLYNPLIFTGENKSCLEIIREYLDICMESPGCAETGHIKSHMFKLLHSYFTIN
FT                   PEKQPDLDSCSTIDQFYNLYLNLVKEAESAVSKEVYLSIYKMAPLSISGASIHENNSKN
FT                   K"
FT   gene            <182927..>183511
FT                   /locus_tag="Eint_071590"
FT   mRNA            <182927..>183511
FT                   /locus_tag="Eint_071590"
FT                   /product="putative vesicular transport protein"
FT   CDS_pept        182927..183511
FT                   /codon_start=1
FT                   /gene_family="HOG000149340" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071590"
FT                   /product="putative vesicular transport protein"
FT                   /note="similar to ECU07_1620"
FT                   /db_xref="UniProtKB/TrEMBL:E0S883"
FT                   /protein_id="ADM11918.1"
FT                   /translation="MLEEDIIALIEEEKAIEEDLKACEESLENIGALAIRIQSFSRSVS
FT                   SLETNNPEVERLSKQADLFNKSILRLGSQRSKKRNEEKEEMARSNINVDREYMENTSVP
FT                   QPVSDDDFFSSSTKRINDVLMNAMDAFETVKRQNIYINRTSERIKTALERIGLSKQLVD
FT                   QIDKRYLSDRVLFMGGIVLLVIMFFLLRFFL"
FT   gene            complement(<183567..>184286)
FT                   /locus_tag="Eint_071600"
FT   mRNA            complement(<183567..>184286)
FT                   /locus_tag="Eint_071600"
FT                   /product="mRNA decapping enzyme 2"
FT   CDS_pept        complement(183567..184286)
FT                   /codon_start=1
FT                   /gene_family="HOG000149945" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071600"
FT                   /product="mRNA decapping enzyme 2"
FT                   /note="similar to ECU07_1630"
FT                   /db_xref="GOA:E0S884"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR007722"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E0S884"
FT                   /protein_id="ADM11919.1"
FT                   /translation="MISPDILDSIASRFLLGLEDQEKNAVERLFFAVEEAHWFLIDNYK
FT                   ILDTSFGDFSRQLLDHVGIKVNIEEALKSFVRYRQSVKVYGAILVDSNISHVLAVKEKK
FT                   KTKNYSFPKGKKCMDEDGTSCAIREVYEETGYDVQNKICNLPITIFDKITLYFVFNVRP
FT                   SFPFEAQTRKEIEEIKWLSIKKLTKGEYRRGYSIVSAAFKRASYLLEAMRKSRFRFNTK
FT                   RITQRIDRLVGQKKTQE"
FT   gene            <184331..>185605
FT                   /locus_tag="Eint_071610"
FT   mRNA            <184331..>185605
FT                   /locus_tag="Eint_071610"
FT                   /product="26S proteasome regulatory subunit 4"
FT   CDS_pept        184331..185605
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071610"
FT                   /product="26S proteasome regulatory subunit 4"
FT                   /note="similar to ECU07_1640"
FT                   /db_xref="GOA:E0S885"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:E0S885"
FT                   /protein_id="ADM11920.1"
FT                   /translation="MSRDKSEQDNLQDTTTINLKRRKRVKESKAASKPPQVYPQMKCKL
FT                   RYLKLKKLAHLLSLEDSILSLCEPDKSSEGSNSQKHVVEQLRGSPLSVGTLEEFIDDHH
FT                   GIITTGVGLEYYVNIMSFVDKDLLEPGCTVLLNYKDNSVVGVLEGEMDPMVNVMKLEKA
FT                   PSETYADIGGLEEQIQEIKESVELPLINPELYQEMGIKPPKGVILYGLPGTGKTLLAKA
FT                   VANQTSATFLRVVGTELIQEYLGEGPKLVRELFRVADMHAPSIIFIDEIDAIGGRRYNT
FT                   SSGGRREVQRTMLELLNQLDGFDTRNDIKVIMATNKIEALDPALIRPGRIDRKIEFGMP
FT                   DAATKKKIFDIHTSRMTLDESVNIESLITSKEDLSGADIKAICTEAGMIALRERRKTVT
FT                   MKDFISAREKVFFSKQKMVSAGLYS"
FT   gene            complement(<185893..>186354)
FT                   /locus_tag="Eint_071620"
FT   mRNA            complement(<185893..>186354)
FT                   /locus_tag="Eint_071620"
FT                   /product="putative ribonuclease-like protein"
FT   CDS_pept        complement(185893..186354)
FT                   /codon_start=1
FT                   /gene_family="HOG000149944" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071620"
FT                   /product="putative ribonuclease-like protein"
FT                   /note="similar to ECU07_1650"
FT                   /db_xref="GOA:E0S886"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="UniProtKB/TrEMBL:E0S886"
FT                   /protein_id="ADM11921.1"
FT                   /translation="MFSVEDHYGSYMRKETIRALSQRFSLANKSVKTSKRKQTAGIPSV
FT                   ERQKIRYKDFVEISKKFTEYLSELKGGMSPSTFVNKMYMCELTGAKIKVVGGTHGIIVE
FT                   ERANSIVVVLENNSVKTYLKGTTDFIIPHNGIEYIFIGSKMKANRFIKK"
FT   gene            <186737..>188164
FT                   /locus_tag="Eint_071630"
FT   mRNA            <186737..>188164
FT                   /locus_tag="Eint_071630"
FT                   /product="phenylalanyl-tRNA synthetase subunit beta"
FT   CDS_pept        186737..188164
FT                   /codon_start=1
FT                   /gene_family="HOG000230294" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071630"
FT                   /product="phenylalanyl-tRNA synthetase subunit beta"
FT                   /note="similar to ECU07_1660"
FT                   /db_xref="GOA:E0S887"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:E0S887"
FT                   /protein_id="ADM11922.1"
FT                   /translation="MVPITQRIVEALKVQDEVRSSDIEGLYSEVHGALISLESKGICNL
FT                   RKEESYEEVLTSEGEKIEKNGSQEYLLFQSIGEDGISTDKLSGHEVGKMNAFKNKWIRK
FT                   EGDKIFRNREDVEDMVRNMVLSMKKGTASAEEIELLRKRKLVAVKKNITFIVTKGPMFF
FT                   DSTSYAAELTSEMILDGTYKNLSFKHYNFNTTGNIPRCGSIHPLMKIKEDFKRIFIELG
FT                   FSEMSTNQYVESSFWNFDALFQPQNHPSRDAHDTFFLSDPELSSRFPENYLEEVKETHC
FT                   GGRHGSLGYMNSWDIKEAQKNILRTHTTSVSARNLYQLAKKEFKPVKLFSIDKVFRNES
FT                   VDATHLAEFHQVEGLIAGKGLNITHLMGILQEFFNRLGMSDIRFKPAFNPYTEPSMEVF
FT                   GYHKGMNRWMEVGNSGMFRPEMLGPMGFDPDINVIAWGLSLERPAMIKYGLKNIRELVG
FT                   HKVDIEFSRKSKICFFD"
FT   gene            <188203..>191010
FT                   /locus_tag="Eint_071640"
FT   mRNA            <188203..>191010
FT                   /locus_tag="Eint_071640"
FT                   /product="hypothetical protein"
FT   CDS_pept        188203..191010
FT                   /codon_start=1
FT                   /gene_family="HOG000149943" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071640"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1670"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="UniProtKB/TrEMBL:E0S888"
FT                   /protein_id="ADM11923.1"
FT                   /translation="MFYLSRAVVNMDLYMKVLCNSSDIYLVQSSSIAIYTIKHGKLIYV
FT                   RKTEFFDVIKSAVIIGNELLVVFNGYIVFLDRFLDERTRYRLGRSSVDYRHVGAYIACG
FT                   KSSICLTSFFGNMTFCTLGSGLESPIEYSADKSVIIDFKSVEGTGQYISLEKNPKGTFA
FT                   KIYEHSPEIIEVLREISVPGGYMIVPLKDRFAVFSTNRVFLFRRNEEVEIYKVSKGRVG
FT                   SLDLALDEGNGECRCSDTLEEKMFTCYTSYCDEKCLLTLIVDEDGELFNLNTTYGLKME
FT                   HVGKINPSKDIAIHSSGLLVSIGYNSDNCIYYIERKEGKISLKLVAMIETIRRFNTSTM
FT                   VFDGVYHTYVSDGKYIGEIVEKTPISFRSELNLFENGKEKIVRGLFNCGAFVCAQYEDE
FT                   VHCLYLEGEELTSIYKFVSDDEIIGYFRLGRIDFYMSGGLVRAYEMNGEGELDTKEYKI
FT                   DYTSFSSNSHCIFLGQRNKIIKLGSEGLETIEIEFAIKEMESDERYLFILTGKRVLRVY
FT                   SIDGRKFVFIQSFRFDVIFLSVFDGYLYTIGSDIYKFQIKEDGSLSLPIRMKEAGRPIG
FT                   KKERLIIFDSQVMDLKYEGILNIDGWKSIFSRDMILASNEHGIKVYEYRKHKVVLVDEI
FT                   SKEKDCKILGKEQMYIDNNLDGFVIRRFNGSSVIEGHGEAIGFSSSEYQIVSMRRIIPG
FT                   LEKPESKCFLKIYKEGSFMYDFETPYRIDITYTSRGEVYCSEENRLYCYEVGVKSLLRK
FT                   FKLKFPSKISGICSDRDKLFVGTEKDSVFMVKDRRIVCRDKFPRRVVALERMNDGNLVV
FT                   GDWAGNIIVMEVKDDSLISGASIFVNDMVVQFISQDKVFGICMSGKVVEIVEIGEELFE
FT                   FLETIGEKITEALNRPFFQAFRRNRFINSEYIKEFSKLSEQQIKEVLEKTNVDIEKIFE
FT                   VVNAI"
FT   gene            <191055..>191600
FT                   /locus_tag="Eint_071650"
FT   mRNA            <191055..>191600
FT                   /locus_tag="Eint_071650"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT   CDS_pept        191055..191600
FT                   /codon_start=1
FT                   /gene_family="HOG000078523" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071650"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="similar to ECU07_1680"
FT                   /db_xref="GOA:E0S889"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0S889"
FT                   /protein_id="ADM11924.1"
FT                   /translation="MYKAEPMLPSDVFSLDWVNLDEKSESFPLSYYLYYLINHGEDCIV
FT                   IPSLEERVTSFAYKRVSYAYMIGKLEEKDRVICIHISAVSVAPSFRRNCFGKLCMDIAE
FT                   ESGNVYNAHFSDLYVREGNRIAIEFYKKLGYVVYRKVFDYYIDGGGEDALDMRKSLKAD
FT                   KGKIYMARGTDIPASELK"
FT   gene            complement(<191699..>194329)
FT                   /locus_tag="Eint_071660"
FT   mRNA            complement(<191699..>194329)
FT                   /locus_tag="Eint_071660"
FT                   /product="transcriptional accessory protein"
FT   CDS_pept        complement(191699..194329)
FT                   /codon_start=1
FT                   /gene_family="HOG000149339" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071660"
FT                   /product="transcriptional accessory protein"
FT                   /note="similar to ECU07_1690"
FT                   /db_xref="GOA:E0S890"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="UniProtKB/TrEMBL:E0S890"
FT                   /protein_id="ADM11925.1"
FT                   /translation="MNDSSSEEMININRRGNQTVRKRILEDLFEEDQHEASSESISSID
FT                   YEDRNSLFYEIFGTGDEYRYILEDENSESTEETNSGNVNALEYDPIDLDGVCEYAMNNM
FT                   EIKPESLRKVIELLGKGYSIHFVLLHNGIEGISIEEGYKIVDIFDEYKEFANSKKRVEE
FT                   RYGSDPLFQSIKDIRALRWYYGYKKHLGKNLDLPGELLSAEEFCENIRTKKKIHEPLDS
FT                   SSFPRFEEEGELIQRISLHPIFRSALEVIFKSYGVRNERNELEVRDEIIKRDLIDFYLS
FT                   DISSEDPWNRYRESIVRSSVEKVSKEVVIPSILKKMEAEAMKKEIFLETIDRIVNGSIG
FT                   IKGDGTYVCGVTKEKKYLKAVAVDFEGDLVDSITVKEDEENELLGFIEKFNPCCIAVSG
FT                   FTTSIRYLMKTLSSWNPLYVEGRIAQMKSQDTYSFCCNIARIIQCPEIEYSDMLNKNII
FT                   YIQGLLPRNVIIETIKRGILTAISVVGVDANYLLNNKRKEGLISLIPVSNASKNNLFSL
FT                   KNVAKLEDLKSLCENEVEYDNLTTYLRIYPGVFSGVSGGEPLDSTPVHPKNYSVARKLC
FT                   GNTWKRELDNEKASAPSIPECSDPLAMDVYRALEDGERPIYSGFPDHLIFEELTGSNGS
FT                   LVGKVIEGRISKCGNTYYLVSSDSTPASIYVRKTKGQEEFFLNQLVTVKIEYMNDYLLS
FT                   YTASFTISGPKKPHHSRFMTHPLFKDLNSEESEKYLKKNSSSILLRRSRKDGTPVVVLR
FT                   VTDSIYVHIKIQEAEKYYYKGNSYDDLDELISRVAKKMLTNVKNIKNHKYYFEDEEKLL
FT                   DYLNQGGSYIRYGFFFSEKYPGKLCMMYRNGRNYKEYITVDDNLVYEGKSFENLDEFIK
FT                   YRKSL"
FT   gene            complement(<194427..>195155)
FT                   /locus_tag="Eint_071670"
FT   mRNA            complement(<194427..>195155)
FT                   /locus_tag="Eint_071670"
FT                   /product="40S ribosomal protein S2"
FT   CDS_pept        complement(194427..195155)
FT                   /codon_start=1
FT                   /gene_family="HOG000072596" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071670"
FT                   /product="40S ribosomal protein S2"
FT                   /note="similar to ECU07_1700"
FT                   /db_xref="GOA:E0S891"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0S891"
FT                   /protein_id="ADM11926.1"
FT                   /translation="MEHTEKRNTGRPFPKREENEWVPKTAVGRLVKMFKITSLDQIFKF
FT                   SHVIREPEIVDMLCGNSIKEEVLSIKSVQKQTRAGQKTRIKAVVVVGDGNGHVGLGTKA
FT                   SKEAASAIRGAISRAKCAIRPVRLGLWDGAQGKPHTVSCKGSGKCGTSIVRVVPAPRGT
FT                   GIVSGGINKKIFELAGIKDLYTISSGATSTTENFAKASIAALEATSSMILPDQWEEKPR
FT                   TLNPLLEFADILNQLDKSRI"
FT   gene            <195497..>196090
FT                   /locus_tag="Eint_071680"
FT   mRNA            <195497..>196090
FT                   /locus_tag="Eint_071680"
FT                   /product="hypothetical protein"
FT   CDS_pept        195497..196090
FT                   /codon_start=1
FT                   /gene_family="HOG000149942" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071680"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1710"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="UniProtKB/TrEMBL:E0S892"
FT                   /protein_id="ADM11927.1"
FT                   /translation="MVSSSKWKRPNFSLLDAKDPTNELINKKILLYRWISPEHLELKNT
FT                   ERSVLEDISREFRGITSLQTPTEKITHMMGIMEKLCDVVGRTEGQDIILPSIIYCIIKS
FT                   SLPNIYLEVRFMALYRRKSMEKCKERCNHGFSIDASCECFSSRPYDEKEVNYYLTSMQA
FT                   AVEFIRKMEFYDLKISEGEFYENMMDAVKLVKDI"
FT   gene            <196126..>196587
FT                   /locus_tag="Eint_071690"
FT   mRNA            <196126..>196587
FT                   /locus_tag="Eint_071690"
FT                   /product="putative RNA-binding protein"
FT   CDS_pept        196126..196587
FT                   /codon_start=1
FT                   /gene_family="HOG000149941" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071690"
FT                   /product="putative RNA-binding protein"
FT                   /note="similar to ECU07_1720"
FT                   /db_xref="GOA:E0S893"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S893"
FT                   /protein_id="ADM11928.1"
FT                   /translation="MKERILNGLHKLFITNIPRKARRQLVYELLTQVSKIGHLYYNQDR
FT                   GYCFVDYETYEELEYTYNVLRGVKLYGKRLYFSKVEKQVRIVVRNIGQEVDGVFLWDVF
FT                   SKFGPCHIEMNEGGLGVVIYRREDSAIKAVEVVNGKVIGGSEVSVEIDK"
FT   gene            complement(<196632..>198965)
FT                   /locus_tag="Eint_071700"
FT   mRNA            complement(<196632..>198965)
FT                   /locus_tag="Eint_071700"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(196632..198965)
FT                   /codon_start=1
FT                   /gene_family="HOG000149940" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071700"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1730"
FT                   /db_xref="UniProtKB/TrEMBL:E0S894"
FT                   /protein_id="ADM11929.1"
FT                   /translation="MLSQEERKQIIFKLFIALKESNIFPGYTPVQIKEAAIRAEQRIYE
FT                   ESNSEEEYLRGMNERFQRIERVVSNRSRNDGRGKATQEQVGPYTCTKDQEFGSISGEPL
FT                   ASAKQNYSYGNPNFERGERRLSEQLFTENKQLFGKQDGFVPPEIMRISRKHDLYESDGI
FT                   SRFNDRGMESSTRGRSNSCNIQNSHHESDHIVNEESFSNSPGNPMFFRRSQPEVDPYGL
FT                   NSRKNFQNTPDQRPFFMQREGQHQEVPSQPFGYVNQGFGTRFGHYDYGREVPKDENMSK
FT                   PSIDMNFDEMQQGKSPGVAPFNGRGFVPLQNPRQFNRNSSSSYSNPRSMNMFQFSGKPM
FT                   YGNQRPFASPSHSIPSHKYPSRMPDMQSFPMASSSEIMDSFPHSDPQDRSMNMFPMGPP
FT                   QTKTSAGWMDNSLAFNRHYPNTGKETTKPLPIFFNQQMHHQPYFHAPRNPEQTGPTTDG
FT                   KQAFLSTQNFNQWIFGSADEDPRIPYEEFLRRHENTKKNIEYFPNTKKEERGFSVNTGE
FT                   YRGYSSPAPWFQSGFRNFFPEGGFPYSSDAASSQRRMGNSPWFKDGILHARAPGPTLAE
FT                   NQPENSREAYNVYETEKDINYNSKDSEIQHRIGSREAPQEEGHISAPIQYSDFPSEVNS
FT                   FFKENEMEKISLDYQELLDLKSRLKEGAGVLEKSQKIYNAFKESFPNSELLQKYEVIKN
FT                   LFEKQEEYLKYGAYFLKARSADNFIDQIKSLTVDMSHDLKSITMKTGDINYGECLMNAV
FT                   KAFSERKKKEEAFGLNVVNEDAYE"
FT   gene            complement(<199170..>199793)
FT                   /locus_tag="Eint_071710"
FT   mRNA            complement(<199170..>199793)
FT                   /locus_tag="Eint_071710"
FT                   /product="MADS domain-containing protein"
FT   CDS_pept        complement(199170..199793)
FT                   /codon_start=1
FT                   /gene_family="HOG000149939" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071710"
FT                   /product="MADS domain-containing protein"
FT                   /note="similar to ECU07_1740"
FT                   /db_xref="GOA:E0S895"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniProtKB/TrEMBL:E0S895"
FT                   /protein_id="ADM11930.1"
FT                   /translation="MDENRKYGKKEETRNPQIRGETEYNLPPYGINENVPEGFTYPHWM
FT                   PQNMNYAFDQQYNYYSHVPQFHNTGMIPQGFVQDQTHPIMFEKPRGKSHGKKKIKLEYI
FT                   SGKNKRSVCFSKRKRGIMKKAYELNILTGTEILLLVASESGHVFTFATDKLKPIITEHE
FT                   DIIQNCLNRPEGMPYKPNFPKERPNPEDKGYPKAEAPNEFRERQ"
FT   gene            complement(<200058..>200525)
FT                   /locus_tag="Eint_071720"
FT   mRNA            complement(<200058..>200525)
FT                   /locus_tag="Eint_071720"
FT                   /product="DNA-directed RNA polymerase II subunit E'"
FT   CDS_pept        complement(200058..200525)
FT                   /codon_start=1
FT                   /gene_family="HOG000158201" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071720"
FT                   /product="DNA-directed RNA polymerase II subunit E'"
FT                   /note="similar to ECU07_1750"
FT                   /db_xref="GOA:E0S896"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E0S896"
FT                   /protein_id="ADM11931.1"
FT                   /translation="MFFVRDFTQNIHLSPSYLGPNIQTLIEEYLLSKVEGSCSSSGYVI
FT                   MVLSIDEISESRIILTGETIFTVKYKALTLKPLKGEIVDANVVETNKMGVFASVGPLTV
FT                   FISNHQIPNFLLENEITKDVMIRLKIIGTKIDSTKIYAVGTLNDDSLGIIC"
FT   gene            complement(<200637..>201248)
FT                   /locus_tag="Eint_071730"
FT   mRNA            complement(<200637..>201248)
FT                   /locus_tag="Eint_071730"
FT                   /product="glucosamine phosphate N-acetyltransferase"
FT   CDS_pept        complement(200637..201248)
FT                   /codon_start=1
FT                   /gene_family="HOG000106325" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071730"
FT                   /product="glucosamine phosphate N-acetyltransferase"
FT                   /note="similar to ECU07_1760"
FT                   /db_xref="GOA:E0S897"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0S897"
FT                   /protein_id="ADM11932.1"
FT                   /translation="MRKRDQVLCTIGCIGTLIVVLVLSDSLFGKGDLGNSNSNVISSGS
FT                   PSLSMCDIPILKRENYILKGLDINDYERGFVECLNELTIPGKVTKEQFKERYLSLCKDG
FT                   CYKIVVAYNPHKDKIIGSGTLFVEKKFIRGCVSKGHIEDVVVSSEYRGEGIGKDIVEKL
FT                   IEISKNMGCYKTALVCDLKNLEFYRRCGMKEKEREMVIYH"
FT   gene            <201341..>201754
FT                   /locus_tag="Eint_071740"
FT   mRNA            <201341..>201754
FT                   /locus_tag="Eint_071740"
FT                   /product="hypothetical protein"
FT   CDS_pept        201341..201754
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071740"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1770"
FT                   /db_xref="UniProtKB/TrEMBL:E0S898"
FT                   /protein_id="ADM11933.1"
FT                   /translation="MKFLQLFVMIATILLIVLIIVASEMLWQKRNDLKKEDLQKNDGKK
FT                   IPKIKEENAARVIFRIIAGIALIKIIKNFFFQKKDGEGKPKPQDKGLTPSAPPLPYPYY
FT                   PGEYYHHTLQSNFPPSSDYQDITKHPYINPSRT"
FT   gene            complement(<202214..>202720)
FT                   /locus_tag="Eint_071750"
FT   mRNA            complement(<202214..>202720)
FT                   /locus_tag="Eint_071750"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(202214..202720)
FT                   /codon_start=1
FT                   /gene_family="HOG000149938" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071750"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1780"
FT                   /db_xref="InterPro:IPR008591"
FT                   /db_xref="UniProtKB/TrEMBL:E0S899"
FT                   /protein_id="ADM11934.1"
FT                   /translation="MRSPTLNDLILAYQNEKSAKRLLPYASQVMNYFLDAVSRRTEGMK
FT                   SLDKSILKNIYELELERIKFFAKEYVKVRLKKLVTNLYEDRSFLSPREAVFYEKYISLL
FT                   KKRDIYVTEKKFYQTHEFVGFYCCADIHGIVIDGEMVEMFKGDFFVAPLDDVMDLLKKN
FT                   EIILF"
FT   gene            <202765..>203721
FT                   /locus_tag="Eint_071760"
FT   mRNA            <202765..>203721
FT                   /locus_tag="Eint_071760"
FT                   /product="hypothetical protein"
FT   CDS_pept        202765..203721
FT                   /codon_start=1
FT                   /gene_family="HOG000208845" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071760"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1790"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A0"
FT                   /protein_id="ADM11935.1"
FT                   /translation="MILVTHDGKFHLDEVMATAVLLKIYPDSEIIRTRNMSVMRSGDIV
FT                   YDVGGTFNPETNRYDHHQESFNETFSSKYKIKLSSSGLIYKYYGEKLLEKYGVTKTDEH
FT                   FQRLLEEIYATYFLSADAIDNGYEIFGEIVPRSLSHIVESFNVLNFSGGSNNEQDRRFL
FT                   EAVRFVSMDLDNFMHTIINGWMPNYKYLSELISKVDGDILCVDRYCFIDVIPEIERKYK
FT                   KDINFVLKKGESSVSILAVPKKRKHFESKIPLKKEWRGLSGGKLDAISGIEGCNFVHLS
FT                   GFVGSNKTIEGAIEMCKESIKAYLKEIKNADNLDKYL"
FT   gene            <203823..>204329
FT                   /locus_tag="Eint_071770"
FT   mRNA            <203823..>204329
FT                   /locus_tag="Eint_071770"
FT                   /product="hypothetical protein"
FT   CDS_pept        203823..204329
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071770"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A1"
FT                   /protein_id="ADM11936.1"
FT                   /translation="MENLNDEDIKLKSSLENTFKEIDQFFSDAGIIFSKSEHFNLVKEI
FT                   NATMNSFLGPRKEIYNRNVQTNAKNFLESAKEVAKAFKEVFNSLKKESIESFKEAYKKY
FT                   NRKVENSKNIYSELEKCLSEYGSHTSSACSGVSSSIPGKETSCKHLKSERANRALSQAL
FT                   SFKKK"
FT   gene            <204506..>205870
FT                   /locus_tag="Eint_071780"
FT   mRNA            <204506..>205870
FT                   /locus_tag="Eint_071780"
FT                   /product="hypothetical protein"
FT   CDS_pept        204506..205870
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_071780"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU07_1800"
FT                   /db_xref="InterPro:IPR012468"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A2"
FT                   /protein_id="ADM11937.1"
FT                   /translation="MSALDTGKMESYLKWKKDQVQLYDDILKENQEKIEVFLNNYREYL
FT                   RHKKEKRTSSVVREAFGVVESFQDVNSSYNRFLSLLKDHWKFWKDIFRHLRNNDDGNWL
FT                   SEVTGNEERISPTSDIETFLDTPVSQDLLFDPQKLEELFSGEESQVLEPIQSAIEFLNQ
FT                   IQHYDKDTTEIREYAQSIIRTDIYRVFVLKYLLRESPVPEFSLESSQQDALVSEILESD
FT                   YFLFFCLLVCSGLIALQSIFRKTSTSKETMNALGKISYAVSILGPILHGMWILSNENYS
FT                   EGIIKVISSNWNVIASMAPMFLVLRDIKYIKNGELMTSEGATAIGGHGVIVAMSMIMMC
FT                   AQTLGKKHEGEYSRQTMVFMAGNIIMTTMYGAKLFGPWTKSRNHFIILGYIVFALILFL
FT                   MVMMSEKKKIKNRTNDKTEWMGVLQWIIICTFLILGLQKPEFHCLQYAKNEIIVS"
XX
SQ   Sequence 205935 BP; 61439 A; 40835 C; 44319 G; 59342 T; 0 other;
     agaaactcct ccaactgccc ctaacagttc ttcttcctct tcttatttct tttcctctgc        60
     atcctgtctc ttttgaacca tagatcttat cgacatcttc ttaacccaac taccatcatt       120
     agttaggctt ccaacctcaa atgcctacac tgcgaatgaa agttctctat tcccaataaa       180
     ctccctaact ttccttatgt cttgagaatc cttcttcagg tcgctaagcc ttcttatatg       240
     tcatgctatc ggaaatccaa ttcctctttg aagttttgct ttcattatac aattcaattc       300
     cgtctatagt atttactctc ttaccctgta gtatgaaaat ggcttagaat ctttaaattg       360
     gggctctgtc ttgttaaggc cgagagatgg gaaattatcc atagtgtttt atcagctatc       420
     taaaatacat gtaagggatt tgaggcagta atgtattgta agacgattta attataggcc       480
     cttactccta gcgtactctc cgattttttc tttaagctct ttaacacttt cggagatttt       540
     taaaacttcg tttacctcct ttcctgtaaa agacgggcta ttaaagcagt caacaaatat       600
     tgcaaatgca acttctcctc tctcgatttc atctttatcg tctgaatcta gccctatttc       660
     cttattctga atctctattt tctcgatata cataacttcc attctgaaga attcaattct       720
     tattctggtg cttttactat tcattctaat gcccttgagg aacatagctc tggcactttc       780
     gatgtctcca acctcaaaca gcttgaatgc acaatatatc caaagatcaa catctagtgg       840
     atttcttgta cagcactctg caaacacatt tttcatttcc ccatacattt tctttcccat       900
     gacataagcg gtaaactgtg aaactattct tgggtcattg aatctataca gagcagatcg       960
     atataactcc actatttttt ttgatatgtt catgtcatgg agtgaaaacc caacattctt      1020
     tttctttact cttttgtctc ttattttttc taatatgcac tcgcttttta tatagcgcat      1080
     gaaatctaaa agtttttttt ctggcctttg aagtcggagc tcatactttt tccttgtctc      1140
     tactatcttt cttaactcgt gtggggagaa gattcctcta gtcttgtagt cttccaactc      1200
     cgatatcatt ctttccatgc ctagctgtat actttctacc atgggccttt ctttttattc      1260
     tcttcttatt ttgtcttaaa ccaaattttt ctgaattccc atactggtct ctcacccatg      1320
     ctcaaaagag tcgaggaaga tgaagtggat ataagaatca aaaggatatc ttttggcttg      1380
     ttatcaccgc gggatatttc gggactatcg gtgcatgaga tttcgagcaa ggatctgtat      1440
     gacataaaca cgagagtgcc tttaccgaat ggccccttgg acttgaggtt aggtgttgga      1500
     aacaagaagg acaagtgtgc aacatgtgga gaaggattgg ctacgtgtat cggacacttt      1560
     ggagaggtga agctggttct tccggttttc aatatagggc tagttaagaa cacgatttct      1620
     acgctaaatt gtctttgcaa gagctgtgga tccatccttc ttggagaaaa aaagaagata      1680
     tacttcaaaa agaagttacg agagagtagt ggtggaaacg acaccaagct tattttaaga      1740
     aagattattg cggaatgtaa gaaggcgaat gtttgctttg tatgctcctc taggaatgga      1800
     caagtcaaga aaacgtttgg attcagaatg gttcatgaga ttgaagatct tgaaaagagg      1860
     aaaaaagata aaaataaagg atcgggagga gtaaattctt cggattacga agaaataaat      1920
     cctttaatgg cgcttaacat atttaggatg atgaaggaag acgactacga actccttggg      1980
     ttttccgagt cacctgaacg acttataata caaagcatca tagttccacc atcctgcatt      2040
     cgtccaagtg tatctatgga tgatgaggga acaaatgaag atgacataac aattaaaata      2100
     agcgaaattg tccatactaa caaggtgctt aaggaaggaa tagaaaaggg aaacccgcta      2160
     aaccttataa acgaggattg ggatcatctt cagcttcaat gtgcactact catcaattcg      2220
     gagcttcccc aggtagggat tcccgggcag ccgatccgag gaatagttca aaggctaaag      2280
     ggaaagaatg gaagatttag atgcaatcta agtgggaaga gagttgattt cagtggaagg      2340
     acggttatct cacctgatcc aaatctaagc atcgaggagg tggggatacc ggaaagaatg      2400
     gccaagatat tgactatttc cgaaagggtc acaagcttca ataagaagaa gctgcaggct      2460
     ctagtgttaa atggccctga aaagtatccg ggggctaatt atgtggttgg agagaagttc      2520
     aagaggtttt tgatgtatgg gaagaaagac acagaactca aagaaggaga ggttgtcgag      2580
     cgacacttac tggatggaga tatggtttta tttaacagac agccttctct tcatcggatg      2640
     agtattatgt ctcataaggt taaggttcat gggaataaga ctctccggtt caatgagtgt      2700
     gtttgtacac catacaacgc agactttgat ggggatgaaa tgaatgttca tgttcctcaa      2760
     acagagaaag cacgagccga atcatccatt ttgatgtctg tttcaaataa cattgtcacg      2820
     ccaagacatg gagagccgat tgtagctgcc acccaagact ttattactgg attatatttg      2880
     ataactggaa aagatacctt tttcgatcga gagagatttg ggcagcttgt aagctatttt      2940
     tcagagacaa gaatcagtat gaaaccagcg ataaagaagc ctgtggagct atttactgga      3000
     aaacaattgg tagaggctct tatcaaggac tcatttgctg caagtaggga ggattaccga      3060
     agtccttatg gtgggtgcat ttctctcgta ggtaagaaca gatcattcaa gactcatgat      3120
     gatcctaacg acggaagtgt gataatattg gacaacctct attacttcgg gcgccttgac      3180
     aaatcgataa taggaggaga aaataaaaag gacagcctta tttatgcaat aatgaaagtg      3240
     agtaataagg ctgcaataag agtcatgaat agcataacga agttatgttc aagatatctt      3300
     ggagaagttg gtttcagcat aggccttgac gatgtacaac cagggccgat attacggcaa      3360
     aagaaggaga cagttgtcgg aaaaggatat ttggagtgcg aaaacaagat tttggaatat      3420
     tcgaaaaaat cggagtccag tgaagaaatg ctggaaatgg agatatcttc aattctcaac      3480
     agaattagag aggaatgtgg atctatatgc ataaacgagc taagtatcag aaactctccg      3540
     aacacaatgc aagcatgtgg atccaaaggc tccaaaatta atgtttctca gatggtagcc      3600
     tgtgtagggc aacagattgt gagcggaacc aggattccaa atggaatgga cgatagatgt      3660
     cttccccatt tccgtaaagg atcgaggact cctgaatcaa aaggatttgt acggaactct      3720
     ttctttgatg gactaacgtc tccagaattc tttttccatg cagtgagtgg gcgggaaggg      3780
     cttgttgata cagctgtgaa gactgcagaa acgggatata tgcaaagacg tcttatgaag      3840
     gctcttgagg atctaagtgt ccagtacgac ggtagtgtta ggaattcaaa tatggaggtg      3900
     gtccagtttt cctatggtga agatcagatc gaccccgtaa tctcggaagg agatgatcct      3960
     gttaatcttg aaagggtgtt tttgcaagcc aagtctgttt ttttgcatca gctcaattcg      4020
     ggtcggttct cgcattctct tcaaccagaa agttgcgatg tgattgatag cctcagagaa      4080
     ctaataccta agggatatcc cattgagcgc atgattaaca aaagatttgt aaaaagcctt      4140
     caggagctca taaaatctaa gagtgaggaa agattctctt ttgatgggac ttctttccca      4200
     tatttttcat ccagggactt tgtaagaaca tttttcttca tggtatcgca aaaaatgatg      4260
     gatttgatta tcgagcccgg aacaacagtt ggagcaatag ctgggcagag tattggagag      4320
     ccgggaaccc agatgacact gaaaacattc cactttgcag gagtagccag tatgaacatc      4380
     acccttggtg ttccaaggtt gaaggagata attaatgctg tttgtaacat tagtacaccc      4440
     attataaatg cagaactaaa tgattcacag aatctgtttg ctgctgaggt tataaaaggt      4500
     aggattggca gaatttccct gaaggatata tgttcttcgt taacagaggt tgttgataaa      4560
     gaagaaatat tcctcgacat tgccatagat ttggaaagcc tttctcgcct aaagttaaat      4620
     ttagatattc ataaaattga gaggttgtta agtcttcatg accaaataag gattgtaggt      4680
     aataatgtcc tcagggtatt tatcaagaag atcactgacc agagctactt caaccttcaa      4740
     aagatcaaga agaaattgct gggcacaaga atatgtggag caccccaaat aagcagggtg      4800
     attataaata gcaataaggg acagtatagt ctggtgatcg aggggactgg actcttgagt      4860
     gttataaaca cagatggaat aaggtgcagt agtgtgacta gcaacagtgt aacggaagta      4920
     gaggaagtat tggggattga agcggcaagg gcccagataa tccacgagat cgaatatact      4980
     ataagcaacc atgggatcaa aatagatcca aggcatataa tgctcctggc agacacaatg      5040
     acatataggg gagaagtatt tggaataaca aggtttggaa tctcaaagat gtccagatct      5100
     actcttatgt tagcatcttt tgagcaaacc agtgattatt tgtttgaggc agctgcacaa      5160
     aacaaatccg atgagatatg cggtgtcagc gagtccataa ttcttggaat tccaatctgc      5220
     attggtactg ggtccattga tctgtactgg aggcgcgatt cttagacatt ttttaaaaaa      5280
     gagctcttct aatgtttgtg tctgttatcc cattaaatgt cgatacatga gataggcaaa      5340
     gccatcggga gatttgcctc tctgcgaaga gctaagaccg attgggacaa tgtaggtgtg      5400
     ataatagact ctggagtaga agacaataaa gtactcttaa caattgacct gacagagcct      5460
     gtactggaag aatccatcga gcttggtatt aagaacatta ttgcatatca tcccataata      5520
     ttcaaggcca taaagaaact tgggcccaag gaatctattg ttattagatg cattagcaat      5580
     ggaatcagcg ttttctcccc acacactgca ttagatccat tgatgaacaa ctatatatat      5640
     agcttgatca ataacggggc ttttctttat aaaaagaatt acggacctaa tacttcaacc      5700
     atagagaatg ctatttctat tctcaaggag aagagcggaa taaggaattt ccggatatgc      5760
     ttagcaagag ggcatacaat ggaaagtgtc ccggaatcca tgtatgttgg tgttggagca      5820
     acatttcgca acacacctct taaaaactca attgttgtta ctggagaaat gtcccaccac      5880
     gacctactgt cgtgcattgc aaacaatgca actgttgttc tgatggaaca cagtaatagt      5940
     gaacgaatat gtctggaaca catttccggc aaactacagg aggagctccc cgattacaag      6000
     atttttattt caaccagaga caaagatccc gttacaataa tatgagtgcc cgatggtgtg      6060
     tggattggaa tcatatttcc taaaaaattt taccctcgaa gatggaatat gttgcagcct      6120
     atgtcatgtt tgataaggta gggaaagagc tcaacgagaa atcaatgatg gacctgtttg      6180
     atgcgatagg tggtaaggtt gagcctgaga cgatgcgcct attcctttcc aaagttgctg      6240
     ggaaaagcat tgacgaagta atgtcaaagg gaaaggagtt tatggcatcc cttgcaattt      6300
     catcggcccg agagcaagcg cctgctcagt ctacagatgc atcggcacca tctcaagccg      6360
     ctgaaaccaa agatgaggaa gaagaggatt tcgatatctt tgctgcgttt taattaaaat      6420
     gaccttccta aatttatttt ctacattctt tctgtatttt tctttccaac tgggttgact      6480
     tgaaaataca agcgatccct tctatgagcg aatgcgagta ctgtaagtct aggaagatgc      6540
     ttcctcttaa tggaaaatac tactgcgagg agtgtgaaat atactacgta tacaaagatg      6600
     gaagacagca atattccaat cttcctattg aggaaataag tcaaatatct gttggagacc      6660
     atctttgcaa aaaatgtaga ctgaagtact ctgagaagaa gtccattgtg tgcactacat      6720
     ttcgtgaata cttcaagaag cttcctttat gtagaaaatg taagcaaaac aatcagaaat      6780
     gcataaagaa caccttcttc caaaacttca tactttacag aacttacagc agggtttttt      6840
     cggtccaatc tgttgtgttc cacagtatat ggctttattt aatgggaacc atgttcctta      6900
     gtaagcttat catcactaac ttaattattt acaaaagaaa aggactcaag cttttagaat      6960
     gtttaatgag ctctattctc cttatccctc ttggatattg gagttggggt accaccgttt      7020
     tctatttata ttgcttcctt acaatggttt tttctaaaag atggtattat aaggttcctg      7080
     ttaatctaga tgggcctcct ccaaacattt tgaagtattt agaacatctc aacataggcc      7140
     gaaagaaaga cggataggaa tgcccttgca aagttcaata gaaatgtcca atgataaata      7200
     tagttaggat ttattcaact ttttgcttct tcacaggagc ttcatcgcta tccttagact      7260
     tctccttatc aaaagtttct tcctcccatt ctatctcaaa tagattgatt acgggaggat      7320
     ccataagctt cacctcgatt tgcttcttat cgatcttgta gccacagtat tcgattatat      7380
     ctttatcttc atcatctttt tctgtttctt ccgctacacc tttattaagt tctctgttaa      7440
     tctccgagta ggaatccgac tctacttttt catttttctc ttcttctttt ccttcggatt      7500
     caaacaccct ttcctttcct tctttaacta cttcttctac agcttccata aatgttctcg      7560
     gctctgtctc ttcttctttc tcttcatcct tgtccaaata acttgagtca tcggtctctg      7620
     tttctccttc agaactttct tctccttctt cttcttcctc cttatctcca atctcttctg      7680
     atggctcctc aacgtcattc ttcacaagct tactgctagg aattcccggg tagcttacat      7740
     cgacaatata gccgattcta ataaactgcc gtccttggta cttcccaatt atgagaatag      7800
     acgtcaatcc aaacagttcg tcaagcggta ttctatctac atcaggggca tttgcatcaa      7860
     tgctaaactc gatcttcccc ttaggtatag gtgcaacttc gatttctgcg agtacctggt      7920
     cattttcgtc tgagtgtaca tccatgttgt acaaaacgac aaactcgact ccacgcttta      7980
     tttcattaga acatgcaaac cgaaagttga atttgagagg gtccatcaat ctccttacgg      8040
     tgttatcaac ttcaacgctt ttgagcttca agtatcccat tgttcctgaa agaaggatca      8100
     aatttttaag cttaaaaacg aaaacacagt gaaaggcaaa cataaaaaat ttctggccat      8160
     gggctaatta tgccagaaaa ggttgaaaag aaggactata actatcattc ttcgaaactt      8220
     gaggatttgc ttctccgtct cccttccgag aataaagggg aaagaatcaa tcttgagggc      8280
     tgcatcctgc aggctttgga aatcttgttt ggcaagtcaa cagactatct aatccttgga      8340
     ctaaaagcat gcaaagccca caagctcggc ctctttcata aagaatccat caaagacttc      8400
     atgaagaaaa acgagctagt aaacgggtat gtggggtctt tctttgcctg gttggtggat      8460
     ttctttccaa taagttttgt tgaaatactt tttgaggaag aggctacaat ctttaagcac      8520
     tacacaaagg ttcttatgaa gctttataag agtccgaaag ttacagaatc tagattggcg      8580
     actgaaagac aggattttaa cactttaagt tgcattacaa aacctaagat agctgggttg      8640
     attagatatc caggggttgt gacctattta actaagaatt tgatgtatat gaacgaggag      8700
     gaaagattgt ttttaatcaa aagatatttg aagcgggaag acttcgaata ctatcttaat      8760
     acgctcattg ataggtccca aactccagaa aaatatagag cagatcttga tgaatatctt      8820
     aaaaatggaa ttcttgaaga cagatctgga aaatattccg tgtttatgag agtctacaat      8880
     ttcataaaga aaaacaatca taaaactatc gaagatgttg gagtagttga aagagtgttt      8940
     gacgggtata gcgtagagga gttccttcaa agtgacattg gtttaatctt tgttactcaa      9000
     accatagaat atataggaat atattctgga agtgtgcaaa agtgtaggga catcatatct      9060
     agagccctga aatccgatat tccaagagat ataagcaaga ccttatggaa taccttaatc      9120
     acaaatagaa gagtattttt ggaatgcata gaaaagttca agatctttga agatgaggat      9180
     ttggcgagaa ttcttattta tagaagaagt acttccaaag aagaaggccc atcgatctac      9240
     aaatcgataa gctatggaga tggcatttat agaaaagagg ccgtagaata tgtagtggaa      9300
     tctttttcaa cacaggaaat aacaaatgtg atgcttaaac aagatagcga cgaaagaagt      9360
     tttttgttgg aatgcattta cagaaaggct cttctaggtg agtttgattt tagaatattt      9420
     gaaatcgaag acgaagtatg ggtggaaaag acctacgatg aaatattcaa gaccttaagc      9480
     cacaatatct atgactcctt ggttgagaaa agaccggaat tactgtttga ttattgcttt      9540
     agacatagag accttcgtag aaagtacttt gaagaaatag ataaagaaaa ctgcacaatc      9600
     gaagagggta tatgcatcca taagatccta agacacgagt caaaaatgct aaaaagtttg      9660
     aaatccaaca aatcatatgc agaagcagtc tatggagata ccaatgaagg gaatgaaata      9720
     tacatgatga gtactctcat ggatcccata ccttcttcga atattgttga gttcatttat      9780
     ctccttacat taatacgtcc cgaagatgca aagtattata tgtgtgaata ttttgaagag      9840
     atatgtgagc aggctacaaa ctgtttaaag gaagaaagct ctttcgatag tacagactat      9900
     tcaaaggttc ttagccttgg agatctgagc ttaatgtact tggttccgtt ccatcagatg      9960
     attgaaacaa tgttttcggt tcatctaagg aataggtatc tggtctatac aatcatggac     10020
     tcactccttg aatccatagt tgggggagtc caaaatctcc gattgatcat tttgaaaagt     10080
     atggactcca acagcgttac atcccatcac attgtcaagt acattgacac tctcacacct     10140
     cttctccaca attccaacat ccagatatgc aatgaaagta gaaggcttct tatggagatc     10200
     cccatcataa ctccagagct ggtctgtctt aaatcccaga tggttcaatc aataatagat     10260
     aagatgtatg ccaagtcctt cttcaaatcg attagaagac agcagtttaa ccattatctt     10320
     tgctttaata ccttgaacat gcttgttcag actcttacca tgcatatcaa ggaacttaaa     10380
     gaggatgttt ttccgatcct ctccagtttg gagtttattg cccatcctca ggacctaaag     10440
     ctagtattcc ctgttatatt cgaaagccta tcttcattcg ttattgaaaa tgcattttat     10500
     ttggacgaat gctgtagcgt tgtagcatct cttatgaaat ttggagggga tatttccttt     10560
     gatcgattga ttgataatat ggggctttct cttcgagtta ataagttttt agtaaggtgt     10620
     cttaaagctt ccaataatga aattgccgag agtgttatta acagaataat aagaaaagga     10680
     tctggtgatg tagacattag agaagataca ggggagggtt ctctctatgt agagcctttc     10740
     tttcttgcct atgcacccga gcttcctatt ttcaaggaat atctcccaat cttcaaacct     10800
     cttctcaaga gactatttct tagctctgac actatgaagc aagaaatagc gtcaaaggcc     10860
     tttgagtcga tggacattct agaatttctt ctaacttgtt gtattatcgg gcaatggaaa     10920
     acaaggcttc tttgcataga gctgtttgac aagaagggtg gagaagatag ccgagtgctg     10980
     gcaatgctgt ttatcttaag aaatgataca cactcagcac ttcggaaaaa agctctagac     11040
     atatggaagt ccaaagtggt gaacactaac tcggcattaa aggatattta caggaccatt     11100
     cttggatcct taggatacaa ggaaagctcc agtccatttc gtgattctat catgggtgct     11160
     ctaagtgatt taatcacaaa atatagtgga tatgttgaga aatatctaga agatgccatg     11220
     aatgaagagc atgtcgggag taatgacaat tccatatcca atccactagg gctgaacaag     11280
     tgcgaggaag ggctaaagat tatctcgaag aaggaggtac ttgaagtaat actaatggaa     11340
     tgcgttaagt caggtaagta tatgaaccaa gcattggatt tcagcatcca aaactcgtcg     11400
     acggatattt tccggttgct cctccaaatc ccatcgtaca gagaaaaggt aattgaaata     11460
     gtgggaaata gaatagatga cctggtaatg tctgatctat ttaccggaga tagccattta     11520
     ggaattgatc tgtttaaaat gacaggaaaa acctccttgt tcaagttttt gaagaattcc     11580
     gataagatga gtctccttga gtctatgctt atcgaaaagg agccaaatac ggcccatata     11640
     aaaaagcttt tgaaatgcat gaagccgtct gaaaagctgg agaaatgtct tttagtgtct     11700
     gatcctttat acacatcaat attttacgga tctggagaaa aaatggatga tcaaggccat     11760
     caaagagagt tattcatcag ggcgtttaac accctgaatt atcaagagtt gaagcctttg     11820
     atcattcccg actacctaaa tctccttctg gatgtttcat ataagaatgt caacgattct     11880
     caatcgctaa tcaaaatcct ctgcaccaca aattccctga gggcattgga aaggctaaac     11940
     tacgttgttt ccgacatgga aattgaagac tcgctctttg ttttgagtgg ccatcttctt     12000
     cgaaactatc tttcctatga gaaaagagag gcagttcttc catccctcaa tcttctatac     12060
     aaaagataca gtgccaagct tggggtcttc ggtctgatga ttaggcgtct tcttgatgat     12120
     agcggatatc tttgaatagg aattctatcg gtgttttcaa ccgtacaaat aaaaatttat     12180
     gatcccagcc ataagatgat tcttacaaag atggctgaaa gaaaactaga ctctacgcct     12240
     acgtctctgt acttgagaaa tggtaaaata tatgtaggtc ttaagaagaa atatgctatt     12300
     gaaaccgaat acgatgttct tatccttaag aaaatacccg tggaagaaaa cattagagct     12360
     atagttggac acgaagaagg ccttcttttc tttctggaca agggtggtct ctatggtctt     12420
     tcgtggggtg atgataatgc tgcaaataga attttattcc ggaaaaagat tataaatacc     12480
     ggactttatg atcagtcttc aggacgtgtt gttattggca caagcaaagg aaaagtccta     12540
     gtacttaacc agtctcttga aataagtaag actttctatg aatcgccgtc ggggatcatt     12600
     aacctttctg tgtccgattt gggtaaggtg gcctgcatct atgaggttga ctcttctgtg     12660
     aaggtgttcg acttaaaaca tcctgaggtc aagtccgtaa gcctatccaa tggatttccg     12720
     caagctattg cgtttgttgg tagcactcat ttggtagttg gaggagattc tggagaactt     12780
     tgtgttgtcg atacaactgt tatgagcatt gtatcctcct taaagattcc tcaggcagtc     12840
     actgttctcc tttggaagga cggatatcta ctcattgggg gagaaaacat attatacctg     12900
     tcttctgtta cagaagacca cattgagatt atagatagtt atgaatgtaa tggatttgtg     12960
     aatgcagtca ctcttgaaga cgggtacgct gtagttggta ttggaaaaga gccaaggctt     13020
     ggaagatgga aggtaaaaaa gaatggagag cacaagctga ttgttctgaa agtagggtag     13080
     ttatccgaat ggaggattag taggacttca aacaagaact tggggatacc ctaatgaaga     13140
     tatcgtatat agaaggtggg cttcttgttg ttgagcatgg agaaatagac aagtgcctaa     13200
     ataagctgat tatgtttgat cttgacatga cactgatctc aaaaaatact ggtcaaactt     13260
     ctaaagactg ggaatacctg tttccgcaag tgcctatgaa gatcagagaa ctaagtaagc     13320
     aaggctattt tattggaata gcttcgaacc agtctcagct tattcgtctc aatgttctag     13380
     aggagtttgt ggagaaggta tgcaatatct tagccgatct agatgctcca attgtctttc     13440
     tagcagcatt ggaaaggaat gaatatagaa agccgtcgac agggatgtat gaatacatat     13500
     gccgagaata tgttgatgaa tcaaagataa ctaagaaaat ttatgttgga gatgccgtga     13560
     attcctctct tggtcctggg cacacaaact catgcgatag taaatttgca cacaatgcag     13620
     gaatggaatt taagcatcca gacgagttct tccggggaac taagttagtg tattttcatg     13680
     agaattttga cattagaaaa tatagagaag gaagcttcga aaccgatggc gaaaagaaaa     13740
     taatatttgt ttttggaagg aaaaagcatt gtggaaagag gttctttgcc aaaaagtatt     13800
     tcccaaacca taggatcatt aatgaaaaag cattttccaa cattcaggag aactgtatac     13860
     tgattaactg tggagacagg catttaattg aaacaattat ggccagatat cccgaacagt     13920
     attcgatgta ctacctaaac tatccaaacg aggtaatgaa ttatctaaaa accctggcag     13980
     ttctttctgg ggaaaaggaa gaagagtttg ttccactaga tgcttgtaca ttcagtataa     14040
     ttgagaagta cggggtaaag gtccccttta tatttgatag ctccggattt gatgagaaaa     14100
     agacaaaatt atctaggatg cagctgtagt aatgctttat ccattgctcc tcttaaatct     14160
     cctccctggc tatggcgttt tctagtattt ttactctctc tcgaacactt ggaattaaac     14220
     tataaaactt ctttttcacc ctttcacttt tgttacaaaa aacattcttt tcatagaaat     14280
     ctctaaggaa ttttactctg cctggctcta tcaaaccttc acagtgatat ctttcttctc     14340
     ttttggagtt tttatagagc cccagacccc aggtagaaga tggtttactt ctttttgatc     14400
     gatcttcttg gcttgaaaca tccacttctt tgttttcgga taagaaaaag ccgagagtat     14460
     tcattctacc tttgttctcc tccaagatat gtttaatcaa acccagtaga ccaattacaa     14520
     gaaatataca aatttcttaa gttagattgg acactccgct gttttgtctt catacctaaa     14580
     acatctctga ggttcaaatt agagaagaga aagaaaagaa ggatgatcaa ggtccttctt     14640
     ggaataagct ttctgttaag aagtgtaagg agtacaaaaa atatagccct tgagaagagt     14700
     ttaacaccat ttcgtagata ctgccaatcg ggatataaat tccccgaaaa agcagaaaac     14760
     tacaacctcg aaaagttgtt tgtaatattt agacatggtg ctagagctcc ggtgcgaaat     14820
     ctcaccaggg aatgggacaa ccaggaatgc atgccctgca acttcaatga taatgtaata     14880
     tcagattgta aaagaaagaa gtgctctgaa ggagacctaa ctcatagagg atttgcccag     14940
     atgatcactc ttggaaaatt cataaagaaa atttataagc cacttctttt cgataagcag     15000
     gtaaagatgg aaaatataaa gatgagagct acaaagatac ctagaacgca ttcttctcta     15060
     gctggagtta taagaggcct tacaggagac accgaaatag gaaatgtaga agtgcctcag     15120
     aaagacgatt cccttctgaa caccctggga tgtgcttcta caaaggagag agaagatgtc     15180
     acaaggctct ttgacaagcc gagtatagtt caagacaatc agaccttctc tcggcatcca     15240
     aaaccacagg aaagggcaga tcattactac acaagtttat gcagtagggt aaacgtggat     15300
     tgtgcggagt taaactgtaa tataaaaaat gtggaagacc atatgaagtc tgcaaacgat     15360
     gcctggacat atatggcaac aattggatcg aaaaacgtag agaatagaaa acgtctattt     15420
     ggaaggtttg caagggatct actcatcgac atcggagagg aaaaacagat actcctttat     15480
     tctgctcatg attcctctat gagtgcaata cttgtgggcc ttgaaacaga cgtattagaa     15540
     tggccttcat atgcatctgc actatttatc gaaatatggt gtaacacagg aaagcagtat     15600
     gttagaatgg tgtttaacaa cagagttgta aagccaaagt cttttctaga tgattatatc     15660
     ccaataagag atttcatgga attgataaag agtagttctg cttccaatcc tcaagaaaag     15720
     acttccgaaa gctcaaacat tgaggaaaac aaaaatgcag aagaagatag atctgagaag     15780
     agatgaactt agtatcatca ataattttgt aaaataaaac aatatcaacc aataaaacaa     15840
     ctcatttact tcttcctata gtccaatcta gtttctagtt tctttgcatc tgctattttc     15900
     ctaacagact taacaaaatc ttcatgtttt acatagtctc tttcgtcctt caaggcaatc     15960
     atacctgcct ccgtacatac atttcttaga tctgctccgt tgaatcctgc agttagcttc     16020
     accaatgaat cgtaatcaat ttcttcaata gcattcatga gtttagaatg aatctttaac     16080
     acctccttcc tcccttgttc gttaggaagt gggatttcaa tctttctgtc aagtcttcca     16140
     gggcgaagaa gtgctgggtc gagtatgtct ggcctgtttg ttgccataat aaccttgaca     16200
     ttgtcgagct cattaaaccc atccagttgg ttgagaagct ccatcagagt tctttggact     16260
     tccctgtccg aggaactgga ctctctggat ctttttcctc caatagcatc gatctcgtcc     16320
     atgaatatta tgcacggcgc cttccttttc gcataggcaa acatctctct aatcatacgc     16380
     gaagactctc caatgtactt ctcaattaac gcagaagaca ctaccttcaa aaaattcaca     16440
     tccattgtgg ctgcaactat ccttgctagt aaggtctttc ctgttccagg aggtccatac     16500
     agaagaaccc ccttaggagc tcgtactcca attcttttga atatatctgg atttttcaaa     16560
     gggagttcta tcacctcccg aagctctctt atctggtcct taaggcctcc aacagattca     16620
     aaggaaatgt tgtctccagg gctttcttcc cccatcgaat ggatcattgg atccacttct     16680
     ctgggaagta ccaccataat cgtaagagtt gtgatgtcca atgccaccct tgttcctgct     16740
     gttatgttcc ttctgtctat tgccttcatg catccgacaa cgtatcttgg cccctggcta     16800
     cttttgacga tgaacttctc gtcacttaat ttttctaaca cttcgcctat tatatgtccc     16860
     actgtttgta gggccttgac gtcattttca ctcttcaggt aatgtttgtg agtttgctta     16920
     tatacctcct gctccatttt caatgccttg tatgcttttt cattactaag caaggcttgt     16980
     gtatattctt cataaagctt gtttttatcc tcctgaaaca ttaaagggct ccacctaaca     17040
     tgatttacac atacatttga ccccacatgg aggagtatga aattttggag atatacagag     17100
     aaatatcgtc aaaaggcacc tatgacttca agatgttttt gtttgatggg aaaaagatct     17160
     cggtcaagaa ggtttccgac gaaatgaaat ccagggtaag aaaaggaatg tgttacaaaa     17220
     acgactggat cttgattcag gaagatgagg atggaatagt tttcaaggtt attgagccaa     17280
     gagcttattc ctatgcatct ctttttaaaa agaaatttga ctcagatgct tatctcacca     17340
     tcagaggaaa tgaaggcccg gttggttcgg gactttccga gaaaacaatt ccgaaggacc     17400
     ccagtaagcc agagcaatct cctgcttctg tagttccaga ggaacttcca gaaagaattc     17460
     ttctcccgtt tctgaacgat acccttccct atagtgtcct tgaaatacct gtaatgaaca     17520
     aggatctact taatggacaa aaggttaaat ccaatgaact tgttttgcct gattccttca     17580
     atcccgttga cgtgaacaga tggaataacc ggagttctcg cctctctcca ataattggaa     17640
     gggtcatata caaaactaga atgagctctg taacttatac ccgaaaatat ccctattatt     17700
     tttttattct tcagacttcc agactaaaca tcatcaaagt gtttgtttgg ggagaagacc     17760
     tcccatattc ctccatgaaa gttggagata aaatctgttt gtccaagtgt aggaagaaac     17820
     ctaacattga aggcccttct attgtcgagc ataacagatt tacagaggca aggtattttc     17880
     gatgtaagga ggttagtgct aaggagatat ttagaattga gttgaacgaa ccgaaggaag     17940
     catttaagtc aatattttcc gatgcatcgg gaaaggtcga atacctaagt gttttgaata     18000
     ggagatgttc agggtttctc gaagaatact atttgatccg aatggggaaa cataagatcc     18060
     ttttgttcta caattcatct aaggaattcc atgagatcga ggttggaaaa catgttagaa     18120
     tcaccaatct gaggatttca aggcgtggaa gatcggagtt ttatatttct acgatctata     18180
     cacagatcga attcagcgat ggcatttctt ctcctcttgt gatacaggac ggggatattg     18240
     tctcaaagct tgatgacgag gggaaagata ccagaaaaag aagcaagatg gcaacgaatt     18300
     ttgaggagtc tgaagacgaa gacaacttct tggaaaaaaa agagaatagt tcctttcaat     18360
     gtaaccttat atttggagcc atggggtatg ttccggacga cttctcgaat attgaggaga     18420
     tgtatctgtc taggaaagag gagatatctg gagagatgtg cgagatagtt cctttcatgc     18480
     cgcctttgga aataaatctg aaggacattt acgacgaagc ggaaaagctg atgctaaatg     18540
     agtcgaagaa attcatagtt gatggaatgc tggttgatgt tgatttttca aacttcatat     18600
     ttgatgaacc accaactctc atggatggta catctgtaac ctatttctgt aacggagcct     18660
     taacccacca actcccggga tatgtaagta tatgcaacga gataacgatt gttgtttact     18720
     tgttcaacaa cttctggatg gacgagtttg acttagaatc attgtataag ctgggtggat     18780
     gctcctcact tgaagagtta aagagcatga gaggaagaga aatgaaattt gtgattgatg     18840
     cctttcgagc ttcagaagaa actgtgatat tttgtttaac taaggttttt aaatagaaac     18900
     aaaggagact tttgagtttt gggtctatga aatttcgtga gatttccctc cctatcgatg     18960
     gccgaatttc atccaagcct attcaggaga aagaatcggc ccgaagacat ttctgaggca     19020
     gtgacagagg tcaagtctac atcaatacca cagaacacac tttatgaaga acccttagtc     19080
     tcacagcatc gggcaaagaa aaagtatgtg acagtgtacg gattcacagc aggaaacctc     19140
     gatgcagtga tggatactgt taagtcctgt ggagaagttc tagaagttga atatggaagg     19200
     aactggataa atgttttgtt cgataacgaa gacagtataa agagatgtct gagactaaac     19260
     actacgatga tcgaggacga gattgtgggg actttcagac aaggaggagg aattattgat     19320
     tccagcgata tttttgtaag gaagaagggg gtttttacgt ctataatgga atatctgttt     19380
     ggagattaaa tctgcttctt tagagcttct tgccaacgat gttgttcaat tactgaatgg     19440
     tttccgaagg atatttgaaa ttccctccgg tttcacccag gaagaatgga ttatgagcct     19500
     gtaatgaaca agctcataaa aaaagtagta aggaagtttt acgagcccca acatgtagtt     19560
     attactgaca ttctgcttca taagactctt ctctacgatg cggagctctg cgggaggatg     19620
     aagatgcttt cgaaggaagt taatcgtctg ataataagac tgaaggaaga taagattgtt     19680
     aagtatgaga caaaggtgga aaatagagag gacaatggac aagttcttcg cactgtgtat     19740
     tacataaact atgcagaggt ccgagacgtc atcaagtata agatatttaa aatgacaaag     19800
     aatctagaga acaatataaa gatggcacag acagaaggat atatatgcat ggaatgtggg     19860
     cgggagtaca gttctttgga tgctcagagt cttatggaga actatgtgtt caaatgcgag     19920
     gattgtaaag gagatcttgc ggaaaacaag aaggatagga gcgccgactg cacgatgtat     19980
     tccaacttga tgtccgagct ggatgatatt attctcctcc tgaaggaaac agacaagttc     20040
     agcatcccgt ctttggacta tttccaagtt cttcagatga agaaagaaaa ggaaaccaaa     20100
     caaatgccta gcaaaaagga agagcaggtg tctgagatgg cgcttcctgt tgtggaggag     20160
     tttgagatgg gagagtccta cactgctagt gatagggaag atcaaaaaaa ggaagtgaag     20220
     atagaagaat acgttacagt gaacggaacc aagaaactgt tctccgatgt tactgaggaa     20280
     gacaaagaga tgatgaacga ggctgaatat gaagaatatt atgatatcta ttctaaatac     20340
     tatgacaatg gaaactgata gtaaatgtga agtaaactct aacttattat ttttgaaata     20400
     ttttaggaga aggatgggac tttctatgga tgaaaacagc aggatgaagg tagaatcttt     20460
     tgaaaggttg gatgaggaga gaagaagtgt tgaggaatac tttccggcag aaaatatctc     20520
     gaacttggaa gtgaacagga ttatggagac tatcgacatg gtaaaaagag aagcggccaa     20580
     agattcagaa actctttcca aggctattca cgaagctact gaatgtttag atctactcca     20640
     gggactttta aggtggggtg cgcaatcact agaagaagga tcagacctta tgaggaatat     20700
     acttatttgg cttagaatcc gaaggtctcg ttttagcatt gccactgttg agattttaga     20760
     agggtttttg aagctaggct ctaaccaaat tgatgaagac ttgagccaag aggaagaaga     20820
     atatcttgtt agaatacttg aggaaatcag agaatacata gaagagaata tattgggatg     20880
     caatagagat tccatccgta tgtttctctt ccgaatcttt cttaagtcaa gcaaggctgg     20940
     agacaccacg aaagtgtttg cctttgagtt atattcccga gttgccatac ctgcccagca     21000
     cgaggagttt ggggtcatta ttcatgaaat agacagctta gacctattta gtattggaga     21060
     aatgaatttc agagactaca ctattctgaa gatatacaga aatgtagtgt tccgagagtc     21120
     gaagataatt gaagagagcc atgaccgttt ggtcaatatt ctgttcgaaa agctcctttc     21180
     ttatcttcct agccgtagct ccgagcgcgc cttttcacta attagctatt cttcttcttg     21240
     ttctcagatc ctatgtgtat ctctatcact ctgctacttg aaagagctga gtgaaaacag     21300
     aaagagcctt gactccaaac ttctgattct ttttattgaa aacatggtga ggattgggag     21360
     gaaaaaagag tatggggagg aggaaattgc atatttcaaa tgtaagtttg gaagccttga     21420
     gcctcgggtg gctgtgctca gagttataaa gtcctttgtg attttactac tacggataat     21480
     agatcaaaaa gaacataaat cccgaataaa agcagccaag gttctttgtg gaattcagct     21540
     ccatggaatg gcaattggaa gaaaaatgtt tctgaaaatc ttgaggattg caagaaagta     21600
     catggaagac agacgggtta ccattatgaa gggagtgata aacattattg gccagtttga     21660
     tctggctgct ttggctaagg aaatgcaaag aatacactct atcttggcaa agaaggaaat     21720
     gtttgataaa gttaaagatt cctttcaaac tgaaacatgc tatagagcat acatagacct     21780
     gcttagcaac aaagatacaa gggatattga ataccgaatt gaagacatca agctacttgc     21840
     aaggatcttt tactcttatg agaataagag tgtttgtaag ttcatgagaa ttaccgtgtt     21900
     ttctattgag gatgtgtttg ttgcggaatt tgctgctttg tactctgagt ttcatccgaa     21960
     cagtattgat gaggtttatg cagcttcaat cctcttggac tccagagaag aaataacaag     22020
     aggcaaaaat gtcttgttct ataacaatgt cttgaggata cttatgaatc taagatcaag     22080
     attttcttcg gagttaagga gaaggctggt agtatttctt cgaaaacttg ttttctatag     22140
     tccatacaca aggaatgctg gaatgcttat aaacctctta ggatatgggg ggattgaatt     22200
     tcctagaaga accgactact ttgtagcaat acttggttct tgtgggagtc catacatgag     22260
     agactacttc cctggatatt catggtctcc aaacaaagag cttggacttg tatacaacct     22320
     tcggttcgac ccggcatttg gaacagcata taagtggaag ctggaagaga ttttatctag     22380
     aatgaattgc agccttgatg gaaaggaggc attggtgtgt gctgagcttc tcttattcct     22440
     gagcgagacg atcgaactta atgaaggagc caaatcctat actcttgcct ttgaactggt     22500
     ggcaaacaac agcaacttta tagtctgggg agctaagtca aattgtataa gtgtatctaa     22560
     ggaagccaat gttttactaa agaaagcgac aaaggcagga gccattctcc cccacatttc     22620
     tattccaata gtgttttcct actatcttgt ttctccagag atggtctaca catacttcga     22680
     aacgacttta agtgttattc gagaggcaat tgagaacaaa agattgatgt ttaaggaaaa     22740
     aggtcaaatt cttgagttcc aaatggtata tgatatttat gtccattcta agcacaagtc     22800
     caggcttgta gacaaattac tggaggtatt tgatgaatgc cccatcaaaa catattatct     22860
     catgagccag gcagtaaaat ttgaaaaaaa ggatcgtttt aaaatcatga aatgtgtaga     22920
     tggtatggtt cactcctatg acccagacaa aagcagagtg cttctaaagc tgcactccct     22980
     attttccgaa gtttttattt caagtaggtc aaaaaaggaa atgaggatct ctaacgagaa     23040
     tgttctcttt gaagagaatg catcactgga tgacatagat aatctgaggc tgcttagagt     23100
     taaataaata cattgaatat ggattcacca ttaaagattc gacaagaaat ctggttccac     23160
     cgagattcga actcagatta ctggattcaa agtccagggt gctaaccatt acactatgga     23220
     accttaaggt gccttgcaaa gagactcctt gcagataatt cccggcttta gactgtagag     23280
     gatgatccct aataattttt aagagaatta tctccccaac atgaacatga aatgcattcg     23340
     agagaagata gaaaaggcca aaccccattt tgtgaaagca gcctcagata ctcttcaggg     23400
     atatattttt gggtgcatgg taggcgtgtt ttcctcatcg gagaggccat ctttcaagaa     23460
     tattcacgag tctggaaagt cgtttgcaaa gattagtatg gtatactcca caacagaatc     23520
     agctcttcag ctttatggat cagaaaacgc accgcttaac agccttataa gcggtatggt     23580
     tgccggaggc cttggggtga gggacaagtc caaaaaatct attttaactg gagcagcatc     23640
     ttttgggcta tacacaggaa tgtccagtgt ttttcccacg aagggacaga agtaagatga     23700
     gggcttaaat ctttcttatg ttataggaaa ataaaagccg atagggcgac tggacatatg     23760
     taaggaacaa atggatatgt ctgagaaggt tttccgattg aaagacatct ccaaggatgg     23820
     ttcttcttca tcataacgaa aagtaggttt gaagagagaa atgagactga atgcaaatta     23880
     aaattaaatt atttagcaat atggacttat ttattaggcc ccgatgagcc gatttaaatg     23940
     atggaatcta aaatctatta tcatgataaa caaaatgata ccaaacgcct aaattgatta     24000
     atattagcaa tgaatagata tattggctgg aaacaaacgg gaattactat aaatggacaa     24060
     acattaatta tcggtccctt gtaaatgaac aaaatttttg ggtatataaa aacatatgag     24120
     gaggcttgtt tagtagtgca tgccgtgaga ttaggatact tcagtacgat agaaggaagg     24180
     ttagctcccg aggagcgaga aaaaatcagg tcgggagaca tattctgctt tgtggagtca     24240
     ccaaacggca tcaaaagatg gacagacgga aagacatggt ctccatctaa gatccatggg     24300
     cagtttcttt tgtatcagga ggttcccaag catatgaaca aaagtgcaat tgggaaaaga     24360
     aaccgccaaa agtcccttct agggataagt aagagaggaa gaacacggga aaagatcatc     24420
     aactgggacg acaaactttc tcttaacaag aaaacgattt caatctgcct gcagaataaa     24480
     acctaccatg tgatagcata cttcagaccg atgttcttta ggatgtctct gataaaagtc     24540
     cctcttttca gccatatgga tatggcactg aagatatacc cagaattgct ctccgacgag     24600
     tttcttagga ctatgactac caaaaaagac ctttattcga aattcaagct accatttcct     24660
     tccaaacaga tgatatttcc agaagtcaag agacattcct tagaagaaat agcaagtagt     24720
     gtattaacgg aatggatgca agagaagatc aaaagcagcg atgtagagaa gaaatatatt     24780
     tacttgtgca atagtaataa atgatagtct catttgtttg tacttttcaa attagaaatc     24840
     accaatcccc acatgaacga ggtggatgca ttgcttagag agattagaat agattgggaa     24900
     accctcatca cagaggactt caatcctctg agacaggccc tgaagaataa aaacaattct     24960
     gtagaggctt caaatttcag gaatctcttc cacaaggttg aaaaggcaat ggaagagatc     25020
     atagaaggaa actacaaggg atttagtgac tcggttctct cgtatatgga gtcctattac     25080
     ctcaacaaga agtgctatga tagcatccaa gagatattta gaacgacaaa ggagttgtct     25140
     gagatgaaga tagaggtgaa agatatgatt aaggaatatg aagacgtggt ggtttttgag     25200
     gccaaggaga agatttgcct cacacttctt gaggttagaa gaaacttcag ggagttttgt     25260
     gaaatcagag acaagattga aaacaacata aagagaaata tcgaagatcc ggatatgagt     25320
     cttagacttc ttgaggcttc caagaagatc agagacatat tcgatctaat aaatgaaaac     25380
     agattgatag acctagattg catcaggaag tttagaaacg acgtaaactc agaggccgaa     25440
     gacctaatga gattgattta cagtaggatc aacaagtttg ttttccagaa cgaatgcaag     25500
     tatcaggagg attttagatg cattgtagtt ttgaatgcct tgcaaggcct tgagaagtat     25560
     caagcggaca atcttgagaa agagtacttc aaggtggtag aatcggcaat tgaagaggta     25620
     gagaaaagta aggtagagaa taaagcagaa gtgctagcaa aggttattat gggaagaacc     25680
     aaggtgatta ttcgtaattt caagacgttg tttgagatgg cagatacttc ttttgagggt     25740
     cttcatgaaa agttgaagaa cttttttggg gaggaggaac ctgtgctgag gatctacagc     25800
     ccaagatgcc aggaaactgt tgagttggct ataaacaagg tgattcgaag gtttgttctg     25860
     gagtacatag aggatcccga aaagcgttgc tatgaagaga tgtttcgggc ggaaaacttt     25920
     gttgatgata tcgattacgg ctctgtgttt gaaagcaaat atcttatcca tgaaaaaatg     25980
     actagggcca caaagctcca gacagtattt tccgagaatt ttaggaggat cctctcttca     26040
     agtgtagaga tagcaatcta catggaaaag tatgccgtta gttctgagat gaagaagtat     26100
     ctaagaaatg ttctgaacga gaagtatgtg aaggagaagg agaactgggc ggaaaggcaa     26160
     ataatttgta tatttaacaa cgatgagtgg catggaaacg actacatcaa ttatcggttg     26220
     tctttttaca caaaatacca agagatcatt gcagacattt cttctcatcc agatctttgc     26280
     aatatttcca caatctcagg ctttttggac gactttcttg agaaaagatt tgatgagtat     26340
     tttagcaaca ttttcaggtc cgatttgatc agagaatgtc tctcgaacgg aaacaccaag     26400
     gaagaggctg tggaagcctt caaaaactcc ttgcttacaa gggacataga caggaatttc     26460
     ctattttttc aaaaacgatg ctacgaaaat atgttttttg gtttagaaac attgaaagac     26520
     atcaacaaat ccatcaaggg aaggaagttg gaggccttac tctcctcggc acttacaaga     26580
     tcgaagttcc aggttgtttt ggaaatactg tattttttcg atctgttcta tcgtgaaggt     26640
     aattacgcca acaaaaacga ttactatttg catagaatat taggagtggt tgaaaaccta     26700
     tatggaccgg cctcctgctt aggtgttcaa tctgagtact tcagctttgt atttgaatgc     26760
     ctgaactttt acatacaaaa gaatgttata agattgaatg taagatctgt agaagagtta     26820
     aagtcttttc ttgagaaatt gagactattg gatgaaatct tggggtttat cggtggagag     26880
     gatagcctga atggaacggt tgccttcatc gaaggagtta tatctggtaa ctgtaaaagc     26940
     gaaagtggaa gaaagttaag aaccaagatt gtaaagaaat gatgtaaaac gatgtttcgt     27000
     cagtttacaa acaataggcc gatagatttt gctggttggt ttttaagata tatgttgggg     27060
     aaaaagcaac tctgatgagt tcccgagaac tagcaacgtt tattccagga tattctaacg     27120
     gagacttatc cgaaagctcc tttggtgaca agataattgt cagggatcaa agtaatgtct     27180
     gtgatgagaa catggatata gaggatgtat ggagtgcaga tatattgccc cattcatggt     27240
     atcaagaacg aattcttggc aattataaag aaggaaaaag gtatgcagac aagatgataa     27300
     aggctgaagc taaagacata tataggatat ctcctgggaa actctcgaag gctttgactt     27360
     ccatcgattt atcaattctc cgaagaatca cacctaatga attggttgat tacgatggaa     27420
     ctggagacat caaatgtaga aatataagac atatgagatc gaagaacgca ggtctgacaa     27480
     acttcgtctc tcacgaatta ctgaaagaag gaaattacaa atacttcttc cgggtcttga     27540
     aacatctgaa aaagatagga aattacaact cgttttactg tgttgtgaga gcatttcaaa     27600
     tgcagaagct ggatacaaaa agattggata ctttgtctag gcatatcgag aaaagcgcaa     27660
     gttattttga tatgagacaa gtcctggatg acctgaccac aactgatatg tttcttatat     27720
     gtcccatgga tgtctatata agagatgtag aggaatccaa cagaaccaaa aacaatgagg     27780
     tggcgtcgat gaggttctgt agactcgtgg aaatactgat aaagctacag ggtcaagcct     27840
     ccaatgttcg aatctcgtac gcaaatgaac acttcctact tagtaagttt tggtatcatc     27900
     ttcaaaagga gatggcttct gatagagagt ttggcataaa aagatacgaa gggcaatttt     27960
     tacttatatg agaaaagcta cgagcgttgg gtctgttaaa taaaagcttg aatatttctt     28020
     cggggtttta tggaggaatt tgaagcacag attcctatag actgtctgtg ttgtacatcc     28080
     tcggccttaa ttgcaggggg atatctattt catgaggaaa caagaagtgg gaagatatat     28140
     ttctacgatc ttgaaagcat ggagattcaa gacgaatttg agacatcagg aactcttgac     28200
     attaagatta atgcccagac cctatattct gcgaattcta gagacgtttc tgcaataaat     28260
     atcggtagta aaagtatcat caaaacagac acaagggata ttaacacata tctggagatt     28320
     aatggagacg aagtatttgt ttccgacatt ggaggaagag ttagtgttta tgataaagac     28380
     attactgtga gaaaggttgt aaagcttggt gaggcgccaa tctgggtgct taaaggaaga     28440
     tgtaaggagt tgatgtgcgg gtcggaggat ggagagctca gatttgtaga catgagaacg     28500
     tggtccgaac accaccgaat gaaaagagct tccggggtta tatcaatata tgaacacttg     28560
     gaatatttat atgtagggtc atatgatgag catatagaaa ttgttgataa aagaatgtat     28620
     gaggttgtga ggaaggtaaa agttggagga ggtgtatgga ggatctttga gaaagacaag     28680
     acattctttc tgtcttgtat gtatgaaggg ctgaaggttt gcgatggtga cttaaatatt     28740
     gtgaaagagt ttccgacgaa ctcaattgca tatggactag cttcctcaga caaggagctt     28800
     ttctttacat cgttttatga taagaaaata tgcaaactta ggttccagga cctaaaagat     28860
     attgtggagg gagaagacta tttttgaagc aagggttgga ttcggctgat aggatgtcca     28920
     aggttttaaa aagttgattt gtttaccctc aacatgaaga taaacattca gcatctgaag     28980
     aacaagtttg ttgtcgaggt ggacaacctg gatattacaa tagaagagct taagaaaaaa     29040
     cttgaagaga acatggggga gtctgtccga attcctgctg gagaacaaac cttgattttt     29100
     gagcgcgaaa agcttgagga tggaaagaaa ctcagcgatt atgtaaaagg atcgactgag     29160
     gagataaagt tatttgttat caagcagcac aggaatccaa atcccatatc aaagccgggg     29220
     aacatttatc aaaatgcaag taacccatcc gatgctcagt cacaaccaca aggaggaaac     29280
     cactatggag gacatggaca atcaacacct aatccatata cggcctttgt acctccgtat     29340
     ggtggatatg gatctcccca gcagatgtac ggccaaatgc cttatggata tggatctcct     29400
     catcagatgt acagccaaat gccttatgga tatggatctc ctcatcagat gtacagccaa     29460
     atgccctacg gatacgggtt cccccaagga agtggatctc caggacaagg ggatggatac     29520
     aatgaagcat tttcaaatgc aatgatgcag cagatggagc agatgcttaa caacccaacc     29580
     ttattggaac aagtgttaag tatacagaac ccaaacatga ctcctgaaca gaaggaagag     29640
     caaaagaaaa tgctaaaaga agccttgaat atgatgaagg ccaatccatc tctgttccaa     29700
     caggcactta caccagaaag gttgaattgg gcactgagca caatgaacgg cggaggatat     29760
     ggagggatgt ttccatcatt tcctccagga aacatgggga acttcaacca aagagatcca     29820
     cgtgcgccat ggatgtatgg atacccccct ccaggatacg gaagcccaag accagacccc     29880
     caagccgacg aacaaataca tctggtacag ctagagcaac tcaaagcaat ggggtttgaa     29940
     gacgaggaag ctggaaaggc cctaagggag gcgaagggtg atataaacaa ggccctggac     30000
     attcttcatg aaagtaaaaa aaagaagagc caagaaaacg ctgagccccc ttcgaagaat     30060
     taaatgttct gcagcacatt ccttcttcct aatctatggt cttatctgtg tatccttggc     30120
     gaaggttcat agaagggtcg gaagggagaa cggtttatta ttaaattaat ggtttctagt     30180
     gaccttgtca aattgctcat caagacgctc tttgtcactc aataaggtct tattttgaag     30240
     aaaaaccctt ctaatatcgc cattggaaat ctcaaggtca taatctatag ccgacaaaac     30300
     caacttctct atttgaaaga tttctctagg attcatctcc tggaggaatc ggatactagg     30360
     acttggacca tcaaaaataa atttcaatcc catgaagcag caaacaaaaa aaaacttaat     30420
     tagcctttta caattactaa atgcaatccc aatctttttg acatacttct cgagataaat     30480
     atatcccgaa attaaaacca aaggcagttc ttgagcaacc ttgaatattg attctattaa     30540
     caggatagat cccacgtttc tatggtccag aaatcggagt attacagagt tgataaggcc     30600
     gaagttgaat cttattcctc tttcttggcc gaagatggac acaagaaata cgtccattgg     30660
     aaagccagca tatgatctta gggatgcatt ggatccagga gatgaagcac tgttgtaacc     30720
     aggtgttttt ttgtttattg cgccatccac cccgccactt ttttttctga ttctactggt     30780
     ggattgttta agctcattcc tggagtccgc cttatatgaa ggtatgactg gcatccacat     30840
     atcttccgct actttccttt ctattccaat ggtccttatg catctctttc tgagcaagga     30900
     atacagatgg cttttccccc tcattacaaa acactctacc ggcaatcttc ccttttataa     30960
     ttgttcagaa ttattttgtt taatatattc actaatcatt aatttatgat tatttttact     31020
     ctttcctcta tccaattgct tgtgggagac tttacagact cctatttata ttctatctta     31080
     attaaatgct ataaataacc aaattataaa acttcaaaat taacattgat ttaaagcttg     31140
     atgtgtagat ttaacttatt aacccctgga ttttgccctt ctgaaatgat cctcggactc     31200
     cttggaataa tcaatatata cctttttctt actggactgt tcaggactgt aaacctgcct     31260
     gctgattcct cgatggagtc tcccggctct aaagaataca gtaaaatcgt gtatcttctg     31320
     atcgatgggc ttcgttttga ctcttccgta aatacatcca aagaaggaca tatatttaat     31380
     aagatgaaac atctacgatc aatcaaaagc aaattccacg ctctgagcgt cagtggaatc     31440
     ccgacagaga cagggtctag ggtcataggg cttgtgacag gaacacccag caatttcttg     31500
     accagtgttg gaaatctcca aggatgctca atccattggg acaacatggt gaggcagctt     31560
     ctccaggatg ggaggtcttg tgcttttttt ggagactgcc aatggattaa gtattttcca     31620
     gaactcaaga atgggccttg ccatacagta gatccatatg gaagatacga gttaaggaaa     31680
     caagaaaacg agataataga aagaatccta cagagtataa acaactacga tgtcattatt     31740
     gcacatctga taaatcttga ttcctacggt cacatccatg agactatata tcacaaagat     31800
     atggaacatc agttgatgat atatgataat ctcataaatg atatatatga gaagatgtca     31860
     gaagacacat tgtttgtaat atgtagcgat catggcgtag atgataacgg agctcatgga     31920
     ggagtctcca cattggagat gtcttctgtt ggaattttca tatcaaaaga cgggagattc     31980
     actaatcttt ctccagttaa cgaagaaata gaagaactaa ggaaaaagca catcttaaga     32040
     atgtacgacg acaatcctct tgaaatacaa gccaaagagc cttatccgac tattcatcag     32100
     gacgacatcc tcccaacact ctgctatttg atgggtgttc caattccaaa gatgtcttgt     32160
     ggtaacttca tacacgagct tgtacacgat gtaaatgcat atcaaaccta ctacaagcaa     32220
     aaatgcagtg tgcttggaat tgagccacga gaagttccca aagaaactaa tgaatatgcc     32280
     aagctgaact ataagttaag cgaggaaata tctcggaaat ttgcagggag aaattatttc     32340
     aggttaatta tttctgcaat actttctgtg gtaatagcac tagccgttat attcaagctt     32400
     ttcagctcga agttctacaa gttcaacgac attcttctgt tgtttgtttt cataatgact     32460
     gcacattctg tactatccat agttcatgag gatttgttct gggctgttac gttctttatt     32520
     tcgaatcctt cggctaagaa tcttcttggt gtggtaattc ttttacagat ggtaagacct     32580
     ccatcaaatg cagatccttt ttatgtcctg gttatggaga gactcaagct ttctccgata     32640
     ttcaatggaa atcttctctt tatccttgag ttgtgcttgt ttggaatcct caacagcaca     32700
     gcacactttg agctagctcc ccggtttttc tctagcagta ttttcgagat tttcaatagt     32760
     catccgcata tctttatttc tctcctcaga tatctgtttg gaagtggatt ggattctgca     32820
     tcatggagac tcagcttatt tctatcatcc cccagcattg ataccttaat agccctggta     32880
     ttcaggccga tggagtccat atatcttatc tatatcatca gaaatttaga tattgaaaac     32940
     agcgttaccg cttacttctc gcttacgaat atggccttct tctcatcagg actacagaaa     33000
     ttgtttcaat ctattaacta cagtgtattc ttcacgtttt caggtaactt ccttactttg     33060
     cctgtcgcct tgattgccat actatacttt gtgtgtccaa gactccgggc catacagttg     33120
     tttatgtccc atcgagataa gacaggctct tcaaaaggga agaaaagaca tctaagagat     33180
     tttcagtcct ccgtaaagga aatattcatg tttcatagcc tcaatttatt actagtgatg     33240
     tggtcaggat ataccatttg tgagtcgctt tcattctaca aattccttgg aattcgtgca     33300
     ttctttgagt atatctacta ttttatagat atcgctttgt tctccgttct tggaataatt     33360
     aaaagaaggc ttaattgatg taatcccatc caaagtctat ttctttcttc taaaaagagc     33420
     tatgaagaac ccggtggctc cattgtcgtc tctcctgcat cttattacat tccgactaaa     33480
     tggaaactct gaaggacagc tagggcccca gaacatgctt atatcttcta gctcatattc     33540
     agaatccttt aggatttctt ccaccacttc ctctccttct tctttgtggt tggaacatac     33600
     agagtacata agcttttcag gcttgaattt taaagcatgc ttaacaatgc ccacttgaaa     33660
     tgatttaagg ccttctattc gctccttgtc cattttatac ccaaaatgca ttccagatcc     33720
     tgaacaactt ggatcacata gaatatatcg gatgtctttg aaatcttccg gattggtctt     33780
     cataaagtcc tcttctataa catccgtatt gtttactcct aatctttcta atcggatttt     33840
     aagtgtcttt gccctagctt tatctctctc aaaagcgtat atcttacctg tattcttcat     33900
     gatcattgcc aactgcgatg ttttgtttcc gggtgcagag catgtatcta taactctgga     33960
     tccttcatcg ggattaagta tgtgtgcagg aaggcaagac gaaatatttt ggatcaaaaa     34020
     cttaccattc ttatattcct cagagaaaac aatatcttta gagtccagga ttttatacac     34080
     tccatcaata catgtctttt cgtgttttag aaaatctatg tccttctctg taccattctt     34140
     taatggattg atccttataa acacagatgg cttcgtcaac tttagctttc ttccatcgag     34200
     agctttttta aacttcttgt acatcctggt atttttcaat cgcctgtcta atatctcgaa     34260
     acatttcacc actcctaatt cctgatcttc ttccatgtac ttacatttct ttatcacctc     34320
     aagcaacaag tcataattct caaccaccat atgcaccagt ctgtggtaca tcttcgggtc     34380
     ctttgtctta taaacttcac tcttaatcgt cgatcggcct tctagtacgt ttcttaccat     34440
     ttcaacacat ttttcatcga acttcgactt gctattttct ttcttttcca tccctaggat     34500
     ccaatccaaa aataattaag acctaagaga aattatttat ttaatcctga tgtcataact     34560
     ctagtgtaca tccactacgg ttcttttcaa atagctgctc tacagatagg acacttattc     34620
     gagtgtccaa ggagccattt atcaacacac ccaacatgga atcggtggtc gcatggtaaa     34680
     acccttagtt tttggtttgt agaaaaattc gacatgcata tggtgcattc gcacgcctcg     34740
     tcagcttcca cagcttttac aacattactc ttctttaggg actcctttgt agcggttact     34800
     ggtgcttctg cagaagcatc aaacacatca aagttaattt ggatctcgta tataatgttt     34860
     cctctagatc tctcattctg tggagtaaga aacaggaacc gaagctcctg ggaaggaatt     34920
     cgtgggaaaa caactctgaa tcctctcctt ccggtagatt ccggttccct agctctaggt     34980
     tcaacctgtt cttcgttttg caatgaagat tgttgggtcc ccattccatt ctctgttact     35040
     aagatagatg ttgttaaagt aactggatcc ctagagcctt ccgatctcct tcttctggct     35100
     ccgtcatctg aaacaatcct agcacggcgc cttcccctca ttggcctttc ctcttctgca     35160
     cctatcatcc tactacatct attgacaata ttccgctcct ctacagtagg cgcctcttgc     35220
     tgcccattag tctggttctt tctttcgcgc cttctccttc ctactccgct agaagcccct     35280
     ggagaaggcc ctgcctcagc ttcttctctc tcattactcc ttgcctcttc tctaccattg     35340
     atcaggtcga tcagcctact tctcaatcta ctcatgaaaa ctccgccagg actattgttt     35400
     gtgtcaatgc tagatgattc tatccttgca tccaagaaat tcagcatgga tctcataatg     35460
     tctagaaagt tgttgttccc atttctcctt gccatagggg gctgggccgt ccaagcctcg     35520
     atttattttg gccatcatct cgaaaactct agaaaccaac agattttcca gaaaggaaag     35580
     gagaaattac tatgatacaa ccaggacagc ttaagaattt aatgtttgga gttacaaaat     35640
     ctgcttgcaa gcagaaatag tttcggaatt ctcacaaggg aaactttcca catgacattt     35700
     ccgcgcgcga attcttcttc ctccaaaaaa acgtccatta agaatgttaa aagcgtgcct     35760
     ggcttcatct tccgtggaat aaaggcagta tacggcaact tcctctttct tatgtactcc     35820
     aaattctaca acatctccat actttttcat ctcattctcc atttcttgat caaaatcgtc     35880
     atctgcatca tttatgtcta tcaggtttct caaaacaacc atttttcctt tgccaaatat     35940
     agcactttca attctcttct ttatctcaaa cacctccttg ggaattgcaa agtagttttt     36000
     ttctggtagc tccattttgg tcacacaagg ccctattctt attctttttc catagagaat     36060
     aatcttgtta ctgtatccca aagctctttt tgcatcgatc cgtctcagaa actccacata     36120
     tccatatcct ttgtgaataa atgaagatcc ataggcaagt cttacttcct taatttcccc     36180
     catctttcca aagatatctt ctagttgttc ctcttcaata tccaggtcta tgtttgatat     36240
     ataaacaatg acttcatttg gaggcccaag ttcctttggg atctccgatg gaaacgtaga     36300
     ggttcttccg gcctttaggg ttttcccatt aaagcttact ccattgatct ccgctatgca     36360
     caaataagct gcatgtggat tgtcgaagtc tgcaaacaca cattccttgt ttcctatgca     36420
     tgtcacagat actggcccaa aaacgctgag aagatcctgg atagagcttc tggatcctgt     36480
     aaaatttcct atgtacactt tgttaaggag tctactgtcg aactttgaag ccttgatgcc     36540
     ctcgtttggg ataacccatc tattgtattc tactacactt ctgtatgctg tgtccagttt     36600
     cccaagctcg ttctttttgg tattggatac ttcttctatg tcttggagga gcttctcgtc     36660
     ctttacaatt atcattctgg gcctgaggcc gtatagcttt ctatgaaaat gaataaattc     36720
     aagttccaac tccttggcat aatgctgagc aaccatcaag aagagttcct tgagaaaatt     36780
     agatttaaag gcaagggaaa tcctcgtcga gctacatgga taaaaagagg aacagaggca     36840
     ataaaagcga ttaacagcat actcagagca cctacacatg acttggccct ctttgggttg     36900
     gaaatagtca aatgtctgta tatgtacgaa catatccttg ggattccaag atactcatta     36960
     gacaaggctc ttgtaagcct ctgcagtaaa gtgtttttag aagagattta taatgaaatt     37020
     gaaagaagga tccagttaca tcttgaaaag atgctcaata aggaaataca ctcaatcgac     37080
     gagtgcatga gttacctaag tagtcacagg tcctcactgg atgaaataat tgttgggtat     37140
     ctcatgataa gatacagggt gtataaggaa tataaaaaag agacatattg cattgttgaa     37200
     agagttgatt caaagctaaa agttaaggca aggaaggcat tcggcttttt agttgatgga     37260
     tgtagaactt gctttttaga gtctaaggtt aaagagcttc tagctcaaag aatacacaca     37320
     gaatttataa ttgcaaagag agaagagatc tcccatgacc ttaccaaaga tgagatagag     37380
     tacataagag aaaactatcc ccttgtatct tgcttttaca atattccaga agatataggt     37440
     gtgccctatc tacgcttaag aaagagcttt gacgtcagat actttgtaga tgttttttgc     37500
     tggaatggat ttgttgaaag catcgagacc ttctacggag cacacgagga aaagctcctc     37560
     gacacagctt ttttaagggg tctgtgcttc cagatgtgca tagatagaaa gtacaatctg     37620
     aacttgatgg agaagtttat agatagatct acatcttttg agaaagcatt tatggaaggc     37680
     tatagaaaag tggtgttcca ggaatacaaa actgccaagg aaagattcag aatggttcta     37740
     gaaattatca gggacttaag actaggcatt gttccggaga ttcaactctg ggtgtacgat     37800
     cttctttcca tgtgccacat gttttgtggg gaatacttcg aaagtgtgtt ctatctgaac     37860
     aagggaattg aactgtctca caggtatcag ctaggattcg tttctttgca ttttctcaat     37920
     tgcaaattca tagtggagag aataggaggc atacaagggc ccttcccaaa aattagactg     37980
     gacctggaag aaacaatcaa ctctcggttt gttattgaaa gcgagcagaa agcgataaat     38040
     aacaggattc ttacaaacct tctgctcaaa gatgacatga gtaatctcag agaaatgaga     38100
     actctcgaaa tatttgcaat gttcaagcct tccactcttt ataaagacat agaaagaaca     38160
     ctaagccgtt taaaaaagtt cacggttgta tctctatatt cgatagatgg atgcctgttt     38220
     atcaatgact ttagaggatt tgtaaaggta gatagggggt ttggagacac taaggtaaag     38280
     atgaatgaga tattggccaa atccagaaac gttctcaagg gaaatgtaac tagcgaccta     38340
     gacaaggcaa gatggtggat ggaaagaatg gaactggaca cacaattggg agaaatcctc     38400
     cgcagcgtag gagataagtt tgataggctc tcaattggaa aggatgtaat tctggttttg     38460
     gatgaaacca caacagagtt tccatttgaa tcaatccctg cttttaaggg taaaagtgtg     38520
     tacagagttc cctctctaga atacttagag gatgttcctg gacttgagat agataggaag     38580
     tcatttttct accttttgga tccggaaaac aacctcttca agactcggga aagaatatcc     38640
     ggctttctta gatcttcggg aataaaaaat ggaatcacag gaaggcctcc ttcagaccta     38700
     gaatgcaaag aagccgatgg ttacgacgta ctgctttatt ttggacacgg aagcggactt     38760
     aaatatctga aggtttctgg agaggggaag attatgtttt tatttggatg taacagtgcc     38820
     aagcttttgt gtgtagagaa ttataagaga aatgggtcca ttctaaaaca tcttaggagg     38880
     aattcaatga tagtcggatg tctctgggaa gtcaccgata aagacatcga caattttagt     38940
     gtcaaggtta ttgagagcct gataaacggg tctactaata ttggcgaggt agtttctagg     39000
     tttcgtgatg aatttaagct gaggtatctg aacggtgcct ctgtagttat ttatggcttt     39060
     cgctaaagct caaaccctca aggaagctat taattcttgc agtaaagaac ccaagatgtc     39120
     ttggtatcat attcaggaca aaaggcttaa gctggcgatt aaggccaagc caaatgctag     39180
     atgcactcaa gtaagagaaa taacagatac ggagattgtt gtaaatgtaa ggtgatcaaa     39240
     ttaattttag gtaaatgcac caccgacaga taataaagct aataaggagc tggtagagtt     39300
     tgttggtaag atgcttaaag tcccgaagtc ttcggttaag gtagtggtag gtgctagtag     39360
     taccaataaa actattgtgg tgagcgcttg ggaaggagat gaagagaatc tgaaagcagc     39420
     tgtgaataaa atgctagagt agagatctgc catgaatcca tatggtactt taatttggat     39480
     aaaatcaatc gtctggcctt ccatgatgct ttacaataaa tggatgattt aaagcttcgg     39540
     caagcctcat tctgtcactg ggatttaaca taagaagctt agagataaag tccgaggcat     39600
     tggagctgat tgtttctgga atcgagtatt tcaatgagtt gattttcttg taagcctctc     39660
     tcatgttcct gttcttgctt tcaaatggtg ttttccctat gaggaactcg tatgttaaga     39720
     ttcccaagca ccacaagtct attccagagt cgtgtatgct gttgttgacc atttctggcg     39780
     caagatactc cattgtaccg cagaaggtca ttctcctctt atcggcattg tagaccgccc     39840
     atccaaagtc tcctatcttg aggaggttat ccgatccaag aagtaagttc tctggcttta     39900
     tgtctctgtg tatcacattg cattccttca tgtacatcag agccagtatc acctgtctta     39960
     tgtataggga ggcctctttc tctccaaact tgcctccctt ctcgctcagg aacttgaaga     40020
     actccccctt tcctgcatac tctaatatca ggtatatgtt atccttgtcg tggaagtgtc     40080
     catacatcct aaggatgttc ggatgcttca gattggaatg tatttctatt tctctccgga     40140
     tttgccttgc tgtctcagcc gtttggatct ccttaattgg aatgattttc aaagcaacta     40200
     taaacccttt ttctttctct cttgcaagcc acacctgccc gaactttcca cgcccaagta     40260
     accttcctat ttcaaactta tccagagtcc aatattctac catcccaggg tcttcaaggg     40320
     aaatatttat aagaacttgc gtttgtcacg agctcagaag agcattaagg acagaatata     40380
     tgattgtctc tcgtctagat ccatatgttc ttttaaccat gtatttctct tttatcctgc     40440
     ttatatgggc actagatgcc gctgcctcct tctctgtcat gcagatgagt atactgtcta     40500
     ttgccgagca aaatgttagg cacacaacaa gagcttctgc tctgtagtct atctctttgc     40560
     tacaggttag atattccttt atgtaattta tcaactctat ccttatgttg taatcactca     40620
     tagtaatctt attgaatatc aagttcttat tttcgactct acatatccgt ctttcttcaa     40680
     gatccttata aactcttagt ctgacatttt tcatatgaac acttcctcct cttttttctc     40740
     cgttgagcct gtacatgagt tcgtcaggag gtagctggac ctgataaatc ttgctcatcg     40800
     cctctagcag aagtgaattg tttaatgtat tgtctttccc caccactctg ccttctttta     40860
     agcctattgc tccgcaaagg gcaagctcaa tcactatgca ggccctcaaa gacaaggaaa     40920
     cgcggttgca taggaactta atctcacttc ttgtccgaag taaaattaca agttgctcat     40980
     atagtctaag agagcctttt gtttctatat gttgagaatg ctcacgtttc cgtgttgaca     41040
     ttgattccat ccagggcccc attggttgtg attattgttg tagactggtt ggttttgaag     41100
     tagccaattg caatgcttct aaacaccatt aggcacagaa ccttatcctt gaaattcctt     41160
     ttgctctacg agctccttag aaatgccaaa gaccccagag ctcaaaagat tgactgtgta     41220
     tgatatccag aggatcttat gctgggcatt taatctggcc aagagacctt catttctccc     41280
     cttaaaggca agcgatcgcc caagcacaat aaatatcatt aaactagaag agactccaga     41340
     aagcatctca aagcttttgt caaaactcaa gatagagcat attgcacttg tgaacgagcg     41400
     gttgccattg aatagcattg tagaatgtat tcaaagagat ggaggatacg atagtattgt     41460
     cccatctctt gaatatgtaa gaatggagaa tctaaagttc attcctatgg taagatttga     41520
     agacatatgt tcctcaggaa tattcgtcga tgataagaga tccttgctgg aaatcgatcc     41580
     aagtaaatat agaagggctc gtatacctag ctcctatgat ataatcgcac tggatataga     41640
     aaaggtcaaa acacagaggg gaaaggatcc aggaagaata acaatggttg attctaatgg     41700
     aaacgctgtc tacgacaaaa taatcaagcc aaaagaacct atactagatt atctaaccag     41760
     atacagtggt ttgacaaaag agataatcga taagggaatt gatgttgaag ttgtccgaaa     41820
     cgaaattttc gactttattg gtacaaacac tgtgattgta gggcatggga ttgaaaacga     41880
     cttgagttcc ctagagttgt atcacaacaa aataatagat acggcacatc tgttcctgaa     41940
     tccatctgga agaaagatat ctcttgcaca actagcaaaa atatatcttt ccaaggacat     42000
     ccacgcagaa acacatgact caaggataga tgcaaccact tgtcttgaac ttctttcgat     42060
     gaaagtacaa tacatgctca ggataacaga tccagaaagt ccaaaactaa aactacaggc     42120
     aaaaacaaaa agaagatgca ttctcgacat cttaaagcat aacagaggat atcttaacat     42180
     aacagcttgt agctaccggg acttggccaa atccttgaga tcctacaaga agaccaaaga     42240
     atgtctctgg atgttaatct acgagattga taataatgtc tacctaagct tctaatacat     42300
     ctttatttat catctctcta cccattcacc tttaccaggt ttgtccaata cgataacatc     42360
     acaaaagtct tcaaagaggt cctctacccc cagaggagtt atcaggatac cttggaaccc     42420
     actttcttgg aaaaaatcca gaagtagtct tatggcttgt tttctattta gatcatccat     42480
     gaacacatcg aactcatcaa ggatcttaat gggacatgaa agtgaaggcc aaagggagag     42540
     aagcaacgaa acacatgcga aagatctttc tccacctgaa agcatgcttc tagatcctac     42600
     cgaggtctct ccatcaacct tcatctttac atccagtctt ttcttatcgt gattaaattc     42660
     cagaactcct tcatatcccc tagctttcgt taccctagaa aactccttgg ctgcattatt     42720
     ggcaatctct ttccgcataa aatctctttt ggctattctc gctgtgatgt tttcaagagt     42780
     cttttctatt tttccattat gttcagaaag aaggtcttct tttccctttt tggctttctt     42840
     tagatgagcc acagtagcta atgccttttc ttcatcatcg attcctttgc acatgtcgat     42900
     ttgtgcttgg atcgaaacta tctctcttct gacttcgtct tctgtccttg attctatttc     42960
     cttctttcca ctcttgagga gtatgccttt ttctgcattg taaagatcca cctgctttaa     43020
     atgttcttct tttagcttaa caacttcccc tcgtgacact cccatctttc tctcaatgct     43080
     tgagacttct gcgctcttcc tgtaaatctc ctgtcttagc ttttctgtgt tttccacctt     43140
     atgctctttg atctccttgt actctttttc caaaatttca atctccttgt taatttcata     43200
     ttgcttcttt tctaacaatg agatttgatt ctcaaggctt ttcgtttctt cataaaggtc     43260
     atcgttctgt acaacttcca tttgtgcatt atatatctgt ttttcctggt tcatctcaat     43320
     ctccagagtc ttgcaagtcc tttgaagacc ttctatcttc tctcggactt tctccatctc     43380
     attgcttatc tcctccagct tcttccccca gcttttctca atcctcccct ccactaggtt     43440
     cttcatctct gccctacacc tttcaagctt ttcacgtgtg ttctcaaaat aaaacctgtc     43500
     tactcccctt gtaacaaaat cagacatact tcccccaact agcctaatct tgtctccgtt     43560
     ctttgtatat gcacactcta cagatgcagg tcttgatctt attatttcat aagcttcctt     43620
     ccgatcctca accagaatcg tctgctcaat agaggctgtt attatcagat aatttatcac     43680
     aaacgggctt cttacctcaa ggatatcaag cactgtcttg tatttctcgt ttgcccggta     43740
     ttttataaca tttggttcct tgcttgagag tgtcgaaatt ggaaagtcta ctttatgctt     43800
     cctaaagatt cggagcaaaa tgtctttgtc tcttttatcc attataataa aggttgacaa     43860
     gaagttattt agtacaatgc taacagcctt actccacttc tgttccttga gttttacctc     43920
     aaatccaatc ggaccgataa tctttccatt gaacctggtt tttgagatct catctataac     43980
     attagggaag ttgggcccaa aaaaactatt cttatcattc ttggagtaaa attcaatctg     44040
     cctcctaaga tggaaaatac ggccttgcct ttcggaaatc atttcctctt cctctctcgc     44100
     cttcgctctg cattccttag ctctttcctc aagactttcc agtatcccat tctgagactc     44160
     aatttcagat gccgcttcct tgtgcttttc ctcaagttgg ggaagtaagt ttttcaccgt     44220
     tccgtcttgt ttctcaaaat cagaaataat tctcttctta aagtcccttg cttctttcaa     44280
     ttcctcgcag tcatttccta tttctctgtg cttcattctt agtttaccaa tcgtctcatc     44340
     aatctcttcc cttcttttat ccttgctctt tttcttttct ccttccgaga tttcaatact     44400
     gactagtttc tcctgggcat ccttaacaac tcgagtaagc tcttccattc tttcactatc     44460
     tctgtccatc tcctcttgtt tgctttggaa cttctcaaaa cacttctcca tctgtgcctt     44520
     tctttcattt acctttgccc acaatatttc ttcctctaat tcaagaatgg ctttttccat     44580
     ggctttaaca ctcttgatcc cctcaagcct tccttcctca tcctttatct gtttgtcgat     44640
     gcctttcagt tcctcatcaa caaggtttat tctttttctc atcgcatcta cactgctcat     44700
     cgactcatca ttcagcttgc atatctcggc aatctccgtc ccttccataa acagttcata     44760
     aagtgtctct gcgttcgtca tattcaagaa cttcttggct tgctcttgtg aaaggaagtt     44820
     cagaggattc tcaaatctta acgaaaaaaa ttccagaact agctccagat cctcttttct     44880
     tgtcgaccag acttttcttt ccccatttac gatactgcta gtggccgact tcaatccaat     44940
     tctcttctca ataatgattg ttcctccaaa gaactccctt ttgaatcccc tatgattctc     45000
     caatacaact cttacaacag cattggactc cccactcttg atcatatctc tgaaacaact     45060
     tcctcgttcc agattgtatg ctctctgccc aagcaccaat ccaattgcaa ccattattgc     45120
     actctttccc gatccgttac atcctgtcac tatcgttaga ggctttctta gattaatgag     45180
     aagatggtca tggcacatga attttatgag ttcgatagag gctattgttt tcttaaactt     45240
     ctcgcaactc attcctaagg ccttttcttt tccagcctaa atccagcctc gaaagttcca     45300
     aataacattg aaaaagataa agtatccgaa gaatgatgga tggactttac ttatattagg     45360
     agtagggtgt tgatgattaa acaggaattt aatagcatca tatttaagcc agggacgagt     45420
     actttccaaa agatggtctc atgtaggatc ccccactagg gaagaaccca gctttctcag     45480
     atgacttgga tgcattgtct ttctccattc cattctctcc ctcagcctgt tcttggcctc     45540
     cttctaatcc agagtcttct cctcccttgg cctcttcgct tgccttttca tcctcaggag     45600
     tggttggctt ctccttaccc tttgcgccct ctttgctttc aggtgtctta gcattagcat     45660
     tacctgcttt ctttgtcata ttattgtatc cctccatgta ggagaagtcg ggctttggaa     45720
     tgaatttgtt ggaagcccca aacctttccg atgcaaatgc caccctatca aggctctcaa     45780
     ggactggccc tgggacaaac ttgacctcat aggggttgac ataggttgtt gtttcacgta     45840
     caatggccaa accgttctca agtaccatct ttctagtcat ctctggagta aaagtatctt     45900
     tcatggtcgt cctggtaact agatattcat tctgatagtt actgtcacta tccccagcga     45960
     actcttcctt tccagaagtg gtcttttccg aggcagcaac cttgtacagg taacaggcgg     46020
     ccagcttgaa tgtggtaaac ttcatagtct tgagattatg aaaatcgtgg tttaaatagt     46080
     ttttcttgct cttacaatgt tttggatcta ccaatagtcc acgggcctat gcctgaaaca     46140
     cttctcagat tgatccacct attcttcttg cagtgtctgt tatggagtct taatggatac     46200
     agatcacata gaccaagctt ttcttctggc cctgttaagc agaccgggct tatatcatgg     46260
     attttatact tggaaattaa ggcccttgaa atggtagtac aggagaggaa agacaacctt     46320
     cctccaaagg gactaagaaa tagagggaac acttgtttct tcaactcggc aatgcaatgc     46380
     attctatcga tcggcgagct caacaccttc tacaagaaca cggatttccc aaaagaaaaa     46440
     gtaatatcta atgcatttaa acaattcata tcggagtatg aaagtcgggg acacaacgac     46500
     ccaaagagtc ttatcgataa gcttagtaca aagataaagc tgttcaacgg gatgcagcag     46560
     gattcccatg agtttcttat tcaattcatt gatctgttgt atacggaatc ggatagaaac     46620
     aaaggtagat ttgaatcaag agaagagttt gaggaggttc ggaaacacaa tctgattgca     46680
     aagactttgt tttcgatgga tagacaggta ttaacatgcg aagcatgcag ttattcctct     46740
     gtgacacttg ctataaacag cacgattctt gtagagcccc gtgagactat ccaactagga     46800
     atagaccagt gttacgaaga ggtgaagctt gagggaaagg atgcctggaa atgcgacaag     46860
     tgtggaaaaa agaagagctc taaaaagaag atagagattc ttgttcatcc cgaagttcta     46920
     ataattcata tctcaagatt ccatccacaa gggtggaaga atacagcaag tgtcaatatt     46980
     gatgacacat tgtttttcaa caatagaaaa tacagtcttt ttggggttgt ttgccagaat     47040
     ggaactctga gcggaggaca ttattttgca gaggccaaaa gatctggtac atggaatgtg     47100
     tacaatgacg agcaggtgac aaaaggctcc aagacctaca gtggagcaca tccttacata     47160
     gttttctatg ctctttaaca atggcgacaa ataccttact atcctctccc gcttggaagt     47220
     tgctcatttg atttgtcttt ccttgtcttc aaagacctgg agtgatttgc caagagatgg     47280
     tagtcttatt ggtgttctgg gggtacaaaa gcaatgattc cggattccaa agccgatggt     47340
     attttgtatg gaaaacttct ggagcatagt tccatgcagg agtaaaagag aggagaaggt     47400
     tattaaaagt acctatctaa agagctatga ggcaactcaa agtgaatgtg aatcggattt     47460
     tttttccgat agcggtggac ttgacgaagc acgtgggaag gacaactccc gacggatgaa     47520
     aagaaatgaa agaaatattt ctaaaaaaat ccggaaaaca agttctagca tggtttcaga     47580
     gccaagaatc gatgaaaaga agaaacaaaa gccaaggacc aatagtactg tgagtagcga     47640
     ggaactttgg agtggtgagg atgaagaaat agttgatcaa acagagtctt tcagcggatt     47700
     caaagaaagg aaaagagata ggaatagaag agggaagtcg gaaggtaata gagaagtctc     47760
     ttcagaggat tcacactttg aagacatcca gggcccgagg agatcttcta ggacaataga     47820
     tgcatctgcc aagaagaccg agatacttga gaagtataga agtaggatat atcgtgacaa     47880
     caaaaaatcc cgcgatcccg aggatatttc aagggaatct ggaatcgaat caaacgatta     47940
     tggaaaagag gaaaggtttt ctaagtcgca agggcttaat agatttggag actccaaagt     48000
     aaatgaaaga gatgcccgca actttgatga tagcgaaagc gaaatcaact ttataatgga     48060
     cgtatacgac aaatcatcac tgaataatag cttgagagaa aagatgtttg aataccttaa     48120
     ccaaataggg aggaaaggat aagatatatt acatccatta aacctagtct ctaaaatctg     48180
     cttcttttaa ttctgttcca tctgaacagg atggacaagc ctttcctgat ttccaacaaa     48240
     tatatttctt attttatcgc tctgcttctc gcctaaaggt ctggaattct ttccatcgga     48300
     gtcccagact ttaaattcct ttagcaatcc gctgttgtcc cctttaagaa atgaatggag     48360
     attactaatg ctttggaagt gaagagatag gctacgggct gcatttattc ctattcccgg     48420
     aatgttctgt aaaacatttt ggagatgctc aatcttttga tttgaagaaa atgtctttgt     48480
     ttttggtacg tggacgctct ctgaatacag atgccttact atggctttca gttctcgagg     48540
     aagatcctca ggatcatcga taaagacaaa gtttctaccg ttcttgattt gtgtgagata     48600
     gatttcctcc atcttttttt catattcatt tttcttcctg acgtattttt ttccttcttc     48660
     caatgctttt ctatattcct tgtcttctct cgcttttaca gaactccgat atttgtttct     48720
     gttcactaca aaagagatgt tgcggccaca agcctcaatt ccatcctttt ccaaatcgat     48780
     aactcctaga gaatatactg tcttatggtt attacattca actatctcta aggactggtc     48840
     cgcggaaaac ttgtaaacaa atttccggtc ctttatcttg tttacaaacc tctctaaggt     48900
     ttgaggaaag acaaagtaat ggtttgcaaa ggccgagtca agattcttcg gaaatgaatt     48960
     ctgctgtgtt tctgaggatg cctttagctg aggagcatta gatatggaga gtggaatgtc     49020
     gagaatggta atcgaactgt cggtatcggg gacgtttcct gaagatcttt cattccctac     49080
     actgctcctt tccaaatatt ccatgagatt tacatgctgg ctgttcatca aaagccccca     49140
     aaaacttctc aatttatctc taccctctct ttggattctc aggaagaagc ttaatatacc     49200
     ctcttctatt agtattaagg tgaagctcct tggatctcga aggatttaga taaaacatcc     49260
     gaatggcctg tccaactttg atgtctgggg aaggattcca ccatgtcact gtgcattctc     49320
     cgctactatc tctgaccagt agcttggtat acatagtgat ccttacatca tgcgacgaaa     49380
     agactctttc tgctttcctt gcgagatctt ctattctatc cagttcgggt tcgagatcat     49440
     cagttgtatt gctataattc tccactttta caaaatactt tgtttcgatg atctttataa     49500
     caaccccttc aatgcagcag acagggcctc cattgctaag gatttccgat atcttaagtc     49560
     tgaaccctat tctttttcta tatccaagtc ttctcttgga atggactact cggactccat     49620
     tgtaatgcag cttaagacgg acattctcac aatcaaaaat ggatattggc gtgcttccct     49680
     caagatctgc cccaaagacc ttaagtctaa atccaactcg gatctccttc ttttctatct     49740
     ttttttggag agcctcgtca tatgatgcat agagactgtg atatccatca aatacctcaa     49800
     tcttttctcc atctattcca acaaccaaga ggatcatata tctccaaggg acatcgtccc     49860
     cctccagaat tctccgaagt acagaatact cattctctag tcttatccta acctgctctt     49920
     ctattctatc tacaaaatca ttaaactcca gccgtctcct cccaaggaaa aaataaatcc     49980
     acgcccatgt aaactgagca aaaactcggt tcgtatcttc tgcaggaaac ctctttttca     50040
     tctccctata aaccctctca ggatctattt ctacttcttc cctctccact cttcgagata     50100
     aattgtcctg cgcttctcca tttgtatcta ctttttccat tccatcttcg aatattttat     50160
     atgctgagcg aatactctcc cttcgcacct ggatcttctt tttagatcct gttgtaaacc     50220
     ctgaaaacat catatcttca ttggtgttcc ctccttcgcc aagatctata tccaagatat     50280
     gatcagaatc caaagataag cgcttttgag gaaaagtatt gggattgttt tcatcagtgc     50340
     ttgttacacc gatgctgttt gtagaattag cattcatggc tttgcatcca tcttcaggac     50400
     tctcaggaat ccgagatgag tccgagttga agtcgtagaa tgtttgattt tcctgttcta     50460
     aggactcgga tacatcgggt tcctcccctg cagtgttatc tttacggcaa gcattgtctg     50520
     agctaaaaaa aatcatatca tcacaactta cttggattga atcaaggacg ctgaaagagt     50580
     cttctgtctc ttcttcgctg ttgctactgc tttggaagaa actttcaaat tcaacctccg     50640
     agcctgcatc catgggcaga atgcaggagg gatgctgtcg gaataaaata caaaataaca     50700
     atttattctg ttctcaatcc gaacagattg tttctatcgt tgttcactag aaaccaaaca     50760
     gttttgaaga agtgttcggg aaggatgagg gatgagtttg acttggctgt gtttgggtcg     50820
     ttgtagtatg attccttctc aatctccttg gtatccttga ttcctagctc agacagcgga     50880
     agaatatcga catctggccc tcctcccatt tcagaccagc tttctagaag attgactctt     50940
     tccacaagaa ccctctctgt aaaggtgtcc aaatactcct cttccttgat gtttagagga     51000
     tagaagtggc aggacttgta gaacatcttc ttaaggctac tgcggaatat aaatgtgatc     51060
     agaataatgg gaagaagaaa catcgagagg taaaatctct tgtccgaaga catctttgca     51120
     aaggttgcca cctggaaaaa tataagcgaa aacattatgt tctggcatgc agagtcccaa     51180
     tatccccctc cggactcata ctggtttcta gaagcataca aaaactccga cttaaacgtt     51240
     aagtagttgc ataagtagaa aaacgctccg agtagaagga ttggcgggca tatgactgcg     51300
     tagacaatag acatcgaaaa tacagtcaga cacgacggga atatggtccc gaagtcaaat     51360
     ggaggagaga actcggcatc gaatctttcc ctccttgtct ttctccccgt aaatggaaag     51420
     ataatgtaat ttatcagcaa cggagcaggc ttcagcagtg ttaatgcagt tcccactaag     51480
     gtcctttgga taattgtatt tgcgaaaaat acagacgatt ctagggactc attactgaac     51540
     gccttgatga cattgtatat tctttcattt cggaacagaa catctgcaaa gagcctatag     51600
     aagcttgatg caaagaacac cgagacaaac ccgttgaaga acaggaagtt ggagagtttg     51660
     tccatcagct tctgttggaa agttgagtat gagtagattc cttccatgtt cacaagtgcg     51720
     gttatgatcg tagggacaaa caccatcatg gagttgtaaa taagtgggaa taagattcct     51780
     cgcaaggagt cggtgatagt ctcatgcttg tccagaaacg aggatataag cttgttttct     51840
     ctaaacatct cggtgcttac tagcaaagta acaatgttgg caactatcga cgagaatagg     51900
     atgataaaaa gaatgaaaaa caccgcccca aagacactgt acatgtagtt ttcgacctcg     51960
     ctgtttgtta tgttctccca gatgacgtcg ttcggtgccg gggcatcttc cgatgcgacc     52020
     gaaaatattc ttgatcctat ttgtgactgc ttcactatat ttgcacttct ctggtccttg     52080
     aacgtaacaa atcctctttt ggtttttgag gggaggtcta gagtaaagta catcttgtag     52140
     ttgctgtaat tgagtatgtg atgaaacgaa aagaagcttg catcctgcga tatgtcacct     52200
     tgcaggaaaa gagtgttatt gtgtgaaact agctcgacaa tcctaacgtc cttattcctt     52260
     gcttcctcat tttttatgat ctccttttcc ttgctaattc tgccattcac gttattcagt     52320
     ttttccaaat agaagtttac ctttgggata tcttccttga gtgtgttttc gaactgcttg     52380
     gctccgtcca aaaatagaac aataagttgt ctcttctgtg aagaatcaaa aacaccctct     52440
     atgttggcct cctcaacagt tttgaggatg ctctctttaa atccagatat actttctgca     52500
     catgcttcct gattcttttc cgaccagtct tgcatctttg caaacttttc attgatttct     52560
     ttctcgatgt tatagatgta gctgtccttc tcactataaa gactctgcaa agtattggta     52620
     tcatatacga gtacacagtc atcaatctct ccaactccga gggaatcaat aaactcaaag     52680
     agatctatat cgttattcac atagcttggt agtctcgaga gaattagcgt tctgtttgga     52740
     aggttgacat actctgtaga cttctcggca cttccaaggt tgtttgagag tctcttcagt     52800
     gttattatgg acgtcattat tgctgggttg cgtagatatg cttgccttag aacgatatat     52860
     cttttgtagt atataaagat agagtacatt ataaaggcag atataaggta cacaacaggt     52920
     attatgaatc cataactttc ggactttggg tccaagcttc ctagagaaag tctaacaagc     52980
     cattgatcag aattctcgac gttctcccgc tggtttgtcc agaacaaata tcccagagat     53040
     gggataacaa agaaagatag gacaaagaga attctgtaca gcatcttcaa tgtctgcagc     53100
     atcataaatg catctaatcc tatgattgat aagagtattg tgtcgcttac cgtcacaaca     53160
     ggaatgatcc agctaagaaa cccggtgtag ttatagcacg gatggcaagg tctgtctttg     53220
     acgttgggtg aataaagcca tcttgccctc tttctgaaga tgatgtacac tattaggata     53280
     cagactgtga taaatccctg ggacactatg tttgtcaaca cagcattgtc agcccccttc     53340
     agaggaggct tttctactgc cttccccatg ttttccttgt cagcatcggc catccttgct     53400
     tagggactaa aaattttatc tttgtagcaa ccaataaaaa tatacacaca tccgtttgcc     53460
     agtgaaagtc ttctcttaag gagaaccttc ccatccattt ggatgcactg tttttatgat     53520
     acaaaataaa gatgggtgtt ggggtcgttt taatccgaag ggcctgtgag ggtaaataat     53580
     gcggatgaaa tttgtggcag agaagtcaac gagtcttcaa gatgtcgaag acgagaagca     53640
     agctaatgtt gccactttaa gagagaacga gaagatcttg attctgtccg ttgaagagga     53700
     gattgctctg aacaaacaaa atattggaaa cgatgtatat tatggtgcga aaagggcgtt     53760
     tttgtcgggg ggaaagaaaa agctggatga gaaacttgta tcccttggcc tggacgatga     53820
     acaacaacta atagtgtcta acttgataat gagtaaagaa ataaaaagat gagctttggt     53880
     tttttaatca caggcaatgg tgaaaacaca cccctatcta taatctactg gagagcctct     53940
     ttaattttct cctctagacg caaggactcg gatccctttg gcaagtaaat ggtgcatgca     54000
     gcaattggcc tatggattcc gcatgctaca cccagggcac tcttggaagg aatgtgaaca     54060
     aagggaacac ccttatcttc acatattatg ggcagaaagg ccgttatttc ctgcggctct     54120
     gcatcacatg ctatgacaac aaggagggcg gtccccttat taagacactt tgtcgactca     54180
     tttatgcctt ttctaacgtt ctttgatctt gtggctcctt ggattagctt cagtatgttc     54240
     tgtacttttg agtcggagac cggagagtat gtctgggtca ttgtcattga aggggcaaaa     54300
     attttggtgt ttagagccct tggatgaata tcaagtctaa gtatgacaag gtggtgaaag     54360
     ctctatctat ccgccaggta gatctatggg ctgtgccgaa gctgatgact cctcttgaaa     54420
     acagctttca gaccgaagcc attggagacg aagagatctg tattgtaccc aaggaagcca     54480
     atttccagct ccctaatatc ttcctgagga ccaggctgaa tcccgaatgc cagaagctga     54540
     tcgacagtag caagagtagt gaaaactgga acgacattat cgaaggggtg atagaaatgc     54600
     ttgaggaggc cgacctaact acgggtgaac acagccctac aactagaaaa tgccctgtgg     54660
     atcaggacac cctgaacaaa ctggtatttg agagatatgg gcacatctga ttggaagaga     54720
     tgatagacat actatttata tatgtttgga ctccattgga tgaattaggg atatcagctt     54780
     aaacctattg gtgggaagca atacttcatt tgtccttatg attagattgc ttggtcgagc     54840
     aatcactttc gatgatggat acattttaaa gatataaaga caaacagtcc atcgtctaca     54900
     tgaaccttac agtagaggaa ccttcgaagg taataaaaat gagggtgaat ggaggtaaac     54960
     accataagga gccgagatac aaaaaaacgg tttctgggga agaaggggaa ctttatccgt     55020
     ctatctatgg ccagaaatcc gaggaaaaaa gggttcttca gaaaagggct ctttttgagt     55080
     tgtatgatga tgagaattgt ccagatggag cgatgttcaa tacaaaggag gtttctattg     55140
     atttctttga tttgaatccg atgaaaagga aacagcaaaa agaaggaaat cccaagagtg     55200
     gcggagttag agaagtggaa aacccatggg gtgggaagga caagggtatg atactggaaa     55260
     ggagctttat agagagtatg ctagaaaacg acatccgggt caaagatata aagtatggag     55320
     aggaccttgt atttatatat tttttcacag tggaagattc tatatcgttt tacaagcagt     55380
     tcttaccata tgcagaagta cacttctccg aagcatatga ctttgagcaa gctttatctc     55440
     tttcttcaga ggaatgggcc agtattgcac tactgaacat gtgttgcgat tcttcaaaga     55500
     tcaaggaaaa ctctgttcag cctccagatg aaaaaataca tttggaaaca agcaatgcat     55560
     tagaaaatgg attccaagca gatgaacgga gtgaaagcat aaaagatgag gagacatcct     55620
     tatttagatg cacgggattt ggtagtagcg gatgggactg tgagttgtcc caagaagaaa     55680
     tcttcacaag aaaaattgag cacttcacac atctcaggaa tttcttctcg aagagcgagg     55740
     taaaagccat gtcccagagc ttggagatgg gaaatgttga ttttgtgttt aaaaacacca     55800
     aagaactggc cgttggaaac cagtcaaaca aggtgatgca ggaggcaata ggccttctcc     55860
     ccgagactgg aattgctcga attattcaga atcttggaca tgacattgct cctatagcag     55920
     caaacaagca tggagcatat actatccaga tgctgatttc gatgtcaaag acatcgctaa     55980
     cccagaatct actatcgaaa tactttagga ggtttggaga gttcttaata acccatgaga     56040
     tcgggaacta tactatccag aagatactta ggtttgatgc gaatcttgta tttgagcttt     56100
     ttatctcaag aatcggagat gtcgtaaaaa acgagcttgg tataaaggtt ttgaagagat     56160
     gtatagagtt ctttcccgat aaaaaaggct tcttggccca aaaggctaaa gagcatggaa     56220
     agaacttgac cactctgcta ttttaggatt gtattaaatt tatttttcat attcaaccag     56280
     tccaaccttt gccttcaaat cggaaatcac tttgttatgg taggcttcgt caacaaatac     56340
     tctacaggga tcaaattcca caaggggttt tgtgcctagt gttgtttcta gaagtaggat     56400
     tgccccatac acatcatttt ccgatggttt tccggaattc agcagcttgg aatgtgcttc     56460
     tgtaagcctt gcaaggctct ctagcattct aacggtgttg aattcattag ctccctcggc     56520
     ttttctttta tagtggtagt agctcatcag aacagagtta aggctgtcgg gaatgactgt     56580
     actttttttt cttacagttc ctatgtagct ctttaaaatc ccactgcccc agtactttgt     56640
     ttcttgtttc ttctcggaaa gtctcttctc aggatttcta ccaaggatct tatctacaat     56700
     catcaagtca ttactgtggc tattcccatc aaataatcca aaaataagat caaacctgct     56760
     ggctaagggg gttgcaatca tggtgttttc cgagacactt ttgtcaaagt tgtatttatg     56820
     tctcgtgttc accactgcaa tgacagaaca tctggtattc aatgaagaaa caatccctgc     56880
     ctttgctatg ctgagtgttt gctgctccat tgcttccaga agtccgtttt tttcattaac     56940
     cttaagtttg ttaaactcat ctatacagca aatccctgta tctgcaagta ctagagcccc     57000
     tgcttccaga acccactctt ttccttgcct cactgcacat gccgtgagcc cagcttgcga     57060
     ggttcctact ccattggtca gaactgctgg ggacagaagc ttagtgcatg tcttgaggag     57120
     atgggatttt cccgtcccag aatctccaac caagagtaca tgggaatttg accttgtaca     57180
     tcccttttgc tcttcatgga atccgcttac aagagccagc agaagtccaa gcttgacatt     57240
     ctcgagtcct tgtatctcct ctccaaatga attaataaga aacagtcttc tttggaagca     57300
     ttcaagccca tccaatctgc ttataaatgc tcttccaagt gggtctccca tagattcatc     57360
     gtcttgctta tgaactgcaa gtgcatgcat gtatatggag cttgccattg gttcccctat     57420
     cttgaatggc ttccatctca caagaattac tcctgttaca agtatcttat ctccgggaaa     57480
     aaactttcct gcaagatcct cctcgagaac aacttctagc gtctccgaca ttgagttggg     57540
     atttcctatg tcctggatcc ttatcttttg actcggaatg gcctccccaa agcaccttcg     57600
     atccttcaga agagacgatc cacaggattc acacagcatt ttaccctttc tttttcccga     57660
     agagcattgg tatgccttag aattgcactt cagacacacc aactcactcg tgacatttct     57720
     tatcaaagtt tcataggctc ggataagtgt tccactcaca gtgatgatcc gattgatgtt     57780
     cttgctgtag catgctttat ctgtgaacaa tgcatatgga atccctttaa gagtcctctt     57840
     gtatatgtag tgatgggcag aaacctccag tgcaatacta tttgccaatt ctggattctt     57900
     cgagcaaagt tcaattaagt cgagttcctt ttcctcttcc aaaaccatat ccccacaagc     57960
     tctttcgctc tttcaacaac aaaattttaa ggcttcccta aagagagagg aggagctaca     58020
     tctccttgtg gacaaagagt agatttactt tggatcccag aaaaacccgc aggcctaaat     58080
     aaggagaaaa cacaaaaagg ggaaaaggag ttaactccaa ttgatgaatt caagcataaa     58140
     acaaaataga cagagaatag tcaatgatgg aagataagca ggaaaaggta cttgatgcag     58200
     caaatgttgt ggaagcaaag gcaatgaatg caatagataa tgttgagaag tcgagcattg     58260
     gaaactccat tccacttgag gtgagtctcc ccctccgtga gctaacgaag tacctaatgt     58320
     tcttcactat atttgagtcg attcccatat acttgattac ttgcgaagga aacaaaaacg     58380
     agtttcttca ttggatttca aaagcaactg ggtttgtttt tcttatcata gccatcacgg     58440
     cagcagtatt agacctggtt acattttacg gcaagctgtt ctatttgtac aagttcgttg     58500
     tgcctgtaac tcttgtaaaa tccgccatag catttgttgt tgtagtcttt tccaacatca     58560
     gctcgatgta cgttgtgatt cttgctatat tatattccct gagaatcacc gtatttgatg     58620
     cactgtttct atactacctt gcaatccttc tgagaagaat agagtccgac gattacgaca     58680
     acgacggaga gcggctcaaa gcaaaggaat caaagggaga gaaagtatga ttaaagactt     58740
     tgaactatgt acaaaaaatc attttcaact ctccttgtgc gccccaaagt acaagcttga     58800
     ctaaatacat tttttaatca ctatggtaag taaggccggc ctcattgtgc ctttatcagc     58860
     ccggttatca tcccatcctc aaaatcaaac tgctccttgc cttcatcttc gtcagggatc     58920
     actatcttta ttctttcaac cagaggattc ccttggttca ctccaaactc ctctgctatt     58980
     ctactccacc agagggccaa gagagcattt ttcttgactc ctatcccctg cttgtagcat     59040
     tcagagacta aatatgctgc aaaaacattc tctcttgtag ccgccttgag gccaagccga     59100
     aatcccagct taatattctt ctcaaccact ccatccagtc cgtttagaaa tagagccgaa     59160
     agccttgtct gtgcatcaga ctgcccaaga tctgctgcct ttatatacca ttctatgctc     59220
     cttctcatgt ccttctcatg tcccatttct ccgttctcaa agcattttcc cactctgaac     59280
     tgacagttgg ggcagtctag agacgcccct tttagataaa gcttgaatgc atacaagtca     59340
     tctggggata taatgtccgg ccccttgccc ttctcatggc atcttccgag gtcgtacagg     59400
     gcatatggat aggtatatgt tgccttcttt gcagctagcc tcaagtagaa gtaccctatc     59460
     ttaagatcgc agtctctttc catcctttca aatagcacaa ttacgccata ggtgtgcatt     59520
     gcatcaatca aacctagttt ggctgcacac ctataaaaat acaccgcctt ttcgatgttt     59580
     ctcgcctttc ctattccctt ttcataacac tgtgcaactc ggaaggttcc aacagcactt     59640
     cccagctggg cagctactat atagttttca aatgcttttc tatcgtccct ctttatccca     59700
     aagaggccct tttcatacga aagacccaag tagtaatata cctctgcccg cgacattgga     59760
     ttcaaggcct ggatcaagtg gctggagatg gatttcctca gtagtttctt tatagataga     59820
     cgctgttttt cattaaggtg cctaagggtc ttctccagcg gcaatggatc tcccgggaaa     59880
     attctcttcg tatctcctct ctcgtcctcc atcttcctag catagtgtcc aagtatgact     59940
     agcacatcac ctacatcttc ttcaatgtca tcttgcagcc cctctgccaa ctcttcccca     60000
     actccgccca tcaacaccgg cttcatctct gttcgatatg ctttattcct tttgcaggaa     60060
     ccaatagctt ccctaaggag agattcatta ctgatggagt tagagcaatg gtcaaatggt     60120
     atttgattgt ctagagaaat tccgagctgt tggtaagggc cttgcgaaaa gttccaaggc     60180
     cgtctgagga ctgagattaa cctttttgtg cttttcttct gtcgttgatt ttatcccgga     60240
     caaaagagcc cgggatgttg aagattcaag actttgactt tgtaaaagtc gtaggagaag     60300
     gagcctttgg gaaggtgtat ctggtgagac ctaagagaaa tccaatgctt atttttgcaa     60360
     tgaagatact tgactttggg gaaatcctta agcagaggtt agctgaccag ctcgaaaacg     60420
     aaatttctat tttgaaaaga ctttatggat gtccatttgt tgcaaagctg tattcaacag     60480
     acttccatcg tggaaaggtg ggactaactc tggagtatgt tggaggaggc gagctgtttt     60540
     attggctcaa aaagtgtggg agatttgatg agaagatgac tcgattctat gcagcagaaa     60600
     tcgttttggc tttgaagttt atacatggaa aagggattct ctacagagac ttgaagcccg     60660
     agaacatact gattacgtct acaggacaca taaagctgat tgactttgga tttgcagtct     60720
     acgaaaacga gagtatatat atgatttcgg ggactccgga gtacatgtca ccggagaagc     60780
     tgcggagcga agatgatgga cgtgcaagcg attattgggg gctgggaatt ataatctacg     60840
     aaatgctatg cggagaccct ccattctacg atgcaagtgc tgacaccatt tatcacaaga     60900
     tactcgaatg ccagatcgtt ttcccccatt atgtaagtcc tgttgcaaga agcctgatat     60960
     caggactatt ggacaaaagt cgaaccacca gactaggagc caagggaata ttcgaaataa     61020
     tgaatcatcc ctttttcaag ggattggact ggggagaaat agaagatagg actgtaacac     61080
     caccgttcat cccaagcccg agctctgtcc tcggattttc aggaagcagc tcggaataca     61140
     gtagcataga ttatggagaa acagctgttt ttaagccata caagtatgtt aaacactttc     61200
     gaaaggacaa gataccgaag cggatataga tccgatgcaa accaaataaa ttcagagtat     61260
     tttcctttga agtagttaag taccaaatct tgtatggttt tttctctgtg gtgagtttac     61320
     ggagaatgtc cctatggaca tcaattggca aagaggagat gagggagccg aatttggcag     61380
     gaagaactaa taaaattttg ttataaatat tcttttgcta agaggggtaa gatgagaaca     61440
     gaaagcaaca gtggatcgaa gggaaccttc aagacgatga agctaggatt tctagggctg     61500
     gttggaatgg tggttgtgta ctatgtgctt ctgtttatct ttggaatcaa gtacttagac     61560
     ccggaatact atggaagtta tttctatgct tggagagtga actttgcaga caagatcatg     61620
     acacatggga gatacaagct cattaagaag aacgagcacc cggacacaga ggacaggaag     61680
     aagttctaca agatctctca agacgagaca ggcccatatc ttattcgatt tgatcgaccg     61740
     gagcatttcc cacggggaca cgagcatcag ttcacattga acttccctgg atatgaggac     61800
     ttcctaaaga tgcgggagag gtttattgtt gagtctgagg gattgcagtc tgagatggat     61860
     ctgagccact ctgatttgat tgaccggatg aagaagaaga aggaaggagg aggacagttt     61920
     ctggcagagt acaaaggcaa gtctattgag gaaatgaaga gcattctgtt tccaaagaac     61980
     aatgaagaaa agaatccatg gtttgaggtg agtaacatac tgatcaatgc aatatccaat     62040
     atcatgtccg acaaggctga ggatagagag ggatatctgt ttgatgggga gaagattgga     62100
     gacaagatga tgaaggacat tcgaagtgct ctcgaggagc tcgacagccg tgcagaagac     62160
     gaagatgaaa agctttcgga gaagataagc gattccgaca tcaacaactt cttcatcaac     62220
     aatgggagag tgtctgcaac accacatgaa acatttgctt actcacggat atactacctg     62280
     ttcaacttct tgacagcagg gattgagttc aagtctcaga agctcgcaga tctaagggag     62340
     ggggaagatg aaaacgagtt ccgggaagag cgaatgaatt atgttgcaaa tctgtttgcc     62400
     aggatatttt caagcatata ccctaaccaa cacagaaaag atgtcagttc gattggggtt     62460
     cttgagaaga taagaaatta ctatagcccg aagacggttg ttgaagagaa gaaggaggtg     62520
     gatgaggagg atctcaatct catcaaggac aaattctcaa cttcgtcaag agttcctgca     62580
     tgatcataat aaaaaaggta tttccatcat acgtttactt taatcgaaat cttttgtctt     62640
     gggttcggca tcttcgtaat attgcactgc attatctatg gaataaaaca gctcctcaac     62700
     actttcctcc ttgttccagt ccagcggatg gaagttcagc atgctattct cggcaacaaa     62760
     gctcaacatt cttttacata ttctagaata ctttcccctg ccaattagtg ccgaaagttc     62820
     ctctgttggc gtataaaaca tctcaagatc ctcactctta accaaatcca ttttcgaaat     62880
     aacattgata caaggaatat tcaaccttga catcgagaca agtgcacaaa agcacccgct     62940
     cacatacttg ttgatatcca ctaagtattg ggactccatc atataaacaa caccacattt     63000
     aaaatgccgg cctacatgat cgataatctt tggcattatc tcggagtgtg caaacaattc     63060
     tatttgcccc gggcagtcga aaacaagaaa ggcgccctca aagtcctcta gcctaagctc     63120
     atcaatgttt tcgtagagtt cctccagtgc aagcagaagc cccccatttg gtccatagtc     63180
     atactcctcc ataacatccc caacagtgat gaagtcccgg agatccaagg catacccttc     63240
     gccaggagct atctgcgcag gatccaggtt gatcaccttg taggttctgc ctacactctc     63300
     cccatgctcc tgtatatttc tgcagaatgt tgacttcccc gatccagccg gtccaaagac     63360
     aaaaatggca tatcccattc cagccctcca tgaggaaaat taataaagcc gtccattccg     63420
     acccgaatat tgaagagctt ctactctctc tccagataga gaatgaatcc cttgaagagg     63480
     gtgaagcttt cgaaagctcc tcttcactca tggacgaacc agagtgcagg ctcgccggag     63540
     acatagtcca cagagatctt cgtgcaacgg atgccgacat gaaagccctg atagaaggag     63600
     gaaaatgcaa gatctcgggg aactcactgc ctttttcact attcgaggtg atcaagaaaa     63660
     aagaaagcac cgaaacagct gttgtttcca atcagaagtt ccttatcgaa ggcggaaggt     63720
     atgactatgg atttaccccc aaagatctgg agaggtacag aatcaagcga aaaagaagaa     63780
     taaaggagac atgtcctaac tgggaagaca tttcagaaga aaaaagaaac gagccgagaa     63840
     aagttcacgt taggtctttg aaactccgaa acaaaagatg aaagcccgaa accactatct     63900
     tcaataaatc gatctacaag ctcaaattat atgacattct ttggtttaat aaccttcttc     63960
     atggaaacaa taccaaagat aaaggacata agagtgatga ggaagaagat gcctatggat     64020
     gtgctgtacc tgactcttcg gaatccgtag agatgcaggg cttctctccc attgggaatg     64080
     catctttcgg aatccttgca ttcgaaggtc aagttttcaa actgactctg tagaatggtt     64140
     tcaaaagcat agtacacagg agacatccat acagtccact taacaaactc cggggcctcc     64200
     tcagggttaa caaacatccc tccaagcatt atgaacaatg cagctactgt agacgaaacc     64260
     acctgtgcgt ggataagtgt tttggtgtgg agagaaacta taactccaaa tgatatagag     64320
     aaaagcacaa gcatcacaaa gacaaataca aacaatatga attggaggag gcctgggttc     64380
     aaacccacca cccagtacac cacaacggta taaagaacgc tagggattcc agatataaag     64440
     aagctagaca tcacattggc gaagtaagat tcaactgcac catacatccc tgcacagacc     64500
     tctcttctga gtgccttctt gtgggagtcg atgaatatga ttgaggaagc tattgacctt     64560
     tcaaggccgc ttataaccat aaacgagagg attccaaatc ggtctcggat gcctttctgt     64620
     gtgtagtcta ggcggaagta aacaagaaca agaaacagca aggttacaag cttttggaca     64680
     ctcagagtcc tcatgagccc acgtcttctg gaaaagtctg acaggtttct ttcaaggacc     64740
     agtaagaagc ttaaaaagga cttctgaagc atcactggga gctctatctt ctctattatt     64800
     gatgatatgg ccaagggctc tattcttttc caggatgctt ttagtctttc tatccttcta     64860
     gtagactctc tttccgacac tggcgatgcc atatcgatag ataggatctt cataaagaag     64920
     tccagcgggt tttcatgttt tttaagattg tatccacact tcttcaagaa gctcttacat     64980
     tctctaagac ttccactgaa cacaatttct ccttggcata tcattatgat cctgtcaaag     65040
     aacgaaagaa tttccttggg aaccctttgg aacgaaacca taattccctt tcctttactc     65100
     ttcagatcca taagaatgtt taggatgtga atgatattca gcagatcaag atcgttagtg     65160
     acttcgtcta taatcagcac cgagggtctc tttgcaagaa ttattcccag ggaaagcctt     65220
     actctttctc cagttgatat tgagctgact ggaatgtgtg caactttata cagtcctaga     65280
     ctatggatca ggttgggcac ctcttctgcc acaattattc tctgatctcg gttccttgac     65340
     gccatcactg caaatctcaa ggtttcctca accgtctgtg tttcatacga atggagatgc     65400
     tctcccacaa atcctacggc atgctcccac actcttgcat cggcaaagtg accatttagg     65460
     aggacctctc ccgatatcct tagtccttcc attggttttc ctattatcgc atttaccatc     65520
     gttgttttac ctgaaccgct tgctcccaca agtacagtca tttccgaagg ccctatcttt     65580
     ccctgaaccc gatggattac tgtttccttg aaaggcccct taattgattc cacgtttatg     65640
     ctcctccaaa cgatctctac ctttccattc gttggatcca tgggtggaag ggagtagctg     65700
     ttaaaatagt cctcctacca ttcaagtccc agaacaaaaa gaaagagacc tccatgagga     65760
     tcaatgccag acacctctga ttccttgtct taatatccaa agatttgttt atcctaaaat     65820
     gaagaggtcg attaaggttt gccattccaa aacatatgga tttccatcag gtgagaacat     65880
     atgccatcag gaacttgcgg agagcttcca gattctttcg gcagtaaatc ttttggtgtt     65940
     gcctgagtcg tttgtaagaa tcgagttttt ttccactcgt agaagcgttt tcactaatga     66000
     ttcctttaat gcaacagaca tctactctgt atacaggaac ggcgagcttt ttttcaattc     66060
     ctccccgctt ccatgggagt cggatgcaca gataccctgg gcagaatata gaaaaaggct     66120
     agtcgactat atttcaaaga ggctagctca cgggatagag aacatggagg gacttaacga     66180
     tcgttatata ttctatacaa aatatcgcct tgcaaattcc atcaatccaa gacagtgccg     66240
     aaaagacctc cagaagctct ccaaagagtt taagctattg gagaggatag aggttttacg     66300
     gctgtctaca caaaaagaaa tctcaggtcc ccttgctgat gaagtatata acatattttt     66360
     atcctataaa tcagatccag agctagaaat caggtttatt ttggaagtga tagacatact     66420
     gccgctgtct gtcattgtaa gaatggctag aagtattagc aaggcaagaa gataccaggc     66480
     tgtattactg tattacgagg tatacttgag atctctacag aaggaaagat acagaacagc     66540
     atttctgttt gccatcagtg catcaagact tcttaagcag ggggtgaact taaactttga     66600
     ggggacgatc aagtcagatt caatccgctg tattaaggaa aaaaactggc agatggtgtt     66660
     gaagaatgtg attaagggaa tagaggagtt agattcactc agatacgggg taaatccata     66720
     tatattacac gacattgata gatgtgagtt tactgtcgat tctgtggaac ttgactggtc     66780
     caacattacc aagtgctccg acacagtgct cttcaatgga gaaagcacaa gaacatactt     66840
     cacggatcgg ttcagaatca gaatcttatt ttctagaata tcttgtgcca atctccatgg     66900
     gatttcggga agtattgcgg gaggaccgga tatatttata ccaatatacc aggtcttaaa     66960
     tgaaagtcct gcagttgtcc aagtattctt tgatctagcc aaagtacttc cttctgcgga     67020
     agatagagcc agtgagcttg aactaaacct taaaagatta gttttctccg aaaacatagt     67080
     tgtacctatc gaccttgaga ttacctgggt gagaagaaag agcacagtcc acgtcaagga     67140
     tgccagtact atcgatgacg aagggaaaat catcgttctc cttgtattat caaatcagga     67200
     gggatttgaa tccagaattc ttgggccaga tgttatagag agaaatggat gtgagacaac     67260
     tgtttctctg catgtgtcca agggattcaa agtatgttta cgccatgaga tctcggaaag     67320
     catatttgag acattcgaac tcacatacta acttcaggat taacaaaacg atccactaaa     67380
     taacatatta cttgcctcca ttggccccgg aatcccatgt gtattgaccc tctcctaact     67440
     tcttttccgc aatcttgata tcttcaacaa actccacttg ctctgatttg gtaaaagagc     67500
     atcttgcctc gggcggatat tccacctcct cttttggaaa cacaaaactt tccacaatgt     67560
     cctcaacggt attctccgag acatccatgt cttcgtcttc tattgcttct tcactagaag     67620
     ctttttctgt ataatcctcc tccccaaaga agaccctgtt ccgaggcttc cggataaacc     67680
     ttttcttgag ctttctcagt atgtttctgt ttatctctaa catgtcgtgg ttgtgcttct     67740
     tggaaggttc ttcatagtct tcatcggacg aggcaataaa cgacagggca tcggaatcac     67800
     ctccatcctc ttcataggag gattctccat cctcagatgt ttttgcttcc aagtctatga     67860
     atcttttaaa tcctttggac ttcccagact tggactttgc ttctgaactt gaacccaaac     67920
     tcgatgaaga agaatgatgc aacggttggg cctcggtttc atcttggtct tccatttgtt     67980
     tactggaaga aaaacactca tcatcgcttg acatacaaca gactccatcc atagaggtat     68040
     catgacggct cttaagaaaa attaagtcaa aatcatcatc tttccttcca agtatcttat     68100
     tggttattct cttctggacc tctctaaccg caagttccct taagatctgc ttgcgatgtt     68160
     ccccataaag tcccatcgca tgagatattg tatagacaca tgcctttctg cttgtcaagg     68220
     agtttcttgg gaattcttcg gcttccttca tgtctggaaa taggttagcg ataaaaacaa     68280
     ataaaagggc tcccttatga ttgaagagct gaaagggata gtgagaaaca aggagacagt     68340
     gcttgaggaa aaagaagctg cagtccttga gatttttagg atcctgattt ccaagggtga     68400
     ctaccaggag atcggggcca ctatcatttc attgagagag acttgggaag atataacaac     68460
     acccagaatc acaaagatca taagaaacct ttttgaaatg atcccatact cgtctgacaa     68520
     ctttggaaat gttcttgagc ttcttactgt tcttgtggaa tgggcagaca aggaaaataa     68580
     gaagatgctc cgcctcgact tagagtgcaa aaagatatat gctttgctga agacaggaag     68640
     atattcggag gcattggcac agataggacc tgtagcccat gagctcaaga agtacgatga     68700
     caagatcaat ctcataacct tatatgtgta tgaaagcaag gcattctatg agataaagaa     68760
     catctcgaag tcaaagtcgt ctctgacatc tgcaagggtt cttgcagttt ctgcgtactg     68820
     cccgccccag cttcaggcac agatcgatct tctaagtgga atttatatat gtgacgaaag     68880
     aaactatgga gttgcgtctt cttacttcat agaagctctc gagggcttca cacttggaaa     68940
     gatggatcct gaagcctgca tatcgctgag atatcttatt ttgtcaaaga tcatggcaaa     69000
     taagagagag gaaatcaata cggtgatgaa gaataaaagc actctcaaac atcttggaga     69060
     cgagataatc agggtcctcc tcaaagtcag caacagtttc gcaaacagag atctgaagtc     69120
     atacaccaat gttcttcagg agtattccga gcagatacac agcgattcat ttatctgcag     69180
     ccatctacaa tacttgtatg atcttctcct tgataagaac atcattaaga taattgagcc     69240
     ttactctgtt atccgaatca gcttcatagc cgatgtattg ggctttggag tagacgtcat     69300
     tgaaaagaag cttagaaaga tgatcttgga cagagctgtc aacggcaccc tcgatcacat     69360
     agacgaatgc ctaattctgc aaggagagaa agccgatgaa agctttgcag acgaatgcat     69420
     gaaacaagtc aaggcattga attgtattgt ctcccctcgc tattaaagcc tttcgcagcc     69480
     tattttggtt ctttctttac ccatatggac atggcaaatg ctccagacaa gacctccggg     69540
     aaggtcggcc tacttttcaa gaccatgggg aaaatgattc ctgtcaatgc agtgtatgga     69600
     gacacagtat tagagactgc acacaagaat ggcgtggatc ttgaaggagc ctgcgaggga     69660
     aacttggcat gctcaacatg ccacgtgatc ctagaggagc ctctatacag aagacttgga     69720
     gagccttccg acaaggaata cgacttaatc gaccaagcgt ttggcatcac aagtacctca     69780
     agactgggat gccaattgaa aattgataag agctttgaga agacagtcct tacaattcct     69840
     agagcaacga agaacatggc tgtggatgga ttcaagccca agccccacta gctgggaaga     69900
     agaatatcca agagtcaaaa aactttattc cattccgtac acagaatgtc ttacaattgt     69960
     agagtctcca tttccgtttc tactgagtct atagaagtat tcaggcccgt ctctacttag     70020
     cagctggaca aaatcctcgt cgtgtgtgat tacaatcagc tggaagttgg aatccttttt     70080
     gtgcttcgag attatcttgg agagagtgaa tgcaaggctt tctatgttgt ctctgtcgag     70140
     attggtcgtt ggttcatcaa gagccaatat attacagttg gaagcaaagg aatctgcaag     70200
     cgccagtctt atgagaatgc tagctatcat cttttgtccg gcactcgacc ttcctctcat     70260
     gtcgagctcc acccctcctt tgataaatac aaccttgtag ttatatgttc tttggcccga     70320
     actctctgtc ttgatctcta tccagtcaac gtcatctcct cggtaagtat tcatccacag     70380
     gtccttcagc gttgcattga cttcttctaa cttcgaggta tggaaatcca caatagcctt     70440
     gtccaatgcc tggatgcact tctcgaggtc cagagaagat atctccagag ccttaacttc     70500
     aatgaagcat ttgttatagt cctctacagt cttttcatga tctttctgaa gctcctgcct     70560
     acaggacttt atccccagag caatctgctt gcattcccct agtaataatg acttctgtgc     70620
     aatcagcttc atcttctttt cttccaaaag ctgtttcttc tctctaagtc tggttagata     70680
     ctcaaagtca atttcagaca actccttctc tatttcttca attatccttt gtctttcgta     70740
     atacttcaca ctctcctctg ccaggacacg catttcatgc atagtacgaa tcttctgtcc     70800
     agcctccaaa acctcatttt tcttctcaag gagctcattt ctcacagcat caaacttccc     70860
     ttcatcctta gcctcatcac aatactcaat atgaagaagc ttcttcacct tactgttcag     70920
     ctcttctatc tctttttcaa gcactgctat ttccttttcc ttttggtaga aaatctccat     70980
     actcatttcc aactctactc tctttctcga aaacttctcc agaatcttct caaccctgcc     71040
     tttctttcgc aatacttcct cagagacttc tgcaatcctc gctcttatgc tactcctctc     71100
     aatctggcga atggcttctt ttgcatcctc tcgaaaattg atcttttctc ggatctcttt     71160
     ctctgcccta actacttcct gcttccgctc aagatactca atcctttctt tctttctttt     71220
     catctcccct ctcttctcct catagatctt ctttattcca tcaatcattg acttcagctc     71280
     ctgaacagac tctccttcct tttcatcctt cagcttcccc tctatcgaaa atagctcgga     71340
     aactaatgaa agataaaact ctgttttctt gattccctca gactcgtcca ggatgtctaa     71400
     ctccatctcc tctagaactt cctcatctac tatgccttcg ctaggctcgt atttcagaat     71460
     aagcccaaca atctcttctc gtttcctgtt tctatccatc actccttcat tgatcctctc     71520
     tatttccgtc tttcccctac tttgtctctt ggatgtattt tctttccctt ctaaagagac     71580
     tctttcaatt gcaagctcca gtcttctttt aaaccctatc tcttcctcca tagaaaagga     71640
     tcggtggcaa ataggacatc catggcttct tcttccatcc tccagcattt ctctataaat     71700
     cttttctctc cacaaactct ctgactcact tgtcatatcc caaagctcaa aggcctcctt     71760
     ctttccatag aatccttcaa agttcagtag gtcaactcca aacattgctg aatccgctcc     71820
     aaagaatgtt cgatttcttt ctacaatttc ccttgccttt tccacttcac actcattttt     71880
     gtagtagaat cctgaaacct ctaactctag cactgcttga tctccagctt tgagttgcat     71940
     ggctctaagc tcctcacact tccgacctat ttcccttttg attctttcat tctccttctc     72000
     tctttgcatc atttcagcct tcttaagatt tatttctgtc tcaatcttct ttgccttcct     72060
     ctccttcttt ctaagttcta ttctttgtct ctcaagtttc tggtgaagct cagagacatt     72120
     aacctcgctc agaatcccct caatctcttt ctttctgttt cttatctggc tcaccatgaa     72180
     gtttttctct gcaatgctat atgcatcgtt caacctcctt tgatagtcct ctaacctttc     72240
     ttccaaggcc tccatctctc tatctccact tatctccatc ttaagcctct ccatctcctc     72300
     caaatatgag acagaaacat ctatacttcc attgtcctca agaccctcat attcgtccac     72360
     tattcttctc ttctcaaaga ggattttcgt ccgattcccc tcttcctcct tcagcttccg     72420
     aagctcctcc tcaagctcat ttatacgttt ctttttgtct ccaatgtctt cctccacttt     72480
     cctgaaaacc tcaagagccg tttccctgaa gtccttctca accctcagct ccaatgaaag     72540
     gttcttaaaa gcctctgtct tctgccgttt tgcttcatct aacagagagg acttaacaga     72600
     tatctccgaa aacactccgt cgagttcccc cttactccgg agatagctgc ttcttttctc     72660
     gctcagactc ctgaatcttg cttccttttc ctctgcatcc atcttcatcc tctcgtacct     72720
     ttcctctacc ctcttcagga actctctgct caaaatttct cttgcttctt ccaactccaa     72780
     cctcttttcc ttcagcccat caataaagct ctttagttcc ttatgttcgt ttcttagcaa     72840
     atatgccctt ttctcccttt ccccattctt ctcaagctcc atatctatct cttcaacaat     72900
     tctttcacat cttcttattt catttccata ggcttcaagt tttatctcat ttctttcaat     72960
     agatccacat ccatttctta tccgtgactc cagcgattcc ttcctttcct tcatctttct     73020
     caggaactct agctcttgca tcttcatccg gatatccgaa gagcattctt tctttgatga     73080
     cttcagactg tccaaggcct tcccatattt cacagatgca aatatctcgt ctagcttctt     73140
     cttgacaaca atcggttctc caagaggcca tgtgctttcc tcctgatggc agaatataac     73200
     gttttccagt acactactcg acaccccaaa gtgctgtggc atctccgtat cgacatctcc     73260
     actccttcca ctcactcctc ctccatcctt ttcagcccac accatacttt ccagtgtttt     73320
     ttgttccttc ttacctcctc tctgtgttaa ctgaagagag cgcgaacata ccatcgtctc     73380
     cccatgcaca ttggtaaaca aaagcttcac ctgtccttga acctctacta gtcttgcaac     73440
     cctcgggtca tagataaacg ctccacctct actgtttgga ggaagacttc cagtactgat     73500
     atacttcagc gattcgatta tcgttgtctt tcctgttccg ttgggcccaa ctatcagtgt     73560
     caacggagaa tagaactcca gtatactacc ctctctatgg ctgaatgacc ttattcctcg     73620
     tatcatcagc ttcttaagag atgacattcc gcaagggatc caaacctttt caaagtacac     73680
     tttcaaaata ctacataaac tatagcttta tttttccaca catttgttca tcatcgaaag     73740
     cacttcctcg cttgcaaccc caagaagctc atccctctcg tttcgagcaa ggctactctt     73800
     tacttccctg tattcaagga aggtgttgta atcctcgtcc ccaatacagc tcaccatact     73860
     catttggctg tagagtctcg taacattctc aagctccaaa cagacctctg taatccttct     73920
     ggccaggccg tccacagact cagaacattc aagaagagat ctataccact cttccctata     73980
     tctttcaacc tcaatgcttt ccctcactcc ttcaatctct gctctataat aatcctcaga     74040
     ctctagtaca ttcatcagat cgtccgtgat cgtctgcaga tccaccgtca caacaacatc     74100
     gctcactctc ctctccggtt ggaaagagct cggaaaccta agaatatttc tcaaaacaaa     74160
     gtttgaaaat ataaagtagt ttcgacgaaa agactccaat atcgtccctg acattcgatg     74220
     tatctttttt ttgccaagaa acgatagctt ctcaatccct tccttcagaa tcccttctat     74280
     ctccccctgt agctcagaaa ctagggtcac aggtgcaaat ccaaagaact caatctcttc     74340
     ctcgcttccc atcctcaggg tcaattttct ttccccattc ttatccaaga caattaaatg     74400
     ataaaaagaa ccttctcctt tagtatccgc aacccagtac tattccactc tttatctgtc     74460
     atccacatct ccttgatgca gtccagccct gaaaacactc ccataacatt cattatcata     74520
     tcttcggctg agtccggata catacaaacc tcaggataaa tcccacactc ctcgaagacc     74580
     ttttttagag atgtctctga caacagagtt cccccatggt taaacactat caccttacct     74640
     cctatcttct tcatcttttc cttactaagg acatggttta ttctcttgcc tataatctca     74700
     tagatgtctc ccttttcatc atacatcttt aaatgcatct tgaagtgctc ctgaggatct     74760
     acatctggat ggcattcgtt ctccttctgg tgctgttgct gaaagtgtgt ttccatcttc     74820
     tcctcggtct cgtccttgta atcacatttc ccacaagaaa agatattttt ctcctcaaac     74880
     accttgatct tgttgaactc gtcgacaaag tctatagagt cggcaagctc aaatcccttg     74940
     ttgctttctt tagatacaca gatcccatcc agcatccaga agtcttccac aagacacacc     75000
     gtcgtgtagt tttcatagac attcaccaca acacagtttg gtgaaagagt tccgatcgct     75060
     tgggaaagac tccgtggcgt gatcagaatc cccttgaatg acaggacatt aatgaagagg     75120
     ttgcacatcg ccaatatctc ggtcctgccc agaagatctt ggaatataag agaaacaaat     75180
     gagttcttcg gttttatccc aagtttatga agtgctccag aaacctggtt ccccagccat     75240
     ccaatgcatt cctcaagatt cctaaatctc ctcgtattca ttcccgtcgg aaaaaagaaa     75300
     tcccccagat caatggactc cgactccaca agaagcttgt tgttccaaac cacaatgtgg     75360
     attatctcct catctgcctt gtagtttccc attctatact tttcgtcaac atagaacgag     75420
     acatcgcttc tcataaagaa gctttgtatg tttttgttcg gcgtagttat ttgctcaatc     75480
     tttggaactg tgcacagttt cggggtgtat ttaagcgcca tgggcttggg atttgatatc     75540
     taaatgaaca gtcttccatg cccatgacct cgaaatattc tggagtcagt ttagagagtg     75600
     atgaagagga aaagattcat cccaacatag acgagaagag ttataaggaa tggaaaagaa     75660
     gacagagaga gctgaagaga aaggagctgg aaaggaggct tgaagagatc aactcggttg     75720
     aatttccgag taaagagctg gccgaagaga gagaggagat agagaagatt ttgaagccat     75780
     cctatgtatg ccttggcacc gagtcgttcc ggaccccctc ttcaaatgaa gaaaaggact     75840
     atatccagga gttgagccac cttatagttc acaacgagtt ggacaatttt attgagctga     75900
     tggaccagtg taaaattgac atggaagagt tcgaggttgt tgtccttcac aatctagcag     75960
     agcaaatcaa ggaaggaaac gatgcaggcg ggcttatact ttcgaagata tccttgtatg     76020
     tcaagtatgc cttgtcgcat ggaaaggaat ttctcttgaa gctacgtgcc caacttacaa     76080
     acaaagaaag gcgaaggcaa tttgaggaag actgtagaaa ggactttgaa gaaacaagac     76140
     gaatgttctt ggagcagttt ggcacattgg actctacctg tagccagact cctaaatagg     76200
     ggtgctaggg acctagaacg aatcttttat tttgtgtttg tctttaaagc tgcaaacggc     76260
     ttatataaaa actcataaca gcaggagatg acaaagaaga cataaagcag ccatgactta     76320
     ctggagtaga gcagaagcag cttcacaacc atcgaaataa acaggaaatc aaatgcaaca     76380
     ctgacatggc cctttccgtt aagagatgcc ccggggctca ccagagttgt tgtctttccg     76440
     tcgtgagaaa taacaggcgt tgagattcta tagagataat aaacagcaag tgcctcggga     76500
     atggatctaa caagatatac caggatgttt ttctctttgt tcatcaaata cactgcaagc     76560
     gcacatatgt tgtacagagc tatgcttctt aatatcaact tccttgtggt tttgtttttt     76620
     tcaaaaactc gaatctgaga cttacttcct ctcatctttg tagggcagaa atagtaaaaa     76680
     atattgattt ccagagcatt tgtttaattc catttcccaa gataaaaata gccttcccag     76740
     aagaggaaag cttacatgct atccccctac ttgtgatgtt accacttcga gttcttcatt     76800
     gccctcaaag ccgaggtcgc ctggggtttt cccaggatcg atattctttc cattaaacaa     76860
     tagacggaac tccgagctgt tcttcccgac attggaagaa aaggcatcga gtatcttctt     76920
     gaatgttgta gccggcttga cattgaacac aagcattgta ccatcctggt caataagctt     76980
     cagcggcatc ttttctgagg aagttatttg cgggatattc tctttggtct tggattcatt     77040
     tccagaatcc ggcgatccca tggggtttcc atcccacttg tttttggccc tgtttcctcc     77100
     caattatccc tcttccctat cttccatctt ttttttctgg tttcttggct cctgaagcct     77160
     gtagagtgtg gaagcttcgc tgtagtatgc attgccatct cttatgcaga gaaccaggag     77220
     attgtctatc ttttgtggtg agcatgtgaa gactcgtccg tcggacatac aggctttctt     77280
     gaacagctgg gaagaccctt cttctagaat ggtaaaagaa tctttttgga agtctatccc     77340
     gtccgactgg ataatgacac tctcatcttc cgtcgacgga aagagactgt aaacctcttc     77400
     ggccttgatg ttctcgtctg tagggtgaac tattgtgttt acatcctcga aggactcttg     77460
     gatatatttt tgatagtcga agatcttact catgcttttc tttatccttt ctctctccag     77520
     agcctcgcct cttctttcca gcccactgga agctccaagt cgatgcccag gctttcccgt     77580
     acttgaggcc tccctttcga tatagtccat gaccatttct acgaagtcta tgtccaaggc     77640
     ttcaagaaga tctgtatgta gccgccttgg cacaatcttc tcaagggacc cgtcaaatga     77700
     ggtgaagtct ctttttatct gaggctcaat gtagcacatc ccaggtgttg gtgcgggagg     77760
     tgcatttgcc cagcatatgc tctcttcaag ctcacggaag gctttttctg gatccatctt     77820
     gggcattggg ttgagaattt ttctagggtt gattaaggcc ttggcagctt tgccggcgaa     77880
     gaaataaact ttaaaatcaa gtggtcgggt gctggagagt agtctgaatc ctgttacagc     77940
     acaaacagct gcctttcgag ttggactatt ggagtctaag acatcgtcca gtttccaaac     78000
     tccttctagt cattccgttc cggtcataga agaagtgaac ttttctgtta tgaacgattt     78060
     ctggcattaa ccagatgccc tttcggcaat gtgtctcatc tcagaccttc ccaagggcag     78120
     agcccctaat cgaaagcttc cagccgccga caggggtagg agaagaaaaa tttatgaatg     78180
     gcagaaaggc ccttttgatg aatctaaggc tagaatcgat aacaatccac aacttcaaaa     78240
     gctacaaagg gacccatgtg atccaaggcc tggatccaag gttcacggcg gtagttgggg     78300
     caaatggctc ggggaagagc aacataatag acagcattct ttttgtgctt gggttccgag     78360
     cccgaaggat gcgtcattcg tcgatggcag gcttgatcta tagtggagac ggaaaccaag     78420
     acatgtgtta tgtagagcta ggattcaaca agttccaaat aaggagagag gtttccttgg     78480
     caggaaggac taggtatttt gtggatggag aagaggtacc ttgtactatg gtggagtctt     78540
     tgctcaagag cgagggtgtt gatatggagc acaataggtt tttgatacta caaggagaga     78600
     tcgagaatat tgctatgatc aagcccatgg atggtggttt gctggaatat cttgaggatg     78660
     taattgggac tggagaatac aaggcagaga ttgaaaagga agaaagtgag ctccgaaggg     78720
     tctctgagga atgtgaaagc aagtcggcag cactgaagtt ctatgagaag gaatacaaac     78780
     atattgaaag aaagcaggag gagtgtctga ggacagccaa aagaagagct gaatgcctgt     78840
     gtctggatcg ggatttacat cttctctttt cagaaagagg gaaaaagaag ctagaagggc     78900
     ttctgttgga aaaaaagaag attgaagaag atcttcaggt ccttgaaaag aagaataaag     78960
     agaatggagg caagcttgag gtactggaag ggaaaggagc aaatgcaaga gtttcggctc     79020
     gagaagccga ggagaggttt ttgaaggcga gaaaagaata ccagagagca gaaagacgaa     79080
     ataaaatgat ggaagaggac ctggagaggg agtcaaagcg tattgaggag ttatctcgtg     79140
     agatttctga aatcaggtgt ctggaagata aaaggcaaaa ggaggggctt aaatggacag     79200
     aggaaattaa tcgaaatgtg gaagagatct ctagatgtag tgaattaagc gagaagctcc     79260
     gaagtgaaat tggagaagga cagagaagga ttgagaagga ggccagaaag agtattgaag     79320
     agatttacag agaagaagag cggatgatga agcttctcaa gaggaaagga gagattggag     79380
     agaaacaacg agaatcggaa tctcgattag gaattctgat gtcgaggaag gaggagattt     79440
     tgagaagggt tggggacatc gatggcaggc tatcgaaaat ggatgaagga aaaatagaaa     79500
     tgggaaggtc tgaggaggaa attagcaggg agattgaaga gattgagagg gatctggcga     79560
     agacaagaaa ggaaatgagt agaagaatgc aaagggctga agagcacaga gaaaacgagg     79620
     agacaagttg gaaggagaga gagattctaa gaagtattga gcatgtgaaa ggagtctatg     79680
     gaaggctaag tgatcttggg tctgtggagt cccaatatga tagggcattc aggattgcag     79740
     gaaagggatt gaacagcata gttgttgata caacatgcac tgcagaagag tgtatttcca     79800
     taataaaaag tctgggactt gggagagcta catttataat attggacagg atttcctcgg     79860
     agcctagcct tcctaaggag tctgtgcctt atctgtacaa tcttgtcaag tgcccaaagg     79920
     agttccgaaa gtgcttttat tttgctctga aagacacact tgtatgcgaa ggattggaag     79980
     tggccgagag gcttgcattt ggaaagacaa gaaaaagggt tgtgacgatt gatggaaagc     80040
     ttattgagaa gagtggagtc atgagtggag gaaaagggaa cggaaggata aaaagcattg     80100
     aagagcttga gaaggcgtgc ttgaagatga tggagctgaa gaagaagaaa gtttcggaga     80160
     tggatatggt tagagacttg aaggaaagag gagccctatg gaagacccga gaaagacttg     80220
     cttcggactt agaggaagtg tgccgggaga ttgggagagt agagaagagg atcaatcgaa     80280
     aagagataga ggatattgaa gtagagattg agaagattaa gaaaaaagtg tcttctctcc     80340
     gagagggaat tgagagtctt accgacatgg agacccgtag gaagaaagaa aaccttcgaa     80400
     atcttaacga gaggattgag gtgtttgaaa agagaaacct tgaactgaga ctgcatcttg     80460
     aaagcagtgg atcaggggag cttcgagaaa aagagctgga ggttgaaaga agaaaaaaag     80520
     actttgaaag aatcagcatc gaagatattt caggaatgaa gagcaagatg attgaatgtg     80580
     aaagggaata taaagaatgt gcagaaaggt tgagggggat attgaaggag attgcaaacg     80640
     tgaaagcctc tcttggaaac gactaccata tggaaattga cctgaagaac aggttggatg     80700
     atgcttgcga taagattgag gagtggacac agaggattaa ggagagcgag acaaaaatag     80760
     cttctcttga ggaagaatcc aagaagtata tgaggatatg caggcttgaa atccatagta     80820
     cagtcaaggt tgaggaaatg aacgaagagg aaattgatcg gacaatagga aggatcggtg     80880
     gcacggtggc aagacttaaa ggcgaagaga ttggagagat tgatctagat gtgtttgaag     80940
     attgtgagag ggcaagggtg gaatacgaga aggcaaaggg ggaacatgga tggtttgaat     81000
     ctcggcagaa ggagatcaag gagtcacttg agtatctgaa aaagaagagg tacgacgagt     81060
     ttatgaaagg atttactcaa gtatctgaaa accttaagga gatttataag tcgattacac     81120
     atgggggaaa cgcagaattg gaattagttg accatcttga tccgtttagc gagggggtgg     81180
     ttttgagtgt aatgccacct aagaagagct ggaagaacat tgggaatctg agtggagggg     81240
     aaaagacact cagtagcctt gcacttattt ttgcactcca taaattcagg ccatccccgt     81300
     tctatgttat ggatgagata gatgcggctt tggactacag aaatgtagga gtgatatccc     81360
     acttcatcaa ggagatgtcc aggacagccc agtttcttgt gataagtctg cgaagtgaca     81420
     tgttcgagct cagcgaaacc ctccttggag tgtataaggc aaacaatgct tctcaatctc     81480
     tgattgtaaa cataggcaag cttgcaggcc aataaagatc ttcttttctt ggaattcttg     81540
     tctgtccctt ttcccctgga tgaagaggta tcaagagcca tttctgcact tcataaaaga     81600
     cggctttctg gctccaaagg atctagagaa tatacgaaat atacatggga aatgtgcgtt     81660
     tagagagata tacacagacc tgttcagatt cctgcagact gccgagttga gagagaggaa     81720
     ggatcttcag tttttcagag actctctgat gagggctttt gaagagattg gggatgtaaa     81780
     gggaggatgg atagaccttt ttgggtcgta ttaccgaaag ggagactacc tcctatgcca     81840
     tgatgacaga acagaaagcc ggaagtttgc cttcagttac tacttggaag atcacagttc     81900
     cggagagctc atcctctatg aaaatgatgg gatgagtgtt tcgaagaagg tagaggtaaa     81960
     gtcaaacaga ctagtgatat ttgaggtatc tgatgtatct ttccatgagg ttggatactg     82020
     tagcaaagat ggaagaagag catttactgg atggctaaac ttcgagtata tcaagcataa     82080
     cgaccatagc gaatgtgtga atatggagag tccgaatgta tgtggtacgt ttccgatgga     82140
     gattgacttc aatgaaagcc cccttgtatt ctatcctggc gtggagtatg actttgagca     82200
     cacctctgga agtgtcgaag gtcccttttg cttcagaaga gtgaagagga tagaggttaa     82260
     aagcccatta gccccatgtt tggatggatg ggaacttaag ggaggaggct tctaccactt     82320
     cagggtcgga gactatatac ttctgaacga tggatgcaat gcatttgaag gagacgtgtg     82380
     tgatgtgttc ttcataggag gtgatgaaca tgtctttgaa gacaggccaa acatatttga     82440
     agattcaaaa aacccaatca aatatctaga tgaagaaggg aggtttgtgt tcggccttcc     82500
     gatagctaag gggatgtttg ctatcaagcg gaacggcctt tctttgtttg tagaaaggtc     82560
     tgggaccgag ttctttatgg gacactttat ttatgtttcc aaaaattgaa ataaaggcac     82620
     cggagtttct aatacaacca tatttatttt tcattcttta ctttcttact cccgtggtat     82680
     tcccacagag gaacaaagct ctcaaagaag cccacgtctt caaacagatt tgggaacagc     82740
     cagatcccgg gagaatacag aaagtatgtt atcgagaaca ggatcagcct tattattgcc     82800
     agaacaatta tgaatgtgat gaatcctccc agagggtaga ccatatatga gaacagacgc     82860
     tgctggaggt ttcttggcca cattcggaag agaacgattg taaatgtcat caggacaaac     82920
     accacacaga ggataagaga aatgttagat gtcttttcat ttgcaaagac ataatattgg     82980
     tcctcttgaa acttctgatc aagtaccaca tcgcattccc ttgcattttt cttgttaatg     83040
     gacaccttga ataggacact ttcgtttaga agctcctgca taacagactt cgccttcaag     83100
     ggctccagcc ccttttttgc cagaagagca aggccactac ttcccttgaa cgtccccact     83160
     ctccttctat atctcagtgt tttctcctct gttccaacct gtctcagaat ggcctcgtac     83220
     ttttttaatt cttccaccat ttgtttggga tcaaattttc ggcttttttg tctctggctt     83280
     atatctgtaa cttaccctca actggaatga gactcaaggc cttgataaaa aagaggacaa     83340
     acgatcttct agttgccttg agaagtctta gaggaaagat atgcagtgaa gacgttctta     83400
     gacaagttct gggcaatatc cataaaagct atatccgcct tgaggtgcta ctaaataagc     83460
     caggactttc acatcaggag cctgtggaag ttgattccac aaatggagtc gtaaggtata     83520
     aaacagggaa ccttgaattt ctgtatcatg aggaacatgg ggttatctct gtaagcacag     83580
     gcgacacggg gataaataat tacctcctct gtttgataag aggcaaaccg gtcgacacac     83640
     acttagaaac tgcttcggca atgcttggga tgtatgcagg aaatgaaaga gcattgtgtg     83700
     atgtgtgtgg aaattatgca actgttccag ggctcttgac accgatatgc cggtctcctg     83760
     aagaagactt cgtacttgta caccacgccc aatgcaaagt ggaatctctg gagaaataat     83820
     atttgaacgc ctgcaacaaa ttttgcacaa tccccttagg atgattgaat gctccgtatt     83880
     cggatatttg atggaggtcg attgtatctg caaccatctg aagttgcata aaagaacaga     83940
     caaaactgtt agtgaagccg tttattctaa tgggacaaat gtgttgcttg tgtctaagga     84000
     ggatgatggt atttacctgt caagcagagg gccacccgac agaaacaaga acagaatgtc     84060
     gttctgctca agagtacaga agtcaaggat taggacatta gacactttga aggagtttct     84120
     atcttcgttt ggctttgagc tggtgaggga agggcaagtt gaactaacca cctttgagaa     84180
     aggagcaggg cgcattgaaa tatccaggtc catctctgat gagggcaaca gccaggaagt     84240
     agacaccggc agatattggc tagtcaaggt atttgtaact tcagaaaaca cacagaacgg     84300
     agaaagaatg ttaagcaggt taatcgagga gctggaagac caagtccaac tcatcaaacc     84360
     ctcaataaag tgatttcggc agtctcaata atatgtattt ctgctccttt ccacctctcc     84420
     aatgatttta ttggaggccc tgatcaaaac cccttaagcc agtgaaaaga accctcccta     84480
     gatggcaaga gaatacaagg agacggttta cagcatattg gcatctcttt gtctggtggg     84540
     agggctgtcc ttggaaagtt ttgtgtgtaa gactgcaaat tgttcgtttt tcctgagctc     84600
     tactctgttt atttcaatgg ctctaacact cctcagtctt gcacacatgg taaggacaaa     84660
     ggcaaaagtt actcttttct ctgcatacaa aggatctatc agtgctttga tggacattat     84720
     gattgtgttc atatacacca agatcttgtg cacaaactcc ctgttcttct gtctatcctt     84780
     tttaacatat cagatgaccg tgtccattct gacctgcttc acgtcctttt ccagctctgg     84840
     cttcatggtt tgcatatgtg tcatatttct ttccccacta tttgacctgt ggtttgtgga     84900
     ggaacatgga ttctcaagat ctcagattcc ggactttatg aagtactaca tcacaaacgg     84960
     atctatgaac ataatctttt tcatccccat agttgggatc agggtgatgt tcggagagtt     85020
     ttttgggaga ctcgagaata gagagtcgtc cacactcttc aactctctgg gaatggttgc     85080
     aatcggagcc atattggggc ttattgatag atccgcattc ttggaggaat ttcgcaaaat     85140
     gtatcaggtt tctattccat ttgttgtgtc aaacatcatg cttgtaacgt ccttggctat     85200
     cttcagatgg aacaagaaca tcaactttac ctctgtatat ccacctgtat cggtgctgtc     85260
     cattttagta tctggactgt tttgttacac ctcagcaccc ttgttctgga ggaaaaccat     85320
     tttggaatgc tcgcttaatg ccccgtatct tttctatctc ctcacgtttt ctcttttcac     85380
     cttatatata atcgttgtgt ataagagtaa tattgtctca aggcctgcca gggatggatt     85440
     cataccagga gtgacctggt ggctttgggg atagtgagtt cttgatggct ggatataaat     85500
     ccataaatta cagtgattaa attaatttaa aaccgatcac agcttgtagt ttatgactca     85560
     gcaccgcttt ttgacttttt tgtttgtaaa caatgttcgg gagttagtct actagtgatt     85620
     taatttggta ttaaagtatc aggccgattt taattggccc acttatgaat cagaaacaaa     85680
     atatttaaga acgaaaacac aacaaacaaa tggctaagga agcgctaaag actctacagt     85740
     ccatgtttgg agagatggtt gcatcctttg tctttggatt tgcggtatat tctgctatac     85800
     tgggatctag cattagccag tcatcggcag ataaggtcat tgtaggacta acagttggat     85860
     tttccggaat cggtgtgata tattcatttt gcgacgtgac cattgcacac ttcaatcctg     85920
     caatcactct tgcagccata ctgacatcta agatcgatgt acttcaggga ctgggatata     85980
     tgttggccca gtacatagga tttatgcttg ctgtgtgtgc cctgctggta tgctctcctg     86040
     tcgaatacaa ggagactttg gacacaataa ggccaggacc tacggacttt ggagcaacca     86100
     gcctcaatgt tttcttcgcc gagtttttcc taactgcaat ctttgttcac attgtctttg     86160
     caacagctgt taatccatac aagccaaagg tcgacaccga aggaaagttt gtggatcccg     86220
     acgagaaaga gccggtggat cgcagaataa ctgcacccct ctgtataggt ctgacacttg     86280
     ggttcttggc attcatgggt ttggccagtt ccggaggtgc attcaacccc ggcctcacat     86340
     ttgctccaat ggcaatgtcg aacacttgga gccatttctg gatttatctt gggggtcagt     86400
     atctaggagg cttgacagga ggtcttctcc aggtgcttgt gctatataag cttagctcgg     86460
     actagagttc agagcatcaa ataatggaaa agataataaa atcacacaaa attcttttca     86520
     ttcggtccgc ggcacctgcc atatctgtaa catgttgtct tcagagacac taacaatctc     86580
     aaagggctct gcagggttcc aagagaggtc gcatacagtg cttgtatgtc ctccatgaag     86640
     aaacctcatc tcgggaggtc cttctgcctt gtactcctca gacacctctg ctccaatccg     86700
     attcagatcc catataatta ctcttctgtc tgtacttcca gatgcaagta tccctttgtc     86760
     gtgaggagac cactctgtgc tcaacacctc cttcgaatgt cccaggagaa tatggagtgg     86820
     ttgttccaga ttcctcctat cccacacctt cacagatttg tctccagatg atgtagagac     86880
     aatattcccg tccaagggcg aaaaccttac agaaagaaca tcagacgtgt gtgcttcctc     86940
     aatggcatgt atgcaatctc tactcctcgt gtcccaaaac accaccatcc catcatctcc     87000
     tccagatgag agaagacctt tgtctaggaa gctgaacgaa cagtcgttga cagtcattct     87060
     gtgtcttctt aataccactg tgggagaaat taaagaagat tcctgggata tatcaaacac     87120
     acatatctgc ttgtcctccc cacagcttgc aagctcccca gagctctgag gactccatga     87180
     caatccaaaa cctcccccct cgtgcccccg aagaaccata tcaggccttg gaatcttctc     87240
     atgtgaaaga tgctttgtgt aatcataaac atgtatatcc gaaagatcag agcgtaccgc     87300
     cagtacattg catgcaaacg gactgtatct aaccctattg gcctcgtcca taatcgagat     87360
     cctttgcaca atcttgaatc tcatgtcccc attcacctcc tcattctgag actcgtcaaa     87420
     ttcgtcggga aactcaacct gggcaatcat tatatactcg tcttccactc cgcttgtatg     87480
     ggtactcagc aacaaccttt gcactgtcct tcctccctcc tcgtctctct tcacatccgg     87540
     aaaccactgc acagaaagag acggccactg gagagtgtgg cagaacataa ggtcgtaaag     87600
     atacggtaca ttcttcttcc atatcttata ctcctcattg attatcttct gctccaacac     87660
     ctggttgttc atccacgagg gctttgaggc cagggaatta aaacccattg aaaaagatac     87720
     tccaaatagt tagttatacc ttaaaacgtt tattctccct tagaaaaagc tgaagctgtt     87780
     gaagaagctc ctgggattgt gcatgccatc gtcagaggcc tcttcatgct ccctctcctc     87840
     ctcaggcatg gttccaaact ccccgtttac ttttgtaaat gttccatagg gcttccttgg     87900
     aggctctgca agtacttgca tgatctttgc cctgtcagac tcactgccaa ttatcacatt     87960
     tggcttaaga atcagacttc cttgcttgtt ccccttgaac ccttcgttcc gaatcttgag     88020
     cactgtatca aacgtcttga acggattcac attgatctca agcactcttc cgtcaatatg     88080
     ggtgaagtat accactcctc ctccgactgc agtgtatagc ggaatgtcta tcttccccac     88140
     caggtcactt ccacgcctct caaacctgct gtcttcttgc acatcaatta tgaaaattac     88200
     atctcctgga acgtggtttc ttctctggtc tcccataccc tcaaagacaa tcttttctcc     88260
     ttttcttgct cctggcttta tattcacttc aaacatggtc ttgtcctgta tatactcaga     88320
     cccgttacat gtaccacaag gcttaccttt gatcttatgt ccagagcctc cacacccatc     88380
     gcatcgcgtc tctgcaagag ttacaaaccc tcctagattt cgccgactag tgcacactcc     88440
     acttccattg catctcttgc acgtctctac atcctttcct ccctttccat cacatgtccc     88500
     acatatcttc tcggtcctga cattgaactt cgacaccttc ccaacaaacg attctctaag     88560
     tgaaatagta atcacatact ttgttgagtt gactttgttt gttctctggt gtcctcttcc     88620
     tccagtaaac tggctgaata tatcaaagat gtcggaatat cctcctccag agaaatgtgc     88680
     tccaaactcc ccaagcccac tgtcgtactc tctcttcttc ttctcgtcaa acaatacact     88740
     ctttgcagag tttagctttg cagacatctc tccacattcc ttcttgatct tctccctttc     88800
     ctcatcattg gccgcattcc tcagcctatt cttgataaac ggcgagtcca ggtggtactt     88860
     tgcctgttgc tttgagtagg cctttcttat ctcggctata gacgccccag gactaagctc     88920
     aagtatttta taatatccct tgggatcttt agacatggcc ccacaagatc taccctcttt     88980
     tatctttttt tttccgcgga aaaatctaga aaaaaccaga tgtctcttca aaactccaat     89040
     actataaagc atttaatcac agaaagacgg tttagtctct tcctccccca cacatttcgc     89100
     ataaagatgt atttctttca ttggcaaagg tacaggcctt gcattcccat acagtacatc     89160
     tatatttctc catactcgac acaaaactcc taaagtcctg gctattggaa atggccttga     89220
     acttgacctt gtcttgcttg gctatacaca tgaaaagatc cttccaattg ggaaagatct     89280
     ctttcactct taccaaaaga gtaaagttcg agaacttctc catcgaaaag tctcctccaa     89340
     agtattcggc catcttcctc tccccaaact tctttggaat aaactctgta ttcttgaaga     89400
     gtggatttgt cttacaccca tgtgttagct tcaccaggaa aaactctcct gggaggtatg     89460
     ggtttgcctt gaccatcgat tcctttgtct ttgttctata aagaatatcc cttgttgtca     89520
     ggagcatcag ggggttttcg gtgggaaaga tccaatctcc cttgaaaaga gccatgcact     89580
     ggttacttac ttgatactcc tgcagcccga tatttccatc cttttccaca gtaacaacaa     89640
     tggttgcaaa tctcgaccca aactctatct cctgctctcc atccctaacc acataaggat     89700
     gcataagctg catctttgct ataaattcaa tctccagaga tgacaagaag tagcttcgac     89760
     caagtttgtc gcttgtaatt cctcccttct ccatcagaat atctgtgtat atcatcccaa     89820
     ctatttcaag gcctgttccc aaaaagggcc cgtccatgga ccctgttatc acgaatccgt     89880
     ctggatagtt ttcctgttct ggctcccata tcccagacac cacagccttt agtcccaggg     89940
     gaatcatctc atggtccatg tatctcccga caagaaatcc aaatctctgc cgtccactct     90000
     ccctccagtt cctaatgaag ttctctacca aatgctgccc gtcaaactcg acatggtcaa     90060
     ccattcggaa cacctgtggt gccaggatta tgtttttttc ttggcatcta ttgcaccttg     90120
     tattggaccc atgatccgtg cacgtcttga tggtgtagtc ctcggcactt agtcccttat     90180
     tcttgctttt tatcatctca tgatatgact gaaagctgag atatttgatc atgttgtctt     90240
     tgtaatactt ctcgtcccat ggatctaagg gtgcacagtt gctacacatc gcattagagt     90300
     catgctggca catcatccta tccctttctc ttttgatgtt tttggaggct tctggattct     90360
     tctttggctc ctctttcttc ttctcgtact ctacatacag cacctggcca ttcctgagcc     90420
     ccaaggcggt cggggtttgg gtcttatcca tcttgtcctt gccatctgga gtagaggata     90480
     ttgatatctg acccacatta aagaaggcaa gcagctgcgt ctccaatatt ctggattcgt     90540
     ccacttccac ccgtctttgg ccttctgggc ctcgaacgat gaatatcatt acagggcttc     90600
     ctggtcttgt ttttattgat catggttatg gcgagcccat catgccaaaa agaaaggatc     90660
     catacaagac acttggagta aagtggacat cctctgggac agaaacaaaa gaggcataca     90720
     ggagattaca aaggctgtac catcctgaca gcaagacggg aaataaagaa aaatatgaag     90780
     aggtatgcaa agcatatgaa gagactctca aggatccacc tgtagagatt gttcctatta     90840
     aagatgtagc gagaatctac aagggctcac aagaggaggt tggagatatc attgcgttgt     90900
     acaacaaata caaagggaag atgggaaaga ttgtagacaa ccttcttctg tctgacgatg     90960
     gggatgaaga gagacttcga gggattattg atgaactgat tgggaacagg actctcaaac     91020
     agtactgtag ctatagcaaa aaggtcaagg aagacccgaa aagaagaaga agaaaagcag     91080
     aagaagagag aatggctagg cagattgcag aggaaatggg gattgatctc gatgctccat     91140
     tagaagatat ccttggagga catagaagaa gggaagaaag gcttcttatc agtcttgagg     91200
     aaaggtgttt ggagggtcct ggaaaagaag gaagatagac ttgaaatatg aagaatagat     91260
     gttttgttga caaatagata ccctctgatg gaaaaagaga tcgatgactt gttcctatat     91320
     gggagtgtta agaaggttgg gaaagacaga ataaggacct tggagaaatg catgggagac     91380
     cttccaaaga taaacccaaa tcttgagcag gtgtggacga agtgtaaaga gattgattca     91440
     agcttggagc tgtacagtat caaactggag tcattggcaa gagaaatgaa agggatagaa     91500
     aaggaaaata cgaagctaga gaacgagatt cagtatcaaa catccatata tgagcatctg     91560
     aaggaactcc tgatcaatgt ggagataaag gaggaccact ttataacgtt agagagcgag     91620
     tcctttgaca gtattgatgg gctttgcagg atcgagaagg cactggaggt gcttgatgga     91680
     ttccatgtgg atgagtatga catcaggata gtccgagaaa agaaggaaag gatcaacgat     91740
     gcactgaggg aattctacaa aaggtttata acatatatgg ggagttttat ggttgacagc     91800
     gaaagcagcg gagacctgaa ggttcacaaa ggtctctacg gggcgatcaa gaggttcaag     91860
     aagatattcc aacactcgaa gaggtataga gattactatg ttgttctgtg ctcgatatac     91920
     atggcacgct cgaagaagtt atatgaaagg gagtttgggt tccacttgaa gacagttctc     91980
     cggctactga aagaggatgt gacacaagat aagatggacc gaatattcga gactcttttt     92040
     gaatcgtacc gcagcatagt gaagtgtgag gatagatttc ttaagagtat ggagatcgat     92100
     gggacatgcc aagagatctt ccgaaacaca gggctcctga ttgtaggatt tgtcgaggat     92160
     gcatatgaca ttgcagatat cgaagtattg aatggattgg ggaaaatatg gaaggaagtt     92220
     gagccagatg aggatgtata tggatctttc cagaaggagc ttagagaagt atatggaaga     92280
     ttagaggaag agtatctaaa gaagaagatg ggcaagggag agaatggagt tggaaagctg     92340
     gaagagatcc tcagcaggtc cagcaatgaa gacctgaaga gaaaagcaat agttatggga     92400
     acacagagaa ttatggagga ggaagacaag ggagacttga gaagaatagt aaagagatgg     92460
     aggcttctag actacatggg gaagaagtgt accaaggaga tagaagaggt tttggatgca     92520
     gaaagaaaaa ccgaatctga atttgaaaag agctgtgcag atatgattct tggtagcgga     92580
     aaaacagtcg acaatgtgaa gaaggtacta tctctcatca atggagaaaa gggcttcaaa     92640
     acaaaggtga tcaggaagat gagggagatg gtttcaaacg acgttgagga gaaggatgca     92700
     gaagatgcag acaagctgct gagagaggca atgtagtctg tgaaatcgga aggaggctat     92760
     ctttgtttcc aaccgcagtg aaattaaact taattgcagg gacggggttt aatgtcattt     92820
     tttccttgaa tatgcatact ttagtaagtc atacactctg catgaatatc catactcatt     92880
     gtcgtaccag ctgatgagct tgaaaaaatt gggtcctatc gagatgctcg cattaatgtc     92940
     aaacaccgag cttctcgagt ctccaatgaa atcggagctt acaacatcat cctttgttgt     93000
     tcctatgatc ccttcattgc tttccgagaa cctttcgatg gcatccacta tggcctcgat     93060
     ggttgtctct ttccttgttc tgcagacaag gtcgaccaca ctaacatttg caacagggac     93120
     cctcattgcc attccgttca atttcccggc aagagaggga attacctttc ccacggaagt     93180
     tgctgcaccc gtgcttgcag ggattatatt ggccaatcct gacctcccgc ttctcaggca     93240
     ctttccaact ccatcaacaa tcttttgtgt tgctgtcact gcatgaactg tagtcatcag     93300
     tccctccaca attccaaagt tgtcgtcgac aatcttggca aggggtgcca agcagttggt     93360
     ggtacagctc gcattgctga tgatcctttg ggacacatag tcttgatggt tgactccgta     93420
     cacaaacata ggtgcgtcct tgcttggcgc agtaatcaca acaatcttga cgtccttatg     93480
     gccttcgcaa tccttcagtg ttgtaaacac cccactggct tcgacaactg catccactcc     93540
     atattccgtc catgggatct tctcaggcct atcaaaggca gacaagcttg ttttttttcc     93600
     tttgtatagg atctttcctc cctcaacctt acactccttg catcttccaa agacactatc     93660
     gtacttcaaa aggtattctg cctgctccgg cttcaaaaga gggtcattca caagaggcac     93720
     ctctacacct ttctccctta gaatcctgta taccaacttt cctatccttc ctaatccgtt     93780
     tattcccacc ttcatttata cggcacattg aattttgttt aaataccttt tgacagaagt     93840
     aacaaggaaa gacccaattg ccgcctggaa tcgattgcaa tgatagcggc tcatccaatc     93900
     accaggtctg ctcgattatc gagaatatac cgatgcattc tgtaaacaaa aaagaaaata     93960
     caggcaccca aggaaaatga ttttgaatag cctattcaaa aacttcaaga acatcaaaag     94020
     atatcaaaag ccaatcaaag ctattctcgt ggttgtgcct ctgcttacct tcaaagtaag     94080
     caaagagacc catgtctcca ctaacgagcc tgttcaacat tatatagata gaaacatcga     94140
     actcgagaag ccttcagact ccacacctct ttttacttgt aacagattca tcctcaatga     94200
     ccttcctcca agacggacat taaggattca gggacttcca gaccaaaagg aaaactacta     94260
     tcccataatc tcaactctaa agtcgatggc cataaagaat atcaatgtga tcatcgacct     94320
     aaaccctcca gatgagaaat gcatgtatct gttcgaaata gacctgaggt ttgccggcag     94380
     cacatgcatg ctgatacatc cactgaagaa ccaccagccc aactcagact tctttcttgt     94440
     tgctggagac ttctttccct ccaaaatgtc cttcgacccc atggacatcc ttgtcacaaa     94500
     caagccgtca aatcgcctgc acatcttgct gaaaggtact ccccggagtc tgaaaatgct     94560
     tatttgcttt attaagtcga tttcgtttat aaggacccat ccatacggaa gctacttcta     94620
     tatcccagta agccatggat acatagatat caccatattc atgcctctag tgatttgcgt     94680
     gttggtttac tacatacttg actggatttg gactccccac catgtctctg ttccaaggat     94740
     atttctagga tctcttctct attcgttctt tcctatttca tttctgttct tcacaaggaa     94800
     aaacgagttt ctttgtcttt caacgatctt catggtcctg aacccaaaaa taggcctggc     94860
     gtacattggg atatgctacc taagaatggt gtacgatacc ttctccattg ccatacagat     94920
     gctgaagtca tcaagaatgt ccccaatgga tgaaagatct tttataaatt acaaagctaa     94980
     acacaaggta gaataaatgt cctttaatta gccatgacca tggattgctc cttgatcgca     95040
     aagtcggctc cgaaggaaac atgcaggata tccttgaatg agtttcggat gttgtatggc     95100
     atactggctt gagtaatgat ttcggcacca aggcttattg ctgctatgct gcttattgca     95160
     cttctcaagg atgagacgat gtcttccgtt ccgatgtcga tgagagatga atcataaatc     95220
     actccatcct cgtagacctg gtgcatcacc atcttgtaac tgaatggctt gatgttgagc     95280
     attccaagga ggttggcctg tgaaggcccc accttatctc ctacagaaag aaccttgtat     95340
     ggagagatga tctccacctt accctttgtg atcttggttg ctattccaag aacctggaag     95400
     tatgatgtct tgtctggagt cattcctgtg atgcagtttt ccacccatac gtctttctgt     95460
     gcaatgtttc caaccttggc acacgcttct ctgacgttat cgtcaatggc cttcttgaca     95520
     tccctaacgt ctcccttgaa aaacacaaag cagacgtctc ccttgatgag ctcaaggata     95580
     cttgacagct tgggattttc aagacttgct actgcacgct tgattgccga gttctttccc     95640
     atgagaaatt caacatcctc tccccaaccc ttcttgatgt tcttgagctg agtcgactcc     95700
     acattctcga ttcccacaag agcaaacctg gtgtaggttc caaagagcct cctagccttc     95760
     tcatatacct gttccttcct ttccttggag tcctttctag tcattccagg gtgaaaaaat     95820
     ttctctcttt tggactccgg catacccaaa gagctctggc cagtctggtg gagccctatc     95880
     aagagaagtt ctgatttgaa ggtcattcca gccaccctct gaatggacgg ggtggtcaga     95940
     aggatttcca accggcttgg aacaatgcca aaggaaacaa cagaaatgat ttcccaagca     96000
     ctcaaggatc catcctatca ggagagactg gttgagattc ttggatatga gatgatggag     96060
     gaagtggaga tgatttgtgc aaacaaagag tactttgttt ctcaggaaga ggtagaggac     96120
     cacggctttt atgtggagta caactttcca gagtccattc ccatagaggt tgactgttca     96180
     gagattgtta gtacagatgt gatgggggga tacaagaagt acttcgacta caagaagttc     96240
     aacggggtcc agtcaaaggt gtttaactcg gcataccaga gcgatggaaa catgctggtc     96300
     tgtgcaccaa caagctctgg aaagacagat attgcatttc tatgtgttct ccgggcactt     96360
     ggtaagggag acaaggttgt ttatgtcgtt ccgatgaggg cattagcaac agaaatagca     96420
     tcgaagtaca gaaagaagct tggagagcaa agggttgtgg agtacactgg agacacagag     96480
     ataaagacag aagatgtggc aaggtgcgat gtcatagtgt caacaccgga gaaatttgat     96540
     gttgcaacac gaagacaatg caatgtattc cagagccgtg ttgggcttgt tatacttgac     96600
     gaggttcaca tgctccagga cgagaggggg cctgttttag aagcgattgt atgcagagtg     96660
     cttaggtatg tagagctccg ccaaagaccc atacgtgttg tggggctttc tgccacactc     96720
     cctaactatg aggatgtggg aaggttcctc agggccgagc atgtgttcag ctttgaccaa     96780
     ggatatagac ctgttccact gaagatgcaa gttgttggaa tgaagaagag gagcaagctc     96840
     cagctcgagg atgagtttct aaaaaagaag gtggagagat atctgagtga tggaaagcaa     96900
     gttctggtgt ttgtgcattc caggggagaa acttctagga cagcaaagct tttgagtgat     96960
     gatggagaaa gaagagatgt aaagggagga gtagtgggag gaatactttt ggaactggct     97020
     cgaagggggg ttgggataca ccatgctgga cttcctcgga agataagact gtatatggaa     97080
     gatgaattca aggcagggag gctaaggata ttggttacga catcaaccct ggcatgggga     97140
     gtcaatcttc cggcatatgc agtggtgatc aaaggaacca gattttatga ctcttctcag     97200
     ggaggattta gggatgtagg cattctggat gtattacaaa tatttggaag ggctgggagg     97260
     cctcaatttg attccagggg agagggatgt ctgataacga caggggacaa gatggaccat     97320
     tatgtgtctc tcctcaagaa cagcagggat gtggagagca ggctgcttcg acatgttgca     97380
     gatatcatga acgcagagat atacctgaac acgattgagg atgtcaacac ggctgtggaa     97440
     tggctaagaa gtacttttat gtatgtcagg atgtccaaaa atcctatgtg ttacggattg     97500
     agtaaagaag atttgtatga tgaatacaag gccctgtcgg attatgctat tcttacatgt     97560
     agaaggctag aggagtgctc gatgataaga atacatagaa aaaggattgg agactttcaa     97620
     acatggagat tctgtagcac ggagtatggg aggattgcca gcatgtatta tctatctcat     97680
     gaaaccatgg agaggtggct gagggaaata gaagatatat atgacgaaga ctccatactt     97740
     aggctttgct ttgaagatag ggagctttcg gtgctgggat gtagggaaga agacgaagaa     97800
     agtatcaagg agctttgtat ggaggttgga gttaaatacg aggtgtcgat aggatgtaag     97860
     ctgatggttc ttgtgaaagc acatatcaaa agactcccaa tccaaaggtt ttcacttgca     97920
     tgtgacagtg agtatgttgt caagaatctc cggaggattc tgatggggct atgccagatc     97980
     ctgatattcc aatgcaagca tctatttgtt gcaaaatgtt gcatactatt gaaaagaata     98040
     gaaaggcaaa aggaaaagcc ttgggatgcc aacaacagag tcgaagtaga tcttttccga     98100
     gttcttggaa tggttagaat ggaagtttcc ctgaagatga aaggggaata ttggatattt     98160
     gtatgggatg gagactctgc catctactcg ggtctctttg cacatcgagc aaatttattc     98220
     atcaaaacaa agtgtgatgt gttgaggatt gagattgttg cacgagatga atgggcaaga     98280
     acagaggaga gatgctgggt tagccgagac acaagtacaa gatcattgta ccataacggt     98340
     gtccatgagt gtgatcaagg atggtctttg gtaggagaga agcaaagctg ttcccatttc     98400
     tgtgtgataa agtcgctttc ggatctttcc gatatgatgg atggatggag attggacgga     98460
     atctccgagc ctggaagatt gattatgaca aacagaagga ttaatttttc gagtatgagg     98520
     aagggagaca taagcataaa agggtgggat aagagagatc taagggatgc tcctggtgtg     98580
     agtgtgggct acttaatgcc cgaggttccg ccgagatatg ttaagtatat tttgtgtgat     98640
     ttttctcttc ggataaaatt tgtgcaaatc gactgcatgc tgttcaggga gaggcttcag     98700
     ctcatgagct cctgtatcac attcatggat aactacgaaa gcaagaaagt tgtcatagtg     98760
     gcaccagaca caagtgacat ggaaagaaca gcacaagacc tcgagactag aatgactctg     98820
     aagagtttgt cttgtggaaa atgtgatgtg aaagtaaggc gtggaagacc tatggcagga     98880
     gacacaggga tatttgtaac tgcatttgat aggaggttgg agatacaaaa ggatttcacg     98940
     gtgattttca agggatgttc caattccaat ggatattttc ctatatttga ggttttgagg     99000
     atatgcgact cgagagaggc gcttatatat gaaggaaggg actatataga gtattttaat     99060
     agctgtgtac tgaacgggga tgaagaatga aaattaaaag cgatgtttaa ttatcgggat     99120
     gtataggtgt gaagatttat agcacaaagg tgagtgccag ggatatgtca tctttgtctc     99180
     caagacctct ggtaacctcc tctggagcat ctattataag aagaaggccg ccaagggaaa     99240
     ccctcacaat ggtcctgggc ccttttcttt caagggaata gacccttcca taggctagat     99300
     agaagcaatc tatgttctca tggattcctc gaaaaatacg cacctcgaca gcatgtccta     99360
     cctgaagcct gcacaaagtg gtgttgtaat caagagaaat ggaaattttg ggggattcca     99420
     tgtacagcct cgagactttt gtgtagagct ttccttcttt gtcgatgtca acgactttga     99480
     agctgtcggc caagatctgc atcatgggtg caaaaatttg aatgttgaaa tgccctgtga     99540
     tggaaggaaa caagggcaga gaagaggaag gaaaggagct ttttgatgag gagtgttcct     99600
     ccgagtttct tccaatcgac ttctatgata agagccggag gcctagggac gaccaaggga     99660
     ttgagtttgt agttaccaag aatggttttc ctgaaggaac aaggggggtg tgttttgaag     99720
     gagttgtgga tggccttgag tttgagaatc ggaaaatgga ggcggagatt gaagggctga     99780
     gcaagaagga gagaagaata gaaaaggaaa atgcagctct gaaggatgtc ctattggggc     99840
     ttttgtcaaa gctttcttct tgacagatgt ttgttttacc tttataatga gctttgagca     99900
     taaacaaacc gtaggatgga cataggaaga aagccactga gcgacgagga ttttggaagt     99960
     gcgtggaagt ctatagagaa ggaacttcgg aagctttcct cggggggctt gtgcagtggg    100020
     cttgagattt ataacaacat atacacggtg tgtacgtcgt ctacacccag gcttgaaaac    100080
     aagctgtatt ggaagatagg agattttgtg tatatgagag cacgggaaat aagaaaggag    100140
     gtgtttgagg caaaggactg gattaaggag tacaacgagg ggtttaggaa gtttaggcag    100200
     atggtctttg caattgacga gctatgcgac ttcttgaacg agtgtgtgaa gggccggacg    100260
     atgcgggatc taggatttct cttatgggag agatgtgtgc tgcagcagac gatgaagtac    100320
     aagcacacaa cgcttgggtt cgagcttgtg aaccaggaga ggattgaagt gatcaaggat    100380
     gcaattgagt cgtttcggct gattgttccc gacctgaaga agccgatgct ttactataca    100440
     cagaggtatg agcagtttgc cctacagaag attggaagca agtaccagga ggaaataaga    100500
     tccatgtgtg gggaagttga gaagtactcg ttctatgtaa gagaaaagat ttggtatgag    100560
     aagagcatcc gggaaaaaat atttcttgaa gagtcttggg agaagatgga ggagatactt    100620
     gaagaggtgt ttatcttgaa caaaagagag tatctctttg cagaaatata caagataatg    100680
     tcgatgcaca gacttcctgt ggagattctt gacaagatct ccaaagagat ggagcatgac    100740
     aagcatcgag aggttggagg atatcgaaca aacgatttct atgagttgca gaatgatgac    100800
     gagcctaagg tcaagcatag cgatgtcttt ctggaaagga tgtctgtcct ttacaggaac    100860
     ctgtccgggc tgaagtcagc atgcgaaata ttccgagagg tgtttacccg atatgtacgg    100920
     gaagagagtg aaaggcatgt ggatgtgtac agcaagggta ttgagacgct gtatatcttt    100980
     cactgcatgc ttaggcatgt tgtggatgtc gggtttttgg gggaccatga atatttcaag    101040
     atactgaaga gagagttttc cacaagctgt atgaaactga ggccatctct ggaagcaaga    101100
     ctgcttgagt tttcggattg gattgttggg gagaacagca atgtattcag gtttcttgac    101160
     agagaatttg aaaaaaacac tgggggaagc cacctggatc ttccttttct ggggcctggg    101220
     aaggtgaaag aggaaggatt ggagcttgga aggaggtttg aagggaagaa tgaatttttg    101280
     cggcaggtgt ttggaacact gtacaagatg atagagaaca agcatgtgtt ctacgagatg    101340
     tatctttcag ggctcggaag gaggctactg gaaaaaggcc cgaatcttta tgaggagaag    101400
     aagttgattt ccctaatgaa acgaaagggg aaccaggact ttataaagaa ggctgagacg    101460
     atggttgcag atataaacat ctccctgagc tacaacaagg atactgaccg atttgtgtgg    101520
     gttctgacac aagcatattg gccacagcag gcagaagccc cgctgatccg gattccagag    101580
     tctcttgaaa tgataaagag ggtatatgat tcgaagttca acaaaaagaa gttgtgctgg    101640
     gcatggaatc taggaagtgt gtgtgtggag atctatggag tcgagatcca aatgaatgtt    101700
     ctccagtact ctgtgattga tctgttcaac agacatgagc aggtggattt cgaaaaggca    101760
     ttgagtgcca cgaagatggg gacaaaggtt atcggggatg ttcttaaatc cttagttgat    101820
     agtggcctcc ttgtctgtgc cgagggttgg tacagaatag gagatatatt tggtatcgaa    101880
     aaggatatcc gtggctttta ctgcagcgaa agtgtttcca tggtgcatga gatagacaag    101940
     aattcgtact accaatcact tgcatcgcga atactaaaga ggaggaagag gatgtgcatg    102000
     gatgacatag taaaggaaac tcaagcggag cataccgaga gatttggata cgacgaagta    102060
     atcttctccg aagccataag aattcttggg gataaaggaa tcatagagga ggtggaggat    102120
     gcatatgtct atctccccta gggggtaggc ctttgatatg tatacttaca aagaagatct    102180
     tttggcccat ggcagagctg tcggaagaaa aaagaaggat gtatttggag caaatagagg    102240
     agcttgaaaa gacacttgag aaggagaaag atagtcttag aaagactata gaatctcaag    102300
     actccaaaca ataaaagatt tattttctat atcaagagat ctttggcaac ttcaaggaaa    102360
     tgcaggctcc tttccaccca gcaagttcct ggcctcgttg atctttgacg ctatgtatgg    102420
     gcttcctccc ctatctggat ggttgatctt catcatctgt atatatctct ctgccacact    102480
     ttccctacga ccctcgatgg ataggatctt tcttgcctcg ttgagatcca tcacaggctt    102540
     gaatcctttt ggatggcttg ggacgaacgg aagatagtct acaagtctcc gaagcatggg    102600
     gaccccataa ggccaaattt ttgactcccc atggacattc agaaaatagt tgatgccatt    102660
     agatctaacg acatagatgc aaacagagct gctatcgaaa gcatctatgc caactgcagc    102720
     cagctagacg acaaggacat tatagaaata actccgtctg tgatctacta cctgtggaag    102780
     cttccgaagt tcacggctca gaagcagttt gttctggaac ttttgtccca tgccgaccaa    102840
     aggttgcgct acagcctgtt catgtatctc atcgatcact ggagtagcat ccagctggta    102900
     agaatggaca aattctacta tcttgtcaag aggattctgg aatattatgt actggatgtg    102960
     gaaacagtct cttccttgtt caatatatcc acgagcatgg atcttagaac atttataatt    103020
     cgatgtgttg tggacagact taaagaaacc accgaggaca tggagcattt cttggctggg    103080
     tttgcttcca cgtgccctcc ggcattgctg cttcctctcg aatccctaag gctccggaag    103140
     gaggttgccc tggaatatgc agggaataag gacatcggaa agaagaacag agctgcatta    103200
     tactccatga tcaaataaaa gatatttcca ctaactcagc tctagctctc atgcttcaca    103260
     aagctgaact tgcttttgca cttcttgcag acaggaacaa acctgcagaa cacagagaga    103320
     catattggac atacaagccc cagcagaact tgcttgttat ggcaatagca ggttgcaggg    103380
     aatcccagag gctttgaatc tccttttgtt ccaaggagag agagtagaaa tctcaaacat    103440
     ccgtcttcag atgttgaata accgccgccc gttgcagcac aacattggag aatcgtcttg    103500
     ttttcaaaca gcgagaatgc acttattctt actccaaacc tctgtgcagc aaacatgcat    103560
     ttcagatatc tcagatactc gtcgttccgc tccttctcaa gtgtaaatat tacgatttgg    103620
     gattccccga gtctgtggag acacaatgca tatccgagat cccccacgtc atagctggac    103680
     tggtgttgag ttatcctgta tatttcctcg atgctacttt ccaaggagtc gaagaggatc    103740
     ttcttcccac ttacgacgac aattcgattg tttcggcttg acttgtgata tgcattcaaa    103800
     aagacaacaa cgtcattgaa gaggtctctc cccgtcatct cccaattctc tttcttcagg    103860
     tcgattagaa ggaaaagaat catgagggat tggcaaggac agatcttgtg ttctgtggag    103920
     caaaaagatg tcagaaacgg gattcgaacc cgtgcctcaa tgagaatacg acctgaacgt    103980
     atcgccttag accactcggc catcctgact tatatgtccc ccaggggagg gtatcgccaa    104040
     ttccttgccc catgctccag acaaacatat attcgccaag gggatgtcct ctattatcta    104100
     atggacgggt gcagtcatcc cgtaagactg ggcacattgt gcggggtatg tggaatcgaa    104160
     atccctgaag attcacacct cttctgtgca ctctataaca cagacaatgt taagataacg    104220
     cacaaagagg ctgtctcaat atataaagaa aaaatgaaaa ctttagagac acagatgaag    104280
     ctgattctgg ttcttgatct tgaccagaca attcttcata caacatacgg ggaatccagg    104340
     atccatggaa ctgtgagatt tataatggat gggagcaagt actgtgtgaa actaagacca    104400
     aaccttgatc atatgcttcg gaaaatttcc aggctgtatg agattcatgt gtataccatg    104460
     ggaacaagag catatgcaga gagaatagtt gggattgttg atccttctgg aaaatacttt    104520
     caggacagaa tcattacaag ggacgagaat gaaggggttt tggtgaagag gctgagcagg    104580
     ctctttccac ataaccacaa aaacatagta atccttgatg acaggcctga tgtatgggac    104640
     tacagtgaaa atctgcttct tgttcggccg ttttggtatt tcaaccgtac ggacatcaat    104700
     gatccattga ggctgaagag aaagatagag gaagagggaa gaacatctag ggacttggaa    104760
     gggtttgtgg acaagaaaaa aagagttgag gaaattgagg atccggagat tgtctcgaag    104820
     ctggatgata tagtgcttga atgctcttct ggatccaagg agccaaggaa agatatcgaa    104880
     agcacggaag aaaaagaagt aagcagatgc ttggaggatt gcgagctgtt aagagtgaca    104940
     aaggtgttga ggaggattca caagaagtac ttttcaagca gccacagaaa cgtaaagaag    105000
     attctgagga acatccgaaa aaagattttc ggtggagatc ggtttcttgt tccacctgcc    105060
     ccaaatagga tgtggcttgt aaaaacaatc gaaatgaacg gagggacagt aagttctctg    105120
     gagaacgagg ttgactttat aatttcttct agcaaggagg aggtcaaggc cctggcacag    105180
     aagcttgagt gtcttgttgt atctccaaag tggatagccg attgtgtgta ttccctgagg    105240
     cgagtaaggc acggaaggta cattgtgtgc gactataggc ccaaggatga atacgaagaa    105300
     gagcttgaaa ggctcttttc gtgatggagg ctgtttgtta ttaagtggcg ggataaattt    105360
     gaagccttgc taacaatctt tatatttgtt acccataagt ttgttttgag tttatcacat    105420
     ttgaaataaa acccatggaa ggaattgttc aggaagtaat acagtgcatg cttggagcaa    105480
     ttgtaaggaa caatgcaatc cagatgataa ttctctactc ggtgttttat ttcacaaggt    105540
     gtgcaaagcg cccggatgta ttctacagcg gaatgaaaag ggactctgtc ttcaagatgg    105600
     ggagcctgca tagaagctat tatcccctat tttttgcacc ctttggaacc atccagaccg    105660
     ttcttcaact attccgaagg cccatgttcc ttgagagaat aagtattcag gtgaagacgc    105720
     cccacaacgg gtcgatcctg cttgaccttg tggaaggtga caaaaattcc aagaagaatg    105780
     cacttctagt ccacggattc aatgggtcgg gaaactcaac gtacatgagg ggactggcag    105840
     ggcatctttc aaaagaaggg tacagagtct tctgctttaa tgcaagaggt atcaggtcga    105900
     agctcaatag tcctgtgttt ttccatatag gatggacagt ggacttgaag gcagccgtgg    105960
     agtttattct ttgtgactat caagggacac tggagatatt tgggttcagc atgggagcca    106020
     actgggtagc aaagtttttt ggagaggaga agctcgatcc cagaataata aagggagggg    106080
     ctgtgtgtct tccatttgac ttcttcaaaa taggaatcca ctttctgaag aatccgtaca    106140
     ctaggctatt caacaaacta ctggcaatga actttgtaaa gtatatcaac agaaacaagg    106200
     atgtatttag agatgcaggg tatgacatga atatgataag aaagtgcagt agcgtccagc    106260
     agatagacat gatggtaaca acaaaaatct tcgatatcaa ggacgtcaat gagtactaca    106320
     aaaaccagtc gtgtgtgaac tacatcgatc aaataagtgt tcctttcatc atactcaaca    106380
     catacgacga cccgatcatc cccccatttt caatagacaa ggaagtgtgc atgaggaaca    106440
     aaaacatact gttggtaata gctcacaagg gagggcatct gggctttctg tcaaataggc    106500
     tggatagaac ttgggcagaa gatgttctaa tggactttgt caagcacttc taggcatggc    106560
     ggagaagaaa tgtgtcgatt attaaagcat gagtttattg catctatgcc ctggaatatc    106620
     ctgacttcaa agatcaaatc cccttgcagc caactcactc cggacaattt ctctatacac    106680
     tccttcaagc ccgtcgagtt ccatgggatt aagtttaatc atcctcaaga tcttgtcttc    106740
     acaatccttg agaacgggtc tggagccttc aggcatctcg ttgttgacct ggtttatgat    106800
     cttcttaaga tccatcaaat agtttggccc aacaatcttc ttcttgtgtg cagcactaca    106860
     gttgagcttg agctcgaggc aatccagaat ttcttttgta ggtagacttt ccttggcata    106920
     gaagataggg gcatcatgct tcgaagatga aagttctcca tcggccaaga tacagtatga    106980
     agtctcgttg cgctttgcca agcaataaat ctcatacctc tgtggtttca tttcacaatt    107040
     ctccactatg tatgctgtgt ctggatccat gttgctaagc ttgcttctta tgactcggaa    107100
     ctcatcgtcc agatgaacaa ctcgaaagtg cgccgataga cagctgcgca gctcctctaa    107160
     atacatcctc gaccttccca tcagaattat aacaggcatc gaggggcttg gggacaaatg    107220
     gataagacgg ctggtagcac tagtcttgtg tgaaacggct aatgaggtta gccagtcttt    107280
     ccttgtttca gggtcgaacg ccgaagtttc gtcccatgaa acgatcgtgt ttcgtgtttg    107340
     agaataaata gtaaggtgaa agagactcaa aaccaatatg ctactgtctc tgatattccc    107400
     tcttgtagtg ctgggagaaa agttcgatgg atatggaccc acggcattcg acatctctct    107460
     gagccccgag attcctcttg aggagcttac gggatatggt acaaagcatg ccaaagagag    107520
     aaagaacaaa ggatttggag atttgagtct ggtcgacttc aacatggaga cagaagatag    107580
     ctttgacaga aataagctgg tcgagattgc ttggaatgtc ttggactctt cccacggaac    107640
     aatcatgact atgcaatcaa tcaggaaggg agagatcgat gctttgtcaa taagggctct    107700
     tggccactac gaggtgctga actcatcaga aggctcttac aacgtccagg aggcgccgat    107760
     aacatatctt ccaatcgtct ttgacacact ggttcttgac cacaagaaga gtgggtatgt    107820
     ccgaaatcca gagaacaata aaatcatcta tgcaagctgg gcaatattcg agcacaagcg    107880
     aacaaagaga tggttcactg tggtcaatgt tgacatgtac agcgcatact cggagaagac    107940
     cgatgtccaa atggcaaata ttctagagga tatgaatcgg gagcacacag tggactccaa    108000
     cccggtgttc ttcatggggc acatcaatgc aatctcggac aggcttcaga aggtgattga    108060
     ggacaagtac ataaatcctt tggatgtaga caggaacgca aaggaaggac ccaagttcac    108120
     catgaagaat ctcccagata ttcttggcaa tttccagagg gactttgtgt tggttagaga    108180
     tgcgtcatcc aaggtggtga gagtcaacta tgcaagaata ctaagaaagg gccttcccac    108240
     cctccactat cccattcatg caatagtgtc gtttgaggcg ggggaccagc accgtacacc    108300
     ctcggctgcc tgaacaataa taaaccacct tttgtgatgt tttgaataat ttttcggtaa    108360
     aagcagtccc ttcatgattg aaggtctttc gacgttttct ggacgcacca tgccaaaagg    108420
     atctggaatc tactcggtga tgaacgacgg caggacgata ctgacggcat cgaacaagga    108480
     gagaaagctt atccagcgaa agatcaatcc acgagatatc cgatggacga cgacaagtag    108540
     ggagttcttt ggaaaggaat cccaatatgt ggttgagaag atgaatgtgc agaaggtcaa    108600
     gatcgtccgt ggatttagac atatcagtgc tggcttgctt gaaaaagcca ggcagacaga    108660
     gtcttcaaga aaatgaaatc gctttatttt tatgtcttaa tcttctctat tgaaattgga    108720
     aaatttggtt ctctataaac aaaaaggatg ggtataggaa atcaccagga ttcctcggat    108780
     ggccgtttac ctgctctacc ggagcttgaa ttcaggatga catatggcgg agaaagatat    108840
     aagacctcga ttctgtccaa ggagattgtt atgggtctga gggaagctct ccaggacaaa    108900
     tataaatatt ccctgagttg gaaacttctt ttctccacat ttgaaaatgg attttcctac    108960
     agaacctttc tttcaagctt tgaaagagac gaactacctt ttgtacttgc ctgtaggacc    109020
     agggatggag agctgtttgg agcattcttt gaggatagaa ttagggtgtc caggaccatg    109080
     tatgggaggc catccacttt tttgttcacc acagcccaaa acatgatctc ggaatccgaa    109140
     gatggcaaag tggctgtctt ccctgtatct caaggcagtg gagcaaatat ctattgcacc    109200
     ccagacttcc ttgcatttgg ttgtagtgga gaaaggtttg ggctgctgat agacagatca    109260
     ttgtcaagtg gagaaacaca tccggtggag acctttggga aggccatcct tgcatccaac    109320
     agccatttcc aaatatcgta cctcgaactg tggcttatcc agttatgagt cttaacctgt    109380
     cttcaatgct ctttggaaac caaacaactg caccaatcaa gaatatttta atatgttttt    109440
     ggcacaatgg attgacatga attcttcaga ataggtctgg gtattttgct gcaacatcta    109500
     caaaccggca atatgtctcc atgtcaaacc catttccaac gggatggaca ctgttttcaa    109560
     caagtacccc atcttccaca acgccgctaa cccggaccag gccagacttg taaagtccaa    109620
     catcctggtg cttaacctga atctctctct ccatacattt cagaacaaca atgccatcct    109680
     caaccctctc aagccttcct atcactacga ctgtctgtcc ttcacagttt ctaggatcca    109740
     gtgaatgcat ggggacagaa tatcaaacgg gaaaaatcat ccccaaccaa atggctctag    109800
     aactcagggc tttatgtcta agcagaaaca ctacaataga gatgataaag gacaggggat    109860
     acacaacgac acaagaggtg cagaccctcg acgagttcca tgaaaagtat ccctttgccc    109920
     ttacaaagag atcgacattg aactttgtct gtgtagatac gaacagacct gttgctatac    109980
     actttggaga ggacgagaag atgggcaaga aagtatttga agggcttctg acgcagtatg    110040
     aaaaggacaa catattccat ctgattctga ttcttccgct tgcacccagt cctacagtta    110100
     tgtcgatgat atctctgaac ccaaagtttt gcatcgagat cttccttgtt gaggagatga    110160
     tatttaacaa gacaaagcat tcatgggttc ctccacatag aatcctgtct cgagaggaga    110220
     aggagaaggt tttcaatact ctgaagcttg ggccgggaga tctccccagg attctgaaaa    110280
     gcgatgcgat tgctagatac tacggggcaa ggcaaggaga tgttgtggag atagttagaa    110340
     agtcgaagac cgctggggaa tccatttatt acaggattgt ggtggaaaaa taaagaggtg    110400
     ttttggcttc tgtgtaaatt taacttgtct ggcatggccc tggacaatgg atggggttct    110460
     tgagaaactg cttctggata caagattcac aacgaacaaa atcccgaagg agtttctcct    110520
     gaggagagtg ggtcttggat acagtataag aagcaagaga ttggatcgag atatcataaa    110580
     gccctgtctt aaggcaaaga agaacaagga gaaagctttg agtattcaag aggaggagtc    110640
     ggaggatgct gggcgatcgg agtctgtcaa gaagaaagcc cgatcaagaa agaactagct    110700
     ccctcgcaac caaagtagat ggctatttgt ggccaaaaaa agcccctagg atgggaaagg    110760
     caagaagagc ctacgagcta gagatcacaa agatcctggc caaaaccatg caaaatagct    110820
     acaggaagaa gcaagttgaa gaattgataa cgaggatctt ccaaaaaatg cagacgataa    110880
     ttgggccttc caagaatcat gaggagttgg aaacattaaa gtcggagttt catctactaa    110940
     aacaagaagc atactctctt atgaagactt gaaaataggg ttgctttgtt tattaaacct    111000
     caaaaggata ctttatctat agttcttcca ctctccgtcc ccttcttttg aatagtaatc    111060
     cattagatat tctcctccct gatagaacac ttcgaagggc gacagcaatg gcttcttgaa    111120
     caatttcccc cagtctatgc taagtctggg acacgatatt tgaacaaaac tgtctatgaa    111180
     ctcatacctt tcgagcttct tgggacttat ttcgtcctgc attatcaaat agatcttgta    111240
     tcctttcagt cggttgacca cacttctcag gatattcttg tttccctgcc ttccgagaga    111300
     ccctagtatt actccaaacg atcttccctt gaatgccgtc ctgatttcag accttctatc    111360
     actcagcatc ttattgtaat catagaactc ctgagtcatc cggcgactga agggacagta    111420
     cttgtagaac ttcagatggg ggttccttat catggctccc tccaagtgga atcttccatc    111480
     tcctatcgaa ataacggctg aaactccctc gatttttggt gatgtgcacc ctaatacctc    111540
     tccactgcta agaggtttca cttgcggaag aatacattcc actccactct tctcgtcatt    111600
     tagagccctt ctcagtctgc ttatacttga gttaaattgg atcgtcccta tcacacctac    111660
     acgcccttgg aagtttctct tgatcatttc aacagcatga tctacatcta tccggatgtc    111720
     cacaaagaca taaagaaccc ttgtgctcat ctcgcctaca gggataaggc atgaatggcc    111780
     gtagtgtaca aggagatcag acccaatgct ctcatcgtcc acacagcatc ctccataaac    111840
     aacatcgttc agaattatac attctgcatc ggtatacttc tctataatgt ctattatcac    111900
     aaaagagtat ttcaaaagcc cgtctgggaa ctgcaatgtc accttctttg cagactgcct    111960
     tctaattgtt ctcaatacct ttcccatctc aaagttgtag ttccttggaa gatatctctg    112020
     gcattctggg acctccttct gctcaagtac aaccatgtgc ccttggaggg cctgtctatt    112080
     tcataatcga tttcctggcc cagaatggat gcagaggcat tgctgagaaa cgaagaaaat    112140
     aagagttttt tgatgaagag acttgaggat ctaatagaga agcatggctt tgacaggagg    112200
     atagatgaat ttgtggagaa tcttgtggga gccaagatgg ccgacgtcat agatatcaac    112260
     aaagtttttg acaagttata tgatttcgtg attatgaatc tacctccaga gattcaggaa    112320
     acattctatc atgacgtaag aagctttata gaaagaagcg ttgtaacaga ggatcaataa    112380
     acaatatcct taactcatgt ttcgtctctg atgtctcgaa gacaagacaa ggtttcgaat    112440
     agctattgat aagtgtccct agaagtggaa aaggaaatga agaggcgggc ttacatctgt    112500
     ttctttcttg ggattgcaac ctgcgagatc tttttaacaa ccataagacc gattgacaac    112560
     cctaatgttc ttatggtttc tggaaaaaac gttgtactca cggcgaacag ggaggacgag    112620
     atggccacct tccgtgtcga gacccaagac aggaaatcca ggttccttgg aataaagttt    112680
     gggaaacgga agcatactgt tctcatatca ccgggggaca acccgaatct ttatatgaag    112740
     tacagtaagt cggatgggag gcctaccatg gggaagaaaa agaagtactg ggaatacaag    112800
     gagatgaagg atggaggcta catgcttagt tcaagcaaaa acaagtgttt gggagtggtt    112860
     gggaatagct tcaggatctc cgagtgtgga actggaaaag gccaggtgtt tgtttttgaa    112920
     aggagagact acagcgaatc ttcaagcact tctaattttg aagagcagat ttctatttct    112980
     tcggaggttc ccttggttcc tccggtctct caaacttctt tggtttcttc aacttctcgg    113040
     tcctctcttg tttcttcaac ttctccaacc tctctaacct ctcggattcc tcagtcttcc    113100
     tttgtttctc agacttctcc aacctctcgg gttccacagg caatccaggc cagccaggct    113160
     ttcgaggcat tgtttccatt tgatgaaagt aatgactccg atagcaatag cgacgacatg    113220
     aagcccgtgt ttattaatct ggatatgaag gacaaaaaga caaatacaga aacccaggaa    113280
     agcagttctc ccatttcgat ttcaacgatg acagtttatg tatctgtcac caagtctctt    113340
     tccgcaggag cggtgtcttc ttcaccaata gtgacgatca tcgacaagtt tccgcctgtc    113400
     agtgccaaac ttcctccaaa cgtgacgctt attcggaaca ggattgcatc ttccgaggaa    113460
     tcgcagtctt cttgcgagtc aagtgattct tacttgggaa atgaaacagt atctcacaaa    113520
     agttccagca gaagcttagg aggagccaag aacgatgcaa atctggactt tgatcttgag    113580
     ttttatccag agctggggag gctcctagac gatagtatcc gcaaaaagaa agaagaagag    113640
     cttcggaagg aagcaacagc taaaagggct cgagggaatc ctctgggcga agaaagaaaa    113700
     gacggagagt tctttagtgc cttggcatat ttagatacct ccatcccaaa tcctttacgc    113760
     caaaacctag cggaagcaca atctgcctgt gcagacattg ggcaagtata atataaataa    113820
     atgtaaatgg atgccaactc tctgtttaat aaggagccct tctaagccgg gttatatcga    113880
     ccacgcctat aattttctct atctttctga atatatcgta catcttgtga atcattttac    113940
     gggttctagc cttttcatta agcttcagca cggccttgag tgaaggaatc atcacgaagg    114000
     tttgggaatt gtctccagga ttgcagtctg taaaggaaag tgcccatccg cttactccct    114060
     catagttgat ttcgtttcca actgtaagac actttccttc cgatataagc tggaatttca    114120
     cactgtttgg aagccttttc aagtagatgg aggacggtga gatcttcatc ctcacgcctt    114180
     tcagggagga gtgaacgtct gctatttcta tgcagcgctc cttcttgagc tccagccaca    114240
     ccttctttga aaagctctcg tacttcaagt caaaaacctg gttttccatc atctccttag    114300
     aaaactcaga gagtagggct ggtaggctta ttctttctgg atggatggtg tcaaacacgg    114360
     ttaagggttg attccggtgc agcacattca gcatcattac cccgtcataa tcggagttcc    114420
     gaagatgcct attggaccta ccacaaggcc catatcctct ttggaatgaa tatgcaaatg    114480
     caaagaataa caacaacatc acttccttgt tttggaaaga tatttaactt gtgttaaaac    114540
     ctgttccgaa acagtttaaa gctttgtgtc agaagcaggg ctgctcccca gagacataag    114600
     tcaagtcgga agaagaaagt ttatttcgca ttgtactgct tgaccatgtt aataaaaacc    114660
     ttccctgcag gcgtagatgg gcatatgacc ctcctgcaaa aatacgtctg catgacttgc    114720
     atttccatat tccaactgcc gttctcttca cactcttctt tccacatgcc tcacagctgt    114780
     acttggccct ctgtgtttca agaaccgctt tcattctctt acggagagtc gatccatatc    114840
     ttgctccgaa agagcctgca atccctacct tcttggtttt tccctataag ttagtctgct    114900
     tcagaatccc cttggtccca agtcacttac cattttgatg ggtaaaaaaa attctcctta    114960
     aaccgcaata cttgcaggac accttccaag agatgatgca tccgtcagga gcggtcgttt    115020
     atcttttcct caagaaatcc ctcccccgtc agtttcttga aactttcaat gttcttattg    115080
     atgctttcta ttaatctatc tccaagttct atttcaattc cctttgcggg attagaattc    115140
     aggtgagaaa tagccaatcc tacgagagac agaagcatcc acattgttta caggcttccg    115200
     ttacactaaa tagtctgtgt tttggatcat tcatttcaaa actcgataca tccaaaaaca    115260
     acttgggttt actatcaatc atattcatca gaatccacaa tcatgctatc gttttcagat    115320
     tcatactcgt cctcctcaaa gtcggagctt gctccgtcgt caataacctc gctcctcgcc    115380
     ttaattccct tcgagtggaa gtactgctcc agaagtccga attcatcttt cgaaagccca    115440
     ctgaaagcgt acggaccctc gcagaacaaa gtcatgtcaa atgtcttggc ctgcatactg    115500
     ctcaagttga ttctactaaa ctccacaagc gatatctcac ttaaatccaa cttaacggct    115560
     ttgggaagaa agagaacaca gtcttccaga ggatataact gcccctcgta tgccttcatt    115620
     gcacacctta ggcatctcat tccatctcta gactcaaaag cacttctcac agacttggta    115680
     acacataaag cttccatcac ctcggaaaag atctcggaaa acagcccaga atactcctcc    115740
     ttgagccttt cgtcactagc acttatctct ccctccgaat cgtcaaacga tacaacaatg    115800
     cagtcatatt tcgtctgccc ctgcctgata ggagggtcga cacacaccac agcatatttg    115860
     tcttcgtctc gaatgtatcc tttctcaagg acatagagtt gcttgatact tttgtagtat    115920
     atcttgtggt cgtagctgct cccaactaac cttaggtaat ctcgaaagaa gatcaggttg    115980
     aacttccccc tcggataggc aaaagaaaga ccctccatct taaatatctc gtcatcaacc    116040
     gaggagctgc atccttcctt gactccctca atggtcttct tgttagaaat aaaccttatc    116100
     tccacatcct tcagagatac agaaagttcg ttctttatgt cgacgacgct ttcgatgtcc    116160
     tcaacaggaa tctcaagtat ggtctttgtg tttcggaact ccagtgctct ctgcccattg    116220
     atcccaagct ccccagaaag gacgtcgact atctccagct ccttgacata cagactaacc    116280
     ttgaagtatt cggaaaacat tctttttaac tcgtcaatgt agttttggtc cacattattg    116340
     agttcataga ctgtacttcc aaatattctt atggccattt ttcttactcc ataaaacagc    116400
     tctgcatctt tgacttcgtc cttctccatt gtgtatactt ctccatcctc tgtcttgatt    116460
     gctattccat ccctcgaaat cttgactgtt gctttcttgt cggctttcga cttcaaaaaa    116520
     cagttgttaa gtgtcaggac ctccatcaag ggataaaaac atctgcgcca agaccttcat    116580
     ggatggaagg catgaaatgt cggaggagga gtacaagaga ctaaggaagt cacagccaaa    116640
     aaagaagaag gttcccagag aggactttgg agacccgtcg gaaataggag gatttaaagg    116700
     accctggagt cggtttgtgg ggatctgcga agacacaaag accccaagag acgtcaagga    116760
     agaatactcg ttgaagaaaa tagtcaacaa gcattgtcta actgcaggaa aggaaagatc    116820
     gaggagcagc tactttttgt ccatgaaaga tccaagcctg ggaagagtac catcaaagaa    116880
     gtttcttgtt ccaaagagca acgtcatgct attccacgac cacaaggaca tggtttcctc    116940
     tgcaatcctc ttccgaaaac ataagttgtt tctatcctct ggctttgatg gaaaggcata    117000
     tttgtacaat ctgaaggaca gggagcttgt gaccacatac atgggacaca gcaagggggt    117060
     atcttcggca atagtatctg agtgtgagag taaattctca acagtatcct tcgatgggtt    117120
     cttgaaaggt tgggatgtgg agacgggaag atgcaacaca aaagtagact tggactgccc    117180
     actcacctgc caaacatcag aggcattaga taaagccatc tttgtgggag gaatagatgg    117240
     aagagtcaga acagtagata tgaggagccg agctgtttta gatgcaatga tagaagagag    117300
     gatctcggaa aaagatgctt tcaaaacatt ctccatacgg gatatcctta caatcaatga    117360
     ctcctcccta gtgtttacaa ggagagaggg ctctctgcat tacctagacc tccgaaataa    117420
     tcaaatagtc aagtctcttc gaaactctta ctccttcgtt ggattcagcc atgggaaaaa    117480
     tgccattatg gccacaggcc aagatgagat tgtgcttttg gatgctcata ctctggagaa    117540
     aaaggaagaa gagattaagg ctcccgaatg ttctactcct gcaaaggcct cggaagacgg    117600
     aggtattctg tgttatggaa gcagcaaggg ccttgtcagc ttcttcactt caaagtctac    117660
     tgcttctttt ggatccgccg gtgagatgat aactgcagtt gactggatag acggtagctc    117720
     ttcaagcttc atatcgggag acatactagg gaacgtgaag atatgggagt gacttaagag    117780
     atgtctttat tcaaataaaa ttacattcat agaagtctac agaactagaa caagtagtgt    117840
     catgatgtgc tggaatctcg agatttcttc ttctttttat caaccttcag aagagacttt    117900
     gcaagcttct tcttgaaacg agaaccaagg cgcttcattt tcttcttaat tcttggcttc    117960
     ttgaacctca cgtgttccat aaactcttca agggattctt catcactctt tggctcccga    118020
     tgcttctttt ttttcttttc tttctttttg gtcttctctt tcttttcctc tctttcttct    118080
     tcctctttct tctcatcctc ctctagattt ttcttgcatc caggctcctc gtcatcagtg    118140
     gtttccgagg agattctttc ctcttggtcc ttttccttgg tatctttctc gccatcctta    118200
     tctcgatccc catgcaagcc tctcctgctc ttctctagat attcgcatct atctctaaaa    118260
     actttgattt ggaatcggaa ttccagagac tctcttccag gtggcatgca ctctttgaac    118320
     ttcacttctc tacccacatc tgccatacat agtccactgt catgccctat cacaatactt    118380
     ttgcactttg ttggtgacac aaaatggaac tcaaatccag atggaatatc ctttcctctt    118440
     cttttgtgtc ctctatagat tgtcattctt ctatatttgc tatctacagt tagatatcct    118500
     tcccttgtat aaagcttaaa tccataaggc acatttctat tccaatcata tccaaaaaca    118560
     tagtcttctc ttctccgctt gtcaacaggc tctaacctca gagttcttaa gttaaggtat    118620
     cttccactca tcatggattt gattgcaatc cccatccttg acactaccat tcccagatgc    118680
     aataggatat aaacattcat ggcaccttcc gagatgcaaa ccacctgttt taatatgtca    118740
     caccatcaga cacatatcca ctgattggtt agagaaacca gaaaccccaa tctgttttgg    118800
     attcagctaa gaaaacaaga aacagatact cgtttattga actacagagt cgatcacatc    118860
     catgatagca gactcttcca cccgctcgca tccccttctg cttagtacaa aagatgatat    118920
     ttttttcgag tcggactgga caacctccat gagtccgaga atagtgagtc ttacaaggtc    118980
     tcccttgtcc ttcttctcca aatactcaca tactctttgg cttttctgtc caatcgctcc    119040
     acagaagaat tcagagaagt ttccgtccgg ctcaataaca tacgccacag gcctgggctt    119100
     tagtccaaac agaactgtac ggactccaaa tggcctttgg tggtaaacaa cagtatatct    119160
     ctgcttatat tcacttagcc ttcttgcaag ctgatcgatg cttatgtcct ctcccgtggt    119220
     atttttgtat gaaaaacata tcatccttgc tgcattcatc accaaatatg catcaggttt    119280
     gaacccagag taactcatcc aaatactctg ccgttcgttg acaagaaaca ccttttcctc    119340
     ctccagaaaa agcttgttcc ccgactttct ctcaatgctc acagatatct tctcggaatc    119400
     taccccaaac acaacaagag acccttgctc gctggcctgc tgtgcatact caacctgtat    119460
     aagccttccg tcaggtgaaa acactgccag ctgctcttca aatcccatta agggctaccc    119520
     catttacttt attttggaat acttctctgc atcccgagac acaaggttcg tcatagtaga    119580
     aaaagctcct caatttgttt ctgtctgtca tagtggttta gatacccaaa ccttacacta    119640
     gacccgtcat agcacacatc aaaagacttc tcctcgcaga ctattccatc gagtataatc    119700
     tgagggtctc tatcgatctc cactcggatt ctggttccca tcctacacac aataggtttg    119760
     aagttgcatc tgtttggtgc aaccacatta atgactattc cttcgtctag aagcaaaggc    119820
     ccgttcaggg atgcattgta tgcactactt cctattcttg ttgacacaat aactgcatct    119880
     cccctcaatt ctatcatggt gtcatctatg aatatcttga atgttccaag tcccaaagag    119940
     gacggcttaa tgatagcctc gttgagaaaa tagtgttttg gctgcagaca gagtctcttg    120000
     gtctccataa acttgatttc tccatttccc cttagccgtg caatgagctc gtccacagaa    120060
     gagtaggaga tggggcatag aaaccccacc tttcccctat tgatcgcata caccacggga    120120
     gggtcccgat aaggtgcaat ggctctaagt acagttccat ctcccccaat gactataatt    120180
     ccgtcgtagt tgattccatg gtcataaaca tcgcaatcca gtgaactctt aactctttca    120240
     atgagctctt cattgacatc atttttggta acaagcaaga accttcccat tgcgttattt    120300
     ctgggatcgg tgaaacaagc taaattgaag agccctaatg gaagacattc ttttgagagg    120360
     aataaagcag aagaaaaaga ggattctaaa ggaggaagtt gagtacaacg tcgatggaga    120420
     aagactaccc cttcttaaca catttgacag tctaaagaca aaagctcctt tttcctctcc    120480
     tcttttggcc cagaaggtcg ttgtgccgta tttcatgaag aagtacaaca ttattgtaca    120540
     ggcctttact gggagcggga aaacactatc gtactgccta ccgcttgtcg agactgcacg    120600
     aaacgagaat ctttttggaa tgatacttgt tcctggaagg gcgcttgtga gacaagtcta    120660
     tagggttgta agagaaatca agcacaggga actggagatc aaggggatct acagagatgg    120720
     ttccgaggac ttctttgttg aagaggatga agaaggggga ttggttgaga ggagaatcga    120780
     cagtagaaca caaaaggaga ttgctgggtt ccctcgggaa ggaggaagaa ttgtaatagg    120840
     aacgctcccg tcgattctta gtttgatgga tctgtttgaa atgaaagcta tcacacatct    120900
     tattatagac gaggcagatc tcctgataaa ccccgagacc atcgatgttt ttgcatctat    120960
     tcttcaggaa atagacgtgg agaagacaca tgtcggatgt tttagtgcta ctatgaacga    121020
     gtatgttgag caggttatag aaacagtgaa gaacatcaca aagatacata ttgtgtcgag    121080
     gaaacatata gaccatgagt ttgtatttgg gacaaacaga aagatcaaac acctatcgct    121140
     gctacagatc gttgcagatg gaattgaatc accgaccctg atatttgtca gaaatgaaga    121200
     gaccggggag tttttaagta agctgctgga tagaagcgga gtttataaag aaggaagcgg    121260
     ggaaagcgca gaagtccttg acgacttccg gctaaagaag atctggtacc tgtttgcaac    121320
     agatgcattg agtagaggaa tagacttcta taacattagg agtgtgataa actatgatct    121380
     tccagatact aagacccagc ttgtgcatag ggttggaaga gtcaatagaa attgccaggg    121440
     acaaaaggtg tatacaatct attcgggcga agactttgga agaatctccc ttgttgccga    121500
     gtttctagag gagaacggac atgagatacc aagccacatt actcggatta tagaaaagag    121560
     ccggaaaagg attggcagga ggagctagct cctttcctcc tcttcggagt ctgtgcagaa    121620
     cgaatccata tcgtcaacca tctctgctat ccgggtgcta acggggtcta cgagtccttc    121680
     cactttccca acaagatcca ttttcctgcg gattccattt gagtttttgg acacccgagt    121740
     agtactgtct atctgaaaca gctgggatgc actcctgaag tcggatggat cgaagcatgg    121800
     agacatctcc aagccttctt ctgtgtaagt tagacattgg tcctccgagc atatgattgt    121860
     gcctaattgc ctgtcgtaca cattccagta aaactcatcg tcgccaatgc ttactgaatc    121920
     atttccagat atatacaagt ttcctattgt tattgcatat tttccctctt tttcctcgat    121980
     gcttgtgttg atcaagggaa ttctgccaac ctttagttct agatccggct tgaggaatag    122040
     ccttatctcc accggattct taatatgccc acaagcaccc gataataaaa gtagaaatat    122100
     aaattccata tctttttatt tacttccagg catcctggta tttataaatg ggcttcatct    122160
     acgattgaca gacaaatatt taccacaact tcttacaaaa cgggaaacta aaccaaggca    122220
     tggagaagct ggaaggaccg aacttgggcc tcctccaatt aaaatcccat aacttgcgaa    122280
     ggacatcctt tacatcatcc tttccatcaa ggtccggaag gttttttttg gcatacttcg    122340
     agaagtcatt cttgtcctcc aggttcttct taatcttttc tacctcatct ctatttttcc    122400
     ttcccaggtt ttctaatttc tttttgagct tgagctgttg caccatttct gcctcagttc    122460
     taggctttgc gtttagatcg accgaatcca gacaactttc aacacccata tcttcaaaga    122520
     ggaagacatg acttctactt ctcccgttgc acctctccaa cacaagttta ttctcatccc    122580
     tagtgctaag gcaatatcct tcctgggata cagtgaatcc atctccactc ttggatattt    122640
     cccagaaatc tatgctgtcc tcgcatttaa gaagatccct acccttccga cacaaccagg    122700
     agtctccaac acgaatctta aagactcgtc cattcctgtt gatctgagat cttgtgttat    122760
     gtccgtaagt taaattaagc tcatccacag ctctaaaagg gtttgatcca aagtctcttt    122820
     tgagttcgga gacaagaaga tgatactctg ctgccaagat tctgataggt ttgttggtaa    122880
     atgagtcgag gtatagcgga taggaaaatg ccattccaag aaccaatatc agaatcatgg    122940
     atgttgatct gtattcccac tatttaaaga agatgtgata cacgagttag gagatgttta    123000
     cgcaaatcac aagacaatct tcagtataat cgtttttaat ccacgaacta gaaaattata    123060
     ggatccctcc taaccagatt tttacttctg taatggtgag gagaatgatg atgatctaag    123120
     tgcacccttt tgaccccaga atgggggttt cttgtcaaga catgtgtgac agtcacttct    123180
     tcttcctttg gcaaggtttc ttcatacaag gggaagtccg cttcgtctcc tgaatagctg    123240
     gagacgtccc cttgctgaga aaaggaagtg tttctattct tttctctctt aatggggagg    123300
     atgatgttct tatttacatc tccctttgtc tttatcctga tggatgaagg acattcactc    123360
     tctggatgaa atatattcac atttgttgtc atattctttc tcccttcgtt cctcagaagg    123420
     gaccctatgt ctccacatcc cccgaggtct gcaagcttga agctaaatat ctgatcgtcc    123480
     gtattgacac agatcttcat ctgaatggac tcctcaggac ccttggtaat gcatttgttg    123540
     tccgtagaga ttgtgtatcc aaactccttt ctgtctatgt cccagggtct ttcttctttg    123600
     cacttcacca ccgagtttcc atctttgcat atgttatttt ctccaaatat cacaacatac    123660
     ttctctccag acttcaccag cctcgccctt gtaacaaact tgtacttgct tggattcaca    123720
     tacttgctgt gagacactag aagcccattt tcctcttcta gcccaagaat ctgtgtggga    123780
     taggacgaaa aaaaaacctt gatgtctttt tcaacaaact cctctaactc tctgtccctt    123840
     gcgctaacaa agattgacat aaacatcaag atcaaacccg gttccatgct ttccagaacg    123900
     gcttttcttt tgtataaaat cgttgaaacc acagaggcct gtctcacccc atcatgcgat    123960
     gagaagaaac tctgttccag acctgaagca ttatcattga aataactttg gctttccctt    124020
     tgtctccctg acacagagga gtacaaatac actgaagact aggcaaagac ctccgtaaat    124080
     cccagacata acttgtgcat ggttatagtt cagaggatgt agcaaggttg ttgttatgaa    124140
     tccaaatagc caattgaaac tgactccaaa ctcaaagccg gtggatgtat atctcgaggg    124200
     aaatatctct gccgagatta tccatgggat tactgcaagc ccgaggttga atccaataaa    124260
     gcagattatc actcctagaa ggggaaacct gtccatggca agagggatca ttccaaatgc    124320
     cattattgtc gaagagatga tcgacattgt tttcctccca aatctatcaa ctatcagtcc    124380
     acagaatgca gttgttataa acgatacaaa caaagaagaa cttgtcatca ggttgggata    124440
     tttgctactc gagaataggc aagactgctg aaacgtcaaa aagttgattc cagacagatg    124500
     gtggaaggcg tggaatacta ctgttattgc aatcgacttt gcggatccag gggtcctgat    124560
     taattccttc atggatggcc tggtgttgaa tgtatttggt gttcttggat ggggacttct    124620
     aataaatgca aatcctatcg tctggagaac aaggaacaca agcattgcaa cgaatgggat    124680
     cctgtagctt tccttgtttc caaagaagtt gaacatggag cctacaaaga gtcccccaac    124740
     tatcccgact ggctggagac tggccaggaa cccccggata tggtctggag caatggcatc    124800
     tatataagat gaaattgatc cagaagtgag gtcgagtgca aatccaagta tgaatctgga    124860
     cgttaaataa tgagcaaaat ccaatgtcat cagcggggtt gcaaacacaa tcatatatat    124920
     gacgttggct acgatcaact tcactttgtc gttagtgaaa gacacaaact tgaagataat    124980
     tcctgcaata aatgcaccta ggaagtgtgt tcctgggatt aatgcttcat ggtatatggt    125040
     gtaggtcttt ccagtagact ctgtaaagtg atcttctatc aagccataga gacaggacag    125100
     gcttatcaga gagaccccaa atgtaaaggc tgtcagaaca accaagatca ggctggcaag    125160
     ctctcttttg gaaaagactt ggtgtttcat cgatgcttgg agatgtccca aaacttttat    125220
     atacttcatt tttggaatag ggatgccggt aaaagaaaag gaagaggttc ttctgaagga    125280
     tatcaaggag gatgttcaga gtgtaagaga cgcagttgtc ttgtcggacg acgtgtccag    125340
     gattgacgag tataactttg agagtctttt tggaatatat aaaaatccgc agcagcaagt    125400
     ggtctttgta aggacgatat ataggcagtt agtaggagag atcttaaagt ttttctcctc    125460
     gaaatgtgtt gcagaggcaa tgactaacat ctgcattctc gaagaagtct ttaggagcca    125520
     gagggggtac attgacatag agatgagtct ggaggatgtg gagtgcatta accagcatgc    125580
     atattccttg ggaaagaagg aaaactccgg agtggtgagg gaaggtatac gggcatggaa    125640
     ctgtctaaag cagagaaagg ctattcgaat atgtgtcatg ccatttccag atgacgaacg    125700
     aagtttaatg cttattgaag aagaattaga ggccatatcg aagactcttg atggttggga    125760
     agattctaga gatgggaact gtacaaatta aattcctttg ggtattccat ttgataatcg    125820
     tcgaatgctc catcttcaaa tggcatgtcg atgacatcca agtccattat agactcttct    125880
     ggatgaacga cacatagctc gggctcactg ggctttttga atgttcttag agatgatgtg    125940
     tttgttatct ccgacaactt tcttctgggt tcctgactgc tcatctcaag ggatgaaggg    126000
     atttaggtta tctgccacta ggggctagag atgcaatgca ccgaggaata cttgtttgac    126060
     agagacaaac aattgggaag gtgtctgagg gagattcttt tggaagacta ctgctttgag    126120
     cttggaggcg aggagaggac accttttgaa ataaagaaag gatttctgtg gtatggaaga    126180
     tacaaggtta ttaaaatcga tggggattgg gcatatcttc atggatacaa gctgtttgtt    126240
     gcaaaagaca ggctccgggt ttatgagcta cctcttggac agtcacgtag tcttggggat    126300
     ttgatagtga aggaaggtag tatggtcttg gctgaaaggg atggaaagcg atggaacttg    126360
     gcagcgatat gcgaagaaaa agttttggat gtagcctttt caaaggacaa ggcatggata    126420
     tggtatagcg agggggaaga agaagagtac ttgtgcaaga gtatctatct gttgaaagat    126480
     tcggaatggg ttaaatggaa gaaagagact tatagagaga gtggagagga gattcttcgg    126540
     atacaagata tagttgtcag aaaaaagacg gtggtacgga atccactaag agtatggagt    126600
     aaagtattaa tgaatgaagt ggtgagcata gtggtaactg aagatatggt gtatgtggag    126660
     tgtgggggat acatcagttt gaagccctgt tgtggaggca tctatgatat ggacggatgc    126720
     aggcttcttg ggctgtcttc ttgggaaaat atatctgatc tgtatctaac acttcttctg    126780
     tttactgaca ttgcagtaga gaacttggag ctggagagga ttgaggaata tctcttcaag    126840
     ctgtttgttt ttaccgaaga aggagaaagg cttgtcaagt ggttaatgga atcggggatg    126900
     gacgaaaaaa aagagatgat tgtttgcaag ctgtacagga agatagatga taggggcaag    126960
     agaaagatag agggatgggt gagaagagtg aagaacttgg atgcattgaa gctggtgatt    127020
     atatactttc cagaggaaat ggaaagatac atccggatgt gtatagagga aaagagagag    127080
     tatgagatag aagaggttat cgaacactat cgagggagcg agatgatgaa ggagatatcc    127140
     cgtgttctac ttcagaacaa ctgcttctat ctctttagcc aatgtatgcc tgaatatgag    127200
     ggaagctttg gagatgtggt tctagttgag aagtacaaca tggaaagcca gaagaacata    127260
     cgactggaaa gggataggaa gatttgattt gaggaaaagt ttgccctaga tttaactaga    127320
     ggaagattta tagagatgaa caagggaaag tatgaaatgg agtcggacga gttttttatc    127380
     aatgccattc tagaggatcg ggaggtcaat gacttttcct gggagttcag tgagataaca    127440
     agctgctctg atatgcggag tagcataaag gttgagaaga ttgactctga tagtgacgtg    127500
     gagtttatag acaggataga tgtagagccg cctttgtggg agaagagtgg agaggatgat    127560
     acgtcgtcag ggagtaggtt aaaaaagaat ctagggagac tggaattgaa tggagagtca    127620
     gttttgggaa gagcagatgc atgtctaaga agtggacttg gaagcaagga tctgggaaag    127680
     ggaagggaag ttgagaaagg aggtgtggat tatgaatatt actcatcact tggagaggat    127740
     atttcggaca tcagtattgt ttcagggtcg tcgatggagg gatcttctga tattgaaatt    127800
     ctgtctgggg aagagaatga aggagaaaga atggagaggc acccagactc atgcagtctt    127860
     aacaacgact gcatccgagc aacgtttctc aggtcctctg gcgaggataa ggaagatgtg    127920
     gacaactcgt ttccagcgca tgtgcttgaa gagtcttctc tgtcgtcgca cgaagacttc    127980
     gagcccaagt ctatagagga gttctatctc cgagaagttt ttaagatgaa ggagtttagg    128040
     acaaaccaga gagaagttat acaggcatgt ctgtcgggga aggatgtatt tgtgttgatg    128100
     cctacaggag gaggaaaaag catctgctac caactaccgg ctcttgttta cgaaggtgtt    128160
     acaattgttg taagtcccct tctctctctt gtgcaggacc agattctgaa tcttctgcag    128220
     aaggatattc ttgcacttcc aattaactcg aatctgagtc ggacggaaag aaggcttgtg    128280
     tttgaggctc tcggaagtga cgagctaatt tgcaagatat tctatgtgac acccgagctt    128340
     attgcaaaga gcgggcattt ccacgaggtg gtatctgggc ttgtcagaag agggagactg    128400
     aagaggtttg tgatagacga agcccactgt gttagccaat ggggacatga cttccggccg    128460
     gattacaagg agcttgggag tataaggaga agatatcctt cggttcctat tatagcgctg    128520
     acagctacgg caacgaagaa ggttgagcta gacatcttgg agaatcttgg gattcgaggg    128580
     tgtgagacat tcaagatgag tttcaacagg gcaaacctga gatatgaggt gcgtgccaag    128640
     acaagcacag ttgaacttga cattgtaagc tttgttcaga cacattttcc tgactgttgt    128700
     ggaataattt actgtacatc gaagaaagaa tgtgaaatga ttagcgagaa gctgaagaag    128760
     catatgaaga cagcatttta ccatgctggg cttagtaaga acgaaaggaa tagtgtacaa    128820
     gagaagtgga acaaagggga gttcaaggtg attgtggcaa caatagcatt tggaatgggg    128880
     attgacaaga aagatgtgag gtttgttatc cattactgca tacccaagtc gctggaaggg    128940
     tactatcagg agacagggag agcaggaaga gacgggctgg agagtgtatg tgtactgttt    129000
     tacacgtatg gggacaagaa gaagatcagt tttatgattg aaaagggaga tggaggatat    129060
     gagcagaagc aaaggcagaa agaggatttg gaggcggtta tccagttctg cgagaacaag    129120
     acggattgta gaagaatgca agtactggct cactttggag agaagtttga tcctcagctg    129180
     tgcagaaaga catgtgacaa ttgcagaaga gagacgattg tcaaaagaga ttatagcaag    129240
     gaggcccggg atctgattct tctagtgtat acaagtagtc gtatcacctt atgccaagca    129300
     gtggatgtat ataagggact gtcgaacaag aagagtaggg agtactcctg gagtgagtac    129360
     tatggaaagg gaaaattgct gaggaagata acaatagaga ggattctccg gagccttata    129420
     agccatggtt atatccagga aagagtagag ttcatggaac ggaggttttc gtggtcatat    129480
     cttgtggcca ggaagacaaa gattgatagg cttgaactgg atgaggagga ggattctgcc    129540
     aataagactg cgaaggataa tgggaggaaa gaagctccaa agagcagagg aaatagaaaa    129600
     ggtataaaaa agattaaaag atgatgtttc ttacttttgg aggtgtaaaa attctgtaat    129660
     tcctagaaat acttgggtgg aaaagaatga taaactttgg tctgaagaag gatatggata    129720
     gatgtgatgt aaggaagcaa gtgaaaatac tggagaacat ggaaaggatt agtaactggc    129780
     tgattgagat gggaggggcc aaagacaaga aggacaagat ggtgaagaga tatgtcagga    129840
     acattctgaa aaggaagtac aaaagataca agagaatggg agttctgaac attgaaggaa    129900
     agcttgatgg aggggtagga aggctttctg atcttggata ttatgaattg aaggcacgga    129960
     aggaagttga agaagttctt agagattcca agctctgtgg gtcaggatta gagttggaaa    130020
     gaatatttaa agaatacatg gatgtacacc tgtgcagtgg gtacaaagag tttctgaggt    130080
     gggttcataa gcttgaggca gacaaaacta agttcagata tctggaatat ttaaacgagt    130140
     tgaaggagta tctatgtagg cttatgaaga tcaagtactt tagaatgttc aagagattga    130200
     tggcctctag gatggagatt atcaagaaaa tagaggcaca gagatacatt gaaaaggact    130260
     tcacgaagga aggaggattt ccaaaggtgt actgtcttgg atgctcaaga gaggttgccg    130320
     gaagtgtgct aaagtatcac ctaaagggaa agaagcactc caagaaaggg gatggagaag    130380
     ttctttatag tgatatagag actttggaag ccgagaatct gattcgaagg gccttctccg    130440
     tcctggatcg agaaagaaag tatagcattt ctttgttttc tagaaggaag aaactggtgg    130500
     gagatggagt cccaaaatgg aagcgcaagc aaaaagacct agacatagag tttgagtgtg    130560
     agatttgtgg gtatttgggg tacggtagag atgggtttga taggcacttt ggagaagact    130620
     tgcacaggaa gtgtgtagag gagtacggga tcaggtattc tcctatattc aagggaatta    130680
     caagaatcgg gactcttatc cggatgaaag atagagtgga ggaatcggaa agctattcag    130740
     aagagtttga ggacagggac ggaaatgtat ttgacaggag gacatatgag gatcttaaaa    130800
     ggaataacct gatctagaat ttactttaag agggcccttc atgataagac tcaaggaaca    130860
     ggctactttt gggaagatct accagataag atatagagac agaatgctgc tgaagagact    130920
     cagggaaata accgtgatcc agacatatgg aattcggatg gagggaagca tcacatgcac    130980
     aaatgaaggg gatttattga gaatcctgag gagtttggct cccaagaaga aggacatagc    131040
     aatactgagt ccttctacat tgataatcaa tgaagagata tacaaaatgt tcagaatatt    131100
     aaatgcagca gggatatcgc tatttctgtt tgttctccaa gacaacccgg tttggtacat    131160
     agatgaagtg ttgtagggtg aggtggatgc gtctttagtt gctgaagttt attttccttg    131220
     cagagctata cctttttgat tcggggctac ccataatttc tatacggctg ctaggagaca    131280
     agaccttcac ccttttctta ggtgttccta tcttctttgg tgtttccaca gcctttttga    131340
     tcttcaggga tctgcttcgt ttcagtggct tggtgggttt ctttcttatc agtatgtcca    131400
     cggaattgac ttttttaaag cactcctttg cactccaggc tccggaattc tccatttgca    131460
     gtgggatgct gggcattatt tatctgtttt ttggagggaa gttctctaga tacactttgc    131520
     ttgcggaaag cacaatgata tggttagaac agatgcttta cccatgaatc tggggataga    131580
     aatcagcttg gcgcctatga tggatgtaac aacagcccac ttcagaagac tcattagatt    131640
     aacgtcctcg tcgactattc tatttacaga aatgattgtg tctaacacag tgatccatat    131700
     ttcccgagat cgtctaagag agaagcttgg agagtatgac gacaagacag ttgtacaaat    131760
     aggggggagt gatgcggggc agatagtaga agccgtaaag atcttgcagg atcttggata    131820
     caggatgttt aatcttaatt gtggctgtcc tagctcgcga gtgaagaagg gaagcttcgg    131880
     ggccgtcctc atgcttaaca aggagttagt tgcagagata atcaacaaag tttataagga    131940
     gacaggggaa attttgagtc tcaaaattcg agtgggagtg gataaccatg aaggtataga    132000
     tttcctgaag gaatttgttg gatacataaa ggaaaatacc ccaaatagga cgttctatgt    132060
     ccatgcacgg aagtgctggc tggaagggct ttctccggag cagaacagaa agctaccccc    132120
     tcttgattat gacagtgtgt atatgatcaa gagactttat ccagaactca agattgttct    132180
     taacggatgc attggaatca acaacctgga tagaataaaa gacttggatg gagtgatggt    132240
     agggagagaa gctatccggg atatacttgt cttctgggac attgaccgta agttgtctat    132300
     gaagtgcgat aaaggagaga gaagggattg cgaggaacta ttcccatttg atatggacat    132360
     gaagaagatc gaatgcagat cagactcgga agccaaggaa tggagagccc agaagattcg    132420
     gtctgttgtc agggaatact ttgaagggtt tccgccctct gatcaactga agtctattca    132480
     tatccagcca ataatcaatc ttatgagggg gaagaaaggc tgtaaggaat atagaaggaa    132540
     gcttaactct cttttgatgg aaagagtaaa ggccggtgag gcatatggcc tgatagtaga    132600
     acatctcaag taatataagt aaagaaaaat aacaacccat tgatgacaga gcctatcacc    132660
     agagaaacga gattcaacga acttccacaa caaataaagc agaaattgat caatatctat    132720
     cggagctcac atcagcaata tctgtcgatg gaaatgctga agccgacaaa gttcaatctt    132780
     ttatactcgc aaacacaaga tctacagaca aggaatctgc aaaaaaattt taggcttctt    132840
     gtggagagcg cagagaagct gaaaaggatg tggtatctct gcaaggatga ggtggatttc    132900
     cggtacctac atgaaaacct gaagaaggcg ttggacgagc tcaagggaga ggtgatgctg    132960
     tacaagaaga atgagggaaa cacagagttt cttgatgaga tctctatgac atatgggatg    133020
     ctcaagaaca agcttgagag ccttacgaag gaaaaaagga tgtaggaggg gtatagtttg    133080
     tcactattaa ataagcttta gtctagtgtt ttgttgtaga tttctgtggt ctggatttac    133140
     aggtgtcttg ggcacggttt aggaggagat gcgaagaggg tcttttggtt gtgccctaag    133200
     gtttatttac ctggaaagag actagatata aaattttgcc ctggttgacc ccgacaagat    133260
     gagagaaata atttcattgc acataggaca ggcgggagtg cagataggga atgcatgctg    133320
     ggaactctat tgcaaggagc atgggatctt acctgatggg agacttgatc aaaacaagat    133380
     ggacgacgag agtgcagaat cttttttttc tcaaacaagt gttgggacat acgttccgcg    133440
     cacattgatg gttgaccttg agcctggggt gcttgaaagc atcaaaacag ggaagtatcg    133500
     agagctgtac catcctgggc aacttatttc tggaaaggag gatgcagcaa acaactatgc    133560
     gagagggcat tacacagttg ggaaggagat aattgagccg gtgatggagc agataagaag    133620
     aatggcagac aattgtgatg ggctgcaggg gttcctgata taccacagtt ttggaggagg    133680
     aacaggatct ggatttgcat ctctaatgat ggacagactt gcagcggagt ttggaaagaa    133740
     gagtaagctt gagttcagtg tatatccggc accaaagata gctacagcag ttgtagagcc    133800
     atacaacagc atattgacaa cccatacaac tttggactat tctgattgct cgttccttgt    133860
     tgacaacgag gcgatttatg atatgtgcag aaacctaggg atccaaaggc cctattacac    133920
     tgacatcaat aggataattg cccaggttgt ttcgtcgata acagcatctc ttcggttccc    133980
     tggatcgttg aatgtcgatc taaccgagtt ccagacgaat ctggttcctt accctcgaat    134040
     ccacttcccc cttgttgcat actctcccat gctgtcgaaa gaaaaggcag cacatgagaa    134100
     gctgagtgtt caagagatta caaatgcatg ttttgagcca caaaaccaga tggtacgatg    134160
     cgacacaaag aagggaaagt acatggcatg ctgtctcctg ttccgaggag atgtgaaccc    134220
     aaaggaggct aacaatgcaa cagccaatgt taaggcgaaa agaaccaatc agtttgttga    134280
     gtggtgccct acaggattca aagttggaat aaacagtaga aaacccactg ttctcgatgg    134340
     agaggcgatg gcagaggtct ccagggctgt atgtgcactt tcaaacacta cggcgatatc    134400
     cgaggcatgg aagaggctta acaataagtt tgacctaatg ttttcgaagc gagcatttgt    134460
     gcattggtat gttggagaag gtatggagga aggagagttc agcgaggccc gtgaggatct    134520
     tgcaatgctc gaagatgatt atgaaagaat ctcttcgaat gcagaaccca ttgatgagta    134580
     ttaaatttat ttggtcaatt gacatctcta gtgtacctac cttgaaatcg aagttattct    134640
     cttgtcataa ggctagactg tatcccttga aaatggaagg ggaaggtaac atggaaaagg    134700
     ttaaggagat gctccaaaga tactcttctc gaggtgggtc attctctgag ggaagctttc    134760
     tgtctgacat agatatgtcg gatgcatctt ttggatcctg ggaagaggag ttggtaggta    134820
     gaattatgaa gtcgctcaga cactgcaagg agatggcgga aatggggaga agaaggaaaa    134880
     tacgtctctc acccaaggag acagcagaat gtgcattgat attggatagc atcaaaagga    134940
     acattaaggg atttggagag acaaggaaaa attggatact ctggggtatc ccgataggcc    135000
     tttccttcct tggaatagca tatatttctg ccaagtatta tttttagtct cccctaaaga    135060
     aaataaagga atctttggga gaagtaagac gtcttgtaaa ggtttattct cacactttct    135120
     cctcgtcctt agacgtcttt ctggtcagcc actgcatcgc cctttgaagt gatgatttga    135180
     caatggcaaa cagcttttcg attccagaca gaaattgctt cataatccct gttttttccc    135240
     ctatcggaaa gggaatctca gtgatatatt ccttgagctc atttatagta tagcccctac    135300
     ttttctcgct gtgtttggga gggttctggg cattcgcaga gggctgtata tttgatgcta    135360
     cttgctcgtg cataatgtcg tctctttcca caataccatc tgtatttccc ttttctttcg    135420
     catgatgttc tctttgctcc tccatgtttg ttgacaaggg ttgtcttccc gatatgatta    135480
     ctcttcaaga catccggtag aagacacata agtccaccgt ggatctggac agcaatggtt    135540
     tgaacgaacc gttataagtt cccaggaaaa ctaggaccca tggaatcctg gaagtcaaag    135600
     tcactggagc acatcaatat acagttccga agtataatgg agggaatggg aatagacgaa    135660
     gagaagcagc ataagctggc ggcaaaactg aatctatcga agaagatcag gaccatcaca    135720
     tcgatgcaaa gcctagacga aagaaagaag aagattaagg agtatgtgat caagctgaag    135780
     gataggaata gcgtacttaa ccttttgagc ttgtcggttt cgcttgaaac cgggcccaag    135840
     gtcctgtatg atattttcaa ttccgaggga ggacatgatg tgcttgtgag gtgtatgagg    135900
     agaatggatg aggagtttgg agatgtggtc tgtgatgccc tgtacattgt tctatccaaa    135960
     tacgggaacc gctttccgcc attcctcagg cctctacttg atggatttct tggggggaag    136020
     atccatgaaa caagatcttt tttcaagatc ctcgagtttc tagtcaacga gaacaaggct    136080
     gacgagctgt ttttcagtac ggatttcaac aaatgtgttt gtaacaccta tctgtccagg    136140
     attatggaat tcatcaaggg cattccgacg attgaagagg agttgaactt tttggttcct    136200
     cttctcaaat ccccaaaggc tgtacatgtc cgatacattt tgtttgtgtc ggacctttca    136260
     cagcttgagc agagggtaag caacaaggaa gtctttgaaa ccataataaa ggagatcaaa    136320
     cctggggtca ggcaggattg gaagaggggc agaattaatg aggtggtgag gctagcagag    136380
     atggaggggg tgcttgatat tgcatgctgt gtttttgaag catttgcatt tcgagacagc    136440
     aaggtatttg cagatgtcga gaaagctgtg gaaaagatga gcattctgga aggggttgaa    136500
     ggagaaaaga aggaacttcc aaaggttgag aagaaggaag aagtagttag aaagccagag    136560
     gctgggaaga caaaggggcc aaaaaagata atcaagaaag cggttaagag tggagggcca    136620
     acaaaaagat atgttcaggt gaagtggacg aagatgggaa agggaaatag cctatggagc    136680
     aagataaata tagaggagat ggaaaagaca tttgggaccg aggagtttga tggatttgaa    136740
     gtgaaagggg aaaagccaaa gatatcccat ggggaagcag agaaaagaag gccaagtgta    136800
     ttttccgaga agaagaacta tgcgattaac attgctcttg gaagggtgaa ggaaagcaat    136860
     cgagatctga agcgggcaat actagatatg agggagggac ttaatgaaaa tctggtgaag    136920
     cagcttcttt tttactttcc gacggatgaa gagatcgagc tgttacaaaa caccgagaat    136980
     gtatttggaa ggggagagga gtttttcaaa gaaagtattg aggagataga gcttatgaag    137040
     aggtgccttt attaccttta ctttatgata tcatttagaa atcagaatgt atgcaagact    137100
     cttaggattc tggagaggta ttacacagta cttctagaaa gtaaggagtt ccgacgattt    137160
     ctagggatta ctctagttgc ggggaaccat ctgaacaggg ggagcttctt gggaaatgcc    137220
     gaggggttta ctatggaatc tattccaaag atattggaag tgaagaatga tggagaaagc    137280
     ctgctaagcc tgctgaaaag aaagatcgat ggcgagcaac tgctcaagga tctgagtgtg    137340
     gtatatgatg caagcggagt caacttcgag gcgttatgca tggaagttga ggagctcaag    137400
     aagaactaca tcaatgcaag cggatccacc tttcttaaga tacaggaaag gatggagagt    137460
     atacaggaag agtacgagaa gatatgctct ctccacgata aggttggaaa gctccatcgg    137520
     gattgcaagg agtactttgg ggagaaggtt gatgacgagt tcaatagctg gattatactt    137580
     cttttggaca ggatgtctca tgacatgaaa aagaagtagt attttgacca tgtccaaacc    137640
     cttgaatgag aactatgaaa gaacaatggg actcgtttga aacagggaat ctcacaaagg    137700
     aaacaacaaa ggatctgttg agattatgtg gatttgcgcc tcgagaaaaa gacatatcaa    137760
     tacctaggac atttgatgag tttgagcagc ttgcgtccag cattgcatca ccaataccga    137820
     aagacgagat gaagaagatg ttgaaaatgt ttatacatga aacacacatc accaaacagg    137880
     atcttggaaa gtacatgtcg atgggggaca agttaagcga agaagagatg gaggagttct    137940
     ttagaagctg tccatttgac agaaacgggg agatcactgc cgacgagctt cttgactttc    138000
     tgtatggttc acaatgaata aatgttttgt tttcgtctgc cttgcttttg tcttgaagag    138060
     atattcactg ataatgatgg ccctctgatg ctgaccattg atgaaatagt gggggaaaag    138120
     gatcttgtcc agctgttccg aacgattgta aggaaagggg aagtaaagtt cctaaacaga    138180
     caatatatag taaagaggat aagagagttt gcgcctttgt cgatggagga tcttgagggg    138240
     ctttacgatg aagatattct agaggagctg gagagaaaca gaaggtggtc tattttaagg    138300
     aggctgaaaa gagacaggaa atgagagccc tggctgatct gattgatttt gctgtttcac    138360
     ccacccttat aaacaaaaat actgaaaatc cctaatggtg gttctcacaa cccaggggaa    138420
     ttccaataga aagatctttg aaataagaga tggaactgca ttgggagact tgctccgaga    138480
     ctatgttcgg gcattggaac tatactcgat cgatatggag agtgtgaggg aatctttatc    138540
     ctcgattttt gcatacatat ttcttttaac tgtgcagatc ttcgggttcc tgtgggtcgt    138600
     ctcatggact gaaggcaaaa aagggataag ttctgctgca ggactgtctt ttggggcctt    138660
     ttgtgtgatg actatgttct tctttggagc cggatatatt tacaaagaaa tcctcaagaa    138720
     aagagctgat tcgtcataca tctcgtatgt ctatgtggtt gggctttctg ttgtacacta    138780
     cccgtatctt atgtttatag gactattggc aaagaatata tggatgtttc tttgtatgat    138840
     ggccatcacc tcgatttccc agtttcttat ccgatcatct atgctgagga accacaactt    138900
     cgagagcagt agagatggat ttatgtttga cattgcctcg tttatcctcc agtgtgggtt    138960
     ctgttttgga agtctttctc tctttagttt cctatcgcct gggaattaaa ctttttaagt    139020
     aagaacagaa tatttacttt atttaactct gtttccttca gttgtatgtc ttgtttaact    139080
     cgtatccctt tccagatgcc caagcaatat tgattccatt gtttgtgtcc acctgatgga    139140
     tggtttttcc atcttcaatc ccaaggttct ttatgaaaga aatcagataa aacaacctac    139200
     ggcattcgag agactcaaga agattgcact tcttgtagaa cttgtccttg acttccttca    139260
     tgcttgtctt ctcgcctctg gcaatctttc caaactcgtc atggaagtaa gaaagtagat    139320
     acaagctgtc gacatcattt aggaagggct ttctaactac gtttgcaagc ttcaatacga    139380
     tgtttgtagc acacaattcc tggctattgt catccttgga cttgcactct tcaggatccg    139440
     acaaaccaag ggatgtgatt ccaaggtcga ttgactcgga agtcactctt ccgttctttt    139500
     ctagaaaaga tatttgagta cttcctccgc ccatgtcgat gattcctagg cttttctgct    139560
     cgttttcctt tcccttgttg gagagaatta gtgccatgag agcaaatctt ccttcatcta    139620
     tcccatttat cacctcgatc tccttgagat tgtattcctt tagctcattc cttacaagat    139680
     ccagaatgtg gtctgaacgc gatttgtcca atgttctgaa tcctgcagtt ccgtaaaacc    139740
     caataggcat ctccttgatg ttgttgtaga acggctttgc atgtgtgaag agttctctga    139800
     ttgagttttg gatctcctcg tcactttttg cacctgctag gccttgagaa tttgtaaaaa    139860
     ggccctggtg cttgatctct ccatcaacaa acccatatat attcaatctt gttcctgtgg    139920
     atcctgcatc tattacccca ctgtatgtca tcttggacgg ggaaaaggcc ttggaattgg    139980
     agggggaaga aagacctaag ataattcctg ggagcaagag gagcagcata gtatccattt    140040
     gagtttgttt ttttgttcga agcagaaatc ttccatcttg ttttagatca tcaacgccga    140100
     aaagataaag aggctcaaca gaagtactat atgggagttg gatggatttc tattgaataa    140160
     tagatttgaa gtctcccctg tatggcaacg ctgtctcaga agaaacttgt agagtccata    140220
     aaactgattg aaagagagtg gataaagatg cacaaggcat tagccagatc aagatgtgga    140280
     gaggtaaagg aagtcaagta caagtatgtc gaaatgattg ggagagggtc ttttggagta    140340
     gttgttaaaa taatggatga cagacttaat ttctttgctc tgaagagagt ttaccaagac    140400
     aggagatatc acaatagaga actcagtata ttgatggaag tagaccatcc aaacattgtg    140460
     agacttgtat cgtacttcta tacggataag accccatctg gaatgtatct taacattatt    140520
     acggactttg ttgggatgaa tctggaggag tacatgaagg caaatagaaa tgtagaaata    140580
     gacacgatta gaccaatata caggcagatt ttggaagggc tggaatattt acatgagaag    140640
     aagatatgcc acagagatat gaaaccatcc aatatactca taggcccaaa tgggttggtc    140700
     aagatttgtg atcttggaag tgcaaaggtt attggcaatg gggagaagaa tataacatac    140760
     atatgctcca gattctacag ggcacccgag aaccttctgg actacaagga gtatgatttt    140820
     aagatagaca tatggtctgt aggatgcgtt gttgcagagt ttagacactc tgggcctatg    140880
     tttaaaggag atacgagtgg atccacactc aacaggattc tggaaattgt taaagcttct    140940
     gaggacgatt tgattggact cggatgccaa aggaccgatt acaagcctgg agtaggggtg    141000
     aggaagtatc ttgagaagct cttcgatgat cccgatcttc ttgaagttct ggagaagtcc    141060
     ttggtatttt ctcccagtaa gagatccact gcttcttcgt tgctaaagag tcggtttttc    141120
     caatgagtac atgcccattg gtcttcgata ttgtacagcc gaattttgtt ctgcatgtaa    141180
     tgcagagtgt attttgatgt aattaaacat ctttttgaac aggaagaaga ttagaaatgg    141240
     ggatttttat ttactcaaca gttacagact tggcaagatt tcttgggaag tcggcgttgt    141300
     atccccttgc gacggcaaga tagtaggata ggagttgcag aggaataaca gcaaggattc    141360
     cctggaggca atccactgtt ttcgggataa ccaacagatg gtgtcctgca tagtccttgg    141420
     aaatgtcttc ggtgcatatc ataataggct ttccacctct tgcaagaatt tgttccattg    141480
     catttcttgc cttgtcgtag aacgtatcct ttgttatcac aaagataatc ctgaacttgt    141540
     catctacaag agcaatgggg ccgtgcttta gctctccagc tgcaagtcct tcggaatgta    141600
     tgtaggttat ttcctttatc ttcaatgctc cttccaagca ggttgaatac tggtgtcccc    141660
     ttcctataat cagaaggttt gcatcattct tcagtacatc tgctagatct cttgtcgaat    141720
     tgctcaactc cagggtcttg tctatatggc tgcttaggtt cttgagccct tccattattt    141780
     ctcttcttct ctcttgtttt ggaaggctct gttcacttag ctgaagggca actagcacca    141840
     atgcaacata ctggcttgta taggccttgg tacttgccac acctatctct ggcccagcgt    141900
     ttatgtggat gccgcattct gtttctcttg aaatggtgct tccaacaaca tttgttatcc    141960
     caacacaaag agcccctttg gataagcagt acctgagtgc catgacactg tctgctgttt    142020
     ctccgctttg agacacaaaa aacacacagt cgcttcttag tataggaggc cttctgtcca    142080
     gaaagtcact ggctatttca acactcacag ggatctcaag gagctcttca agcagtcccc    142140
     tatttgcaag gctggcatga taactggttc cacatgccac aaatattatc ctttgggatc    142200
     ttcttatgtc atcgatgtgg tccttaaggc ctcctaaaga aactttgaag ttttcaaagt    142260
     tgatccttcc cctcatcgtg ttaaccacag attccctttg ttcattgatc tccttgagca    142320
     tataatggtc atagctcccc ttcatgattt cagccaattc ggtctcgatt gtcttgactt    142380
     cccttgtact agacccggtc tcctttatct ttgaatgcat cctgtggata aatatgttac    142440
     cattggacac gtgggctatg tcgttgtctt caagatagat aacctttctt gtgtgctcca    142500
     caagggcaga tgcatccgat gcaacaaaga tctcaagagg ttccttattg tatgtatgca    142560
     gagaacattc ttgaacgccc tttgatatag tttcgatatt tggattaaat ttgtacttat    142620
     cgaagtttgg agacattagt ggagagccca aaggagagat agaatggtcc atggagtcgt    142680
     catagttaac accgaagaaa tcaaaggaca tcttccctga gggcttgagg cctataagga    142740
     caggggaaga cttcctaaca acaaccagtt cgttgggaaa caaagaagaa acaaacacaa    142800
     acgcaaatgc tccttcgcaa tgtcttacaa ccctctttac aactgatacg aagtcaggtt    142860
     tttttccttc cttctccatc tctttgtaga aatagagtgc aagttttgct gcacactccg    142920
     tgtctgtact ggattcaaat gtaaatcctc tcttttcaag atataccttg agatccttgt    142980
     agttcgtgat aattccattg tggacgacaa ggaagttgtt ctccttgtca ctgcttagag    143040
     gatgagaatt ttcaacactc ggctggccat gtgtggccca tctagtatga gcaatgctaa    143100
     catggttgga aacctttctt gaaaaatcaa tgggggcttg gatgtttttt atttcgcgaa    143160
     gcttatcaac ttttccaaca gacctgattt tgacaaagtc cctatcgctg ttgtctgtga    143220
     tgcagaatcc tgcagagtca tatcctcggt attctatcct cttcaagcca tttatcatga    143280
     tgttggctat ttcgtccttg gttttttctg tagagaagtt tgcgtatcca aatattccgc    143340
     acatatggtc tgaaaattta gtttatttat acatgaaaag aaggttagat gaagtttatt    143400
     gataaacaaa attgataacc aattaatttc catgaattca ttatcttggg aggggatttg    143460
     tggaaagcaa tagacttcag atatccccaa tgagaatttc tctgaaagac gagaagtttt    143520
     ttcgaaccat gataggtgta tttgccgata aagggaacat cgaatttgat ataaggccgg    143580
     aggaaatcac agcctcatcg tgtggtcaaa gtaattttta tttggtgata aataacgatg    143640
     tgtttacggc tgatggagaa tgtttatcat ttgttgtgaa agctcagcac ctacttgagg    143700
     gtataaatgc tctaggccga tatgatctcg ttattgagga cgatcttaag cttttagacg    143760
     gagggaacac tatatttatt ccttttctac cagcgccaaa aagcgaatac gaggagcctg    143820
     acactcctgt cgcaaagctc gttgtaagcc ctgagctact ggaggcattt gggatgctga    143880
     agggggttgt gacatatgaa atagagggaa acaagctatt tattagaaag gccggaagcg    143940
     atgttctgga ggaaattgaa tttttgacgg gaggattcat tatagctgga gatcttcaat    144000
     ttaagtgtaa taacagatgg acagatgtgt tggccgggat caagagttat gttgactcca    144060
     taatgcttac atttggcgca aacactctgt gcattcaatt tctatttaaa aagtattcta    144120
     gaagttattt agagttgcag gtctggagat ccctcgggga ttgatttagg gcccggagat    144180
     aaaaagaaac ggccataata ccccaaatgg aaagcaaagg gtcgaattac cactgggccg    144240
     agtccgactt gtctggctgg gcaaaggata agatcaagga gaccttagaa catcgaggct    144300
     acaaagtgaa tgagatggat gtgatggtta agatatgcca aaggatgaat acattagggc    144360
     tggtgtatat gataggcttt gagtgcacga aggatggaaa gtattgtagc ataagaaact    144420
     tctactctgt gtctgaaaag gcagaaggga tggaagactt cgaatggttt cccgggtttt    144480
     tctcggagct tgaggaagag gcaatactca agtttggaag ccgagttctg gatactaata    144540
     ggcaagtgga ggagagaaaa ccttgtgtca ggagtataga tgctgaggat gcaaagactg    144600
     tagacataag ttacaaggca agcattaact gcgagattaa tgagttcaag aatttcatcc    144660
     tatcccaaga atatatttcc atgtggagtg ggtatagggc aacctttgat ggagacgaca    144720
     tcctaattga cggggtaatc atccggagac tccgagaaga gaacggatgt atcaggatgg    144780
     agtggaaact cgagagatgg agtcacttca cagaagttaa gatatctctc gagtcttttc    144840
     ttaatagctc aaaggtaaca gtgaaacaaa aggctgttcc aatcaaggaa gagaaaagca    144900
     ttagaatgtg gtggcatgag aaagtatttg cctcgatttc tacttgcttt ggatttatcc    144960
     taaagcctct agaataatct gcagggcttg actacaataa aacacaagat ttctaaatcg    145020
     agtataaatg tggactcctg catcaacaga catggtggca tggaaagatg gaaggggcga    145080
     ttgtatcata agatgttttg gatgtggcaa tgttgtctgt agaagggcaa gacgggccat    145140
     gcttctatcc aatgtaaaga tcgaagtata ttcggcaaat gttcccacag aatgtgtgaa    145200
     gtgtgtaaga gacggttacc tggcatattc atgtcagtgt attgttgttg atgcagaatg    145260
     tagatgttgc cgaatgattc taggatatca tattttacat ccatgcaagt tatgcgaaga    145320
     gattggaggc atcagacatg catggatctt tgatacaagc tctgtcattt cctccatcag    145380
     aagggaaaga tcagaggctt gcttgaacgt gtctgcagca tggaatgggg aaggagacaa    145440
     cgaagtgaag ataagatagt ttgagaatta aacaaaacag cctaaatgac tttattgcta    145500
     tttctttaaa gtaagcacca aaacatatgc tgaatggcag aaaaatagag ctcatgactt    145560
     attcaagagc ctgatgtaca tttctatcat ttgcgatatt atcaaaacaa cattacttaa    145620
     tattataata atcagaacaa cctcgaactt ttcaatactg ctcctatttg tgttttcgtt    145680
     gaggatctct agtattccgt taatcacgtc acacctcctg ttcagcaggt ctgcccttgg    145740
     cttgatatcc aaatacctct tacatgtttc atagagagac gaaaatgcag ggtagtccca    145800
     cacaaactca ggctcatcaa gaatattgga tccaagattt agattgaacc ttagtctatg    145860
     caatttacct atcatcttca atatctcctt cttgcttttg ctgacctttc cctccctctc    145920
     gacctcttca gggaactcct taactgcatc gatcgtgttg tccacaagat tctcgaagta    145980
     gtccagcttc acactcttgg ctattgcaat cgaaatcacc atctttgtaa agtgattttc    146040
     agagttcaag tatattacat cgttgataat aaatggatta tccgttatac catatttgaa    146100
     ggactcaatc tccacctcgc tcggctcatg tccgttttcc tcatacttct caacaagctt    146160
     gactatcatc gattcctgca tctcagacat tccccaacac actacaacac cgtactcgta    146220
     gaagaagcag tcatgtcttt ctccactgcc cttgaagttc atcagagtgt acagacattc    146280
     cccaaagtac atggagactt tgttgcatag agagttgctc ttcaaatact tgtacagatt    146340
     cttgaggtcg tatccgtctg cagtacaata ggctgttact ctgaacagct tcgtgtctgg    146400
     gaccgtgttt tcctcttttg gcatcatgtc tgtttcaatc ttcagtgcat atgcatcctt    146460
     gagggctcga agctctatcc tggcctgctt cctgcctcca gcatttggtt ctctacttat    146520
     atcagtcaag tataccttct gtttgttgta gtcttcggcc ataaatgctc agggataaaa    146580
     ttttggggtt agaaatcggt ctccttactt caaaaggaga agagacataa acggatttat    146640
     tgattggaaa aatattcact cacctccttc ttgaactcag gggacctctt ccggtttccc    146700
     tggggccttg taaagtactt gaagagctca cttcgcttaa aaatcttttc gtcctcaaac    146760
     atcctcagat actcctggat ctttttcttc tcctttccat tctcaacaat ctcctcggca    146820
     gagcttaaga gagctttcgt tgaaatcaga ttccctatgc ccttgcattt cctaaggcca    146880
     ccatcaaaca ttagaacttc ttttccgata ctttcgtcgg aaagtccatg gcttcgaagt    146940
     agatttacaa tatcttccga tttgtcctct ccagactcca tcaacctttt catctcgtcc    147000
     tggtacttat catcttcttc atctccagga ttaaaatagg catcatcccg ttccaaggaa    147060
     ttcctctcta catccttgag aatcattcca tttagtttgg agcttttgac atcggatatc    147120
     tttccgcaag ccaggcattc tagagataac ccgccattgt tgatatagaa tgtctctggg    147180
     ttgttgcaaa atggacacat aacatatgca tcgatgaagt catatatcag gtcttgaatc    147240
     ctcgaggatt catatctccc gttcacagca taccgtccct ttccaatgtc tgtcctagta    147300
     gccagttcat aactcataaa ctttagaatg tacaaaggcg gcctcttcag agaggagctg    147360
     atatcctcca gattcacaat cactgttctt gtgtttccag cctttccttc ctgctttaca    147420
     actgctctag gcatcttgta cctatagtaa aagtcattat ttgttctatt tatgtcgatc    147480
     atgccataaa tgggaatgtg tatattgggg gatttaccca taaacacatg gctttgataa    147540
     aaaattgcta aggatcctcc atgggtaaga gcaaaagtac tggaagaaca aggctggata    147600
     agtattataa tcttgcaaag gaaaagggct acagagcaag atctgcattc aaactccttc    147660
     aaattaatag gaagtatgca ttccttgaga aagcacatgt gctcatcgac ctgtgtgcag    147720
     ctccggggtc gtggtgccaa gttgcagctc aggaaatgcc tctaagaagg aagatagttg    147780
     cagttgattt ggagccgata aagttcatgg gggatgtcga cacgatcaca gcagacataa    147840
     cctcagatga gtgcaggctt agactacggg agatacttgg aacacacaag gcagatgttg    147900
     tactccacga tggagcacca aatgtgggaa cgtcatggga aaatgatgca tttaatcaga    147960
     atctccttgt attgcattca gccaggctca cagcggagtt tctaaagaag ggcggtgtat    148020
     ttgttacaaa agtgttccga tcccaggatt acttttcatt gctgaatata ttgtcgcagc    148080
     tttttgagac tgttgagacc tcgaagccgc tcagctctag aagccaaagt gcagaaatat    148140
     ttcttgtgtg ccttgggttt attggagaag aggaggtaga ctactcgatt ctggatcctt    148200
     ctgcagtctt tacggaaatg aaggagacag gagggtatga ggatttcaac ttccacaaga    148260
     aactgaagct tacagagttc ctgaaggagg agaatcccga aattttgtct gagatgcttt    148320
     taaagtattc ggagattgta gttgatatag atgaaaaaga catagagaag atcttggagc    148380
     ctgagtttct gtatctgttt aaggatctcc aattactagg aaagggagaa gtcagaaaga    148440
     ttctagccaa gaggaagaag atcattcggg cagtgcggaa aggagatgtt gacattccag    148500
     cactggactt ccttggaaga aatgaagaag aggagattga gatgaaagaa aagagtgttg    148560
     aggagaagat agaggagata gagatgcttc ttgaaaagaa aaaaaaacag tcccgccgtg    148620
     aagagtgcaa gacaaagaat gaacaaccag ccgagtgttt ttttaaggac tcagtgtttg    148680
     ataagctgaa tattataagt gataatgaag aggaattgga agaaagtccg gagcaggata    148740
     ttgaagtgag cagttgttcg gacagtctag atctcgatga agaagagctt atgtgtattg    148800
     caaaacttaa ggaggatccc gaggggtttg tggaggatac cattgacaga tacatccgtg    148860
     atcccaatga aaagcttcca aactatcttc gtgaggacca agaagccttt ttttcaaggc    148920
     cttcaaaagc cgaggaaaga aggctcacaa aaaaggaaaa agaggcactt agcagacgta    148980
     agacaagggc tgagaggaga gctgaaatgt ttatgaaaga tctggtaata gatgattctg    149040
     aagaagaggg caaggtagca aagaagattt ataagtcatc ctttaagaag acaaagacta    149100
     agccgagagt tgtgttccct aagaagggaa gatgtggagt cccgcgaggg aaggggagag    149160
     ttgtgatgct ggatagaagg ctaaagaagg acaaaagaaa aggaaaggcc tgatgctata    149220
     gcccgtcctg agtaatagag catatcatta aaaggattta cttatttatg gaatttaaag    149280
     acaccaaaag atcaagttta tttcagattt tcattcattg cctatgctcg atgatatagc    149340
     cattgcacac acaagcccga gaaggccaac aacctctcca aagattagta ttaagaagaa    149400
     gatactgttg aacttctttt gttgggacct tgtgacacat gcaacctttg cagagtagcc    149460
     tatggaatat ccagcaacac ctgaggatac gccattaacc acacatgcac tcaggaccaa    149520
     aaggccatcc ttgagagatt caatcttctt gtcataaacc atgaagtata gaatcacaga    149580
     gtacattgtt ggagctgtaa tgaagatgat tggaacaagg gagtaggtgg tattaacaac    149640
     attttcagca gccttacaga tgccctccga gcctgctatg aatcccaggc ctccgcctat    149700
     ggcagaaaga gaaatcatca gtcctgggcc tagctttgaa atgattaaac ttagtgtctt    149760
     ctcgtctaac tccatgtata cccttgtttt attttgataa atattttaga aaacaaagtt    149820
     tccaaatcga aacaacctgt acttaccaga ttggccaata caaaatggga ggcgtatgga    149880
     atgtcccatg gggaagagcg actttctcgc aaagtttgaa gagatgaagg atgggacgtt    149940
     tacgcctaag gaccagtccc agaattggtg ccggcatttt ggagtgaaga aggacaagag    150000
     gctgcacctg taccccgaag agatgctgta cttgtacgac agaaatccta aagaagaata    150060
     ctcggtgaga acaaaggcat acttctttat cagaaacaac tgctacaacc ttcttctcgg    150120
     agaggacggt agatttcttc tgtacaggag gcataagaac ttcaatagaa agaaggataa    150180
     gccgatctgc ttgatgagat atgtacacag ggatgagtgg atggaagatt caaccaaaga    150240
     cattgtcgat gagtctttct gtgtgctatc tgatgatgtg tttacctttc tgaggatccg    150300
     aaaagtctta aagcttggga tggacactcc tgaaaatttg aggaaatggg atggagaacc    150360
     cttttgaacc cctcatcttt ttcccaagac ttctcaagcc cttgaaatga gtaggaacgg    150420
     acaaggagac caaggacaac tgacaaaaac aataatagcc gttggattca atgaccagaa    150480
     acatcaggaa gaagtaagag gcagggttga aaagcatttt gatgtaagag aaagctacaa    150540
     aatccaaaac gaccatagag tgctttgcat actcttttac gacgagagga gggcaagaga    150600
     agcgatttct ttcctcaagg aagagggtat ttcatcctac cacataataa gcaagtatga    150660
     gattcccagg gatatggaca aatgcgatga atcccgaaac caaagcacac tgctatttac    150720
     tttcaagaac ttagcgggct ctgttgacga caaagagttt ggagagcagg ttgggcgatt    150780
     tggagaagtg aaggacattc gatacgttaa gacacatcaa agatgtgtgg agttctatga    150840
     ctcaagaagt gcagttgcag ctttccatgg aatgaacgag ctgaagttta tggatggaat    150900
     gatgcaggca aagtgggtgt gggatctctc cacaaagacg agatgggagc ttataaggtt    150960
     aacagacagt attttgaagg aatgtaagtt ggagataaag acgcctacaa agagagagag    151020
     tgaggagagc aaggaagaaa taaagagaaa gaaaaaagta caggacagcg acacggcaca    151080
     ccctagaaat atattcttga aaaggtttga ttccttcatt gctttgaata ttgaccatat    151140
     aaccgaggga tatgtcaatg actgattaag cagggaattt ctggagcctt atttaagatg    151200
     caagcactac ctgaacatcc acctttaaag aagcaagtaa agaaccagaa gtaaatgttt    151260
     aatataactt cttatttctt cttcatcgtt ttgaggggtt tcttgggcct cagatcctta    151320
     ctgtcgcact ttctgcactt ctgtgcagac ttcccagacc tcgcataaca tcttcgacag    151380
     ataagacagt cgtttttttc cttcatggcc atggcaccgt cgttttcaga catgtttccc    151440
     cctcctccaa gaagtctggg atacattgta attgtatcga gattccttat gccatagctt    151500
     gccactgtgt tggaatcctc caatattcta gagttgtgct gcagaactac cattgaagaa    151560
     ctaagtccac aggcgtttcc ggcaaggcct ttcaaagaca gaataggctc cgatggatcg    151620
     gcctgaacaa acgaagtctt tccacaaaac ctcactacaa tcttcattct taaagggcaa    151680
     aaatttccag agtaaaatct gtgaagttct ccagacagcc tggggacaat acaagtaaag    151740
     acatttattc tactcaaaca ttcgatggca aatccagtac actcggcaca tggggcatat    151800
     tttcctctgc tggagccaca atgctatgca atgcgaatgg aaggtgtgtt tacacttgcc    151860
     tatgcatggc ttgcactcga taggatgctt acattttatg cacatctggt caaaactctg    151920
     ctggcatatc ccgcatatat cgctttctat gtcccatttc caattgtaaa caggatagac    151980
     tttcttaatc tttatttcga ccattctatc ggacaggttt tatgattgtg gggagtcact    152040
     ttcgctcgaa gataagcctg tagaaaattc cagacttaca gagagagcct catgcaatgg    152100
     aaccaaaagg cagttgaaaa agacaagatt ggatctctag atgatagaat gaaaaatttg    152160
     caaagagtcc cagaaagagg gagaaaaaac gtagccctga aatggggata aagtacagct    152220
     atgagataca tgatccttcg aaggctgtga agggtaagat cgacaatgca aaggtaagct    152280
     tcaagaagac tagagagact tgctgtactc taaggaagag gaagctgctt gacgcaattc    152340
     agtatctgaa aaacgtgatt agcaagaccg aatgtgtacc gtttagaaga tacaaccgtg    152400
     gatgcgggca aacacaccaa gcaaggaagt tcagcatacc tagaaaagag attgtgaagg    152460
     ccaatggaga gaaagtgatt aaaaggggac atgtccaaac aagagggaga tggcctaaga    152520
     agtctgccga gttcgtaatt tcacttcttg aaagcgtcaa ggaatctgca gaatccaaga    152580
     gtttggatgt gggaagtttg gtgataacac atatccaagt cagcaaagct ccaaagatct    152640
     ttggaaggac cttccgagca catggaagag taaatccatt caataagagc ccatgccata    152700
     ttcaggttgt tgcagaagtg ttggagagca acgatgttag catcgaggcc taagctacct    152760
     tacgattaaa ggttttcttc ttatttttta ttccttccta aaggccctac ttgatgctga    152820
     acaataaggg aaggatccat tctatgagcg gaggatttaa tctaagagca ccaagggaat    152880
     atggattgtt tgaggacatt gattttccta tgtctttaga ttccatggat gagctggaca    152940
     ctagaagtag cataggggcc atgaatggaa cagaactccg aaaggatggc atagagagtt    153000
     tgtttataag caaaaagaat gactacaaag aagtgaagga ggaggaaaag ttcaacccgt    153060
     acgaagacaa ctcgggaaca actgtttgct tgaaacagga tgacttcatt attgttgctg    153120
     gagatacaag acattcgtcg gacatggtca ttaactctcg agaaatgtca aaaatatttc    153180
     ggatggggaa ctttcttttg accgggacag gattttatgc agacacctat gaagtctata    153240
     ggaaaatgac agatgaaata ctccaatacg aagtcgatgg gcccatgagt attcatagct    153300
     cggcaaattt gctctcaaag attttgtact caagaaggtt tttcccatac tactcgttct    153360
     gtactctaag cggatttgag aagggaaaag cttaccttta tcaatatgat cctctaggat    153420
     cttatgatct tacaacatgt gtatgcaagg gaagtggaag aagcatgatt caacctctgc    153480
     tggactcgtt tattgacaaa aagaattgga ataacgcgag tgatgcacag ataagccagg    153540
     aagactgtat aagactggtt gtaaaggcat tcaattcggt agcagagagg gatataaaga    153600
     ctaaggacaa tctggagatc tatgttgtaa gagaacacga gctgactcac caaattctcc    153660
     ctctgagaag agattaaaat cgatgtctta tgccttgatt ttttaccttg ttgggagtcc    153720
     cttaattttt ggacgatttt taacccggga aagatatccc caagcatttg cagatgaatt    153780
     tcttgtttcc catgtttctt tcgcttgtct gctccgaaaa cttggggatt cgatatgaag    153840
     acgtgatcag caagtgggtc aattacgaga agaggagaat gagggatggg cctcttgggg    153900
     tttcgccttc ttcgtttact atcgagaatg gaatgcctaa aagtagaagg cttctggact    153960
     cgaaaacaat ttggaatcca gtaaggatgt ttgaagacga ttttgaagga ctagaatgca    154020
     aaggagtttt aaaaaagatc tctagagatg gagactcgaa atatttgagt gagggatatg    154080
     aaacgctgct cgatgaatca ggaatcaact atttgtgtct atcgacggca gttaggccgt    154140
     taagaatcag catagagggg attacaaatg tagcaattgg atatagaggg tattttgatg    154200
     aacaaaaggc acaaaaacta ggggaatgtc tttctagagt tctgaatgga atggaagtgt    154260
     gtgttattcc ggaatccctc tgtgggttgg tatcgaagct ggagcatgtg ggagaagacg    154320
     tttccttgca ctgcatggta attatgactt cagggagaaa gacagtattt tcactttaca    154380
     aggtggagat aaaggacaag gagagaagat ttgagaatct gttccatgag agccttgacg    154440
     gaatatctga ttggaagatg gaaagaatag tatacgatta catagaggaa aagcttaagg    154500
     aatacatttc catcaaagac gatatttcgg agacaagcag aaacgtggca ttctatcccc    154560
     agatagaaga gggacgggac tctagtttga gaattgacat gaggcctata tacaaggaga    154620
     tcagaaatgc tctaagatat gagaatccaa ggggaggagt gaagatggtt aatggggtca    154680
     gtgttgttga tggagaagaa aatgtaaggt ttgttattga ggcacctatt tttaacattg    154740
     aagaaattca gaaaagactt gaggaatttg ttaaagagaa cgaaggggaa tttggcagga    154800
     tggttaagga gataaagaag aaagcggagg agattattga gccagggggt tacagtgtga    154860
     tgatgaggtc tgaattctat gggaatccga tatttgacag gatctttggc aattttggca    154920
     agagagacca cataagatcg gaaagcattg agaagggagc agcaaggatt atgagaacag    154980
     aatatatggt gattgatccg aagattctac gtgtaaaagg aagaagtgga aatggagaag    155040
     cttacttgga tgaagtcaag gcaagaaggg agattggaga aatacttgag aaaaagaaag    155100
     acaaaaaact cagagatatt tttgagctgg tacctgattc atgtatagaa gaagcagatg    155160
     agatcttttc ggacgttagt gagctggact ccatcaagag ggcagtggag aagtggaaag    155220
     aattggaagc caaagacgga gagattagag aagagaaaag gttgagagag caagctctga    155280
     aggatctaaa agaggcgata atttcggcag agaagttggg aaagagtaat ttggaagtgt    155340
     gggattcggg attgaaggac gaggtgacaa aagcactgga gcatctgaac atcatgagcg    155400
     ccgatagcaa atataaaaag aaagatattg aagaggtgga gttcaacctg attattagaa    155460
     gcaaaagcct gtttaatgca tacgaagaaa aggccaggaa agaggctgag aagaaggaag    155520
     aagaaaaagc cgagggagac ggaactgaaa aggaagctga ggtaaacaaa gactctgagg    155580
     agaaaccgga gtcgggagag gagggtagat ctgagctcta aggaattaaa attgagtctt    155640
     ttatattctg tatatgaatg gtcaggtttc taagtgggaa ttccttctgc agcactttac    155700
     ctgaattttt gtagggaaaa acaatagacc cttagagata tacatggacg agagccgaga    155760
     gagatacgag gcagaaatga caaagaagct ggatgcattc aaaacagcaa aggaatggtc    155820
     tgactttatt tcccttctga gctcactgga caacacgatt aggaagtttt ccataccaga    155880
     aataccaaaa aagaagcttt tgtttaagag gctaaaccag tgtctaaatc cggttttgcc    155940
     tgcaggaatc cacaacaaga ccttggaaac atattctttg gtgtttgaga agatttccag    156000
     agagaacttc ctcaaggagt ttgacttttt gacactggga ctcttcacgt tttcggcaca    156060
     ttgtagaatt cttgtgataa gttcttttct ggaccttata gagaagtata ttgttccatt    156120
     gggggcggat gtggaaagat attccacaag catacttata gggcttcttc caccgatgga    156180
     gttcgaatct ggagaacatt acagccgagc acacctcata gtaaccgagt ttaagtctct    156240
     ggtttctcta gaagtattct actcttcgat gtggagcatc cttcttaacg acgaaagact    156300
     cagaacatct gtggtgaatt atatgctaag cctaggctgg gaagagcaga tattggggaa    156360
     tgaaagactt gtggtaagag ctctgtgtgc aggccttgga agcgaatcga ctttagtggt    156420
     aagaaactgt ttagatctcc tgatttttgt atttcccgat aaggatcacg tttgtaaaga    156480
     ggatatgctg gacgacctta cggaggcggt gataaggttg tttgtaaaaa gagacctttc    156540
     tctcaacaag aggatctacg gatggatgtg tatggcagat aactttaacg aggccgacgt    156600
     ggctttgtta agtagggctc ttaaaaggtt tttggacaga aacagcgcag aagacatcca    156660
     actcttcttt aggatcatga tgacgcttca agacaaggga aagctctgcg agaagattat    156720
     ggagaacctt ctttttgatg ttctatcctg tcttcaaaag catcaaagga agggtgtgaa    156780
     ggaaaatgta gattcagatg catttgaaga aagacagggc gagagcattg atgttgaaaa    156840
     gattgcaagg gcatttttaa ccacagatct ggattcgata tggaaaatat tctatctccg    156900
     gctgagaaat gtcctgaagg aggccaagga aaaaatgctt ttggacttga atctaattga    156960
     cgacgaagag cttaatgaca gtgtgatgag agaggagata tatagtatgc atacgatgtc    157020
     gttaattctt aatgaggggc aaatagttct atcagagggg tcttctctta ataactctca    157080
     ggaccggagt tcaaacgaaa agatttcaga agcagaggaa agaagttctt tcgaagaaat    157140
     aagcccgagg aaagaagaga tagtagcaaa agcgttaaaa gtcgaaaaaa gacaccgaaa    157200
     cagaagagat tcaagaaggc ccacccaggt tctttccttc ataaggtttg ccgtggaaaa    157260
     ttactctgta gtggactcgg aagtcttcca ctaccatctt ccgtttctgg tccatttagt    157320
     cctttctgac tttctactgt ttgacgctca gattgttttt tcgtttctgg atttcagtgc    157380
     aaagataatg aagtttaagg aaaaacaagt tgaaggagga aggaatctgc agaagctgat    157440
     tgggagattt tatctggagg aggacaccag cgtactggac gatgtctcgt caacaatact    157500
     ttacagcatt tcggacaaga ttggaatagc tattgaaagt aatgttgaat tatctcttcc    157560
     attaatgtcc actttcatta agatctatgg agaggatgtt ttccccagtg gttttatacc    157620
     gaattatcat aacttcatac tgaagtcttc caacaggctt ataaaggagc atcttgaagt    157680
     ttacaagata attgattgca ctcgacttga ttcccaagcc atgttcgatg tcctatggac    157740
     aagattctgc cacgtggaga aagacctcta tctggagaat ccaaaggagt ctgacaccaa    157800
     caacggaatg caaaggatat ccagaagaaa cataacaagt agattcttta ttacaggcaa    157860
     gggacctcac cgcagggcat tggttgaact tctatggaag tataacgcga tctttgggcg    157920
     gagctttgaa aagtttcttc taaaaagaat tggagaagga gaggtagagg aaattagtta    157980
     ctttctcctt cttaagattg agaattttaa agggaacttc gacttcttag agctgtatta    158040
     catcattaac tgcaagcttg atcctgaaga tctggtgttg aacacatttc tttgctctct    158100
     tacgtgtttt gatgatctat ttaagttcct cttgaagaaa cttgaggatt caaacataca    158160
     gacaagtgac accttctttt cggagtccat tgatcttaat cagatagttg gagtgttcaa    158220
     gtgcatcaag aatcttctgg agtattccaa aggatttaag tcgatgcttg tagactctga    158280
     agagaagttg tattccaaag tactccctct ggaggagccg gtatcatcca gagaaatctt    158340
     gtatagaata ctagtgcatt tgcttgtgaa cagaaaagaa tacgatggaa gggatttcga    158400
     cttggagatc atcaaggttc tcgaggctct aatgagaggg gggattcttg acagcagtgt    158460
     gatgaatgtg gtagatcttt ccaagattgt ggatgtggca aaaggataca gaggagatcc    158520
     tgcaattgtg ttgggaattg ctccgttgat taagcatagt ggaaacagta tggcaatcca    158580
     agacctgtgc agtatacttg atagtcaatg cttctactac catgaattcc tagggtttgt    158640
     cttttcatta accgatagac tccaaagaaa ggtactttca aacgtgctct tttcactaga    158700
     aaaccaggac tttgcactca tgatagtctc ggaaacaata actaacatgc tggttaaaag    158760
     aggagttgag ggcgagctgc ctggcttcat agacaaaagc atgaagttta tttttgagtt    158820
     ctttgagaac cagtacgtcg atgtaaacga agcagaaagt gagggaaata aggttaggag    158880
     tgtagttcgg aaagacaagt ttgatgagca gtctattggt ggcgatgatc tggttgtgtt    158940
     tgaggaaagg attaacacaa gaatgaatgc tttgagattc tcgacggcaa aggagttgtc    159000
     gtctctgttt ttcaagaagg tgcctattgg gtttgtcgag atgatcctgg ggaatccgcc    159060
     gtgcattccg tttttgaagt ctattgactt ccgggagcag ctttacatgt caattatgaa    159120
     tctttactca acaaatgcta tgaaggtgtt caagtttctg ggcgtgctga acaaggtcat    159180
     ggatcctcag gaaatgatag gggttttcaa taagtcaaag aatcttctcg aaaaaatctc    159240
     ttcctacagg atagggtctg actattctcc cttaaacttt gtcttggact ttctacagtc    159300
     tctagacctt caagaggatg cagaggctct tgttcagtcg gccatcataa actccgttta    159360
     cttcttacag aaaaggttgg atctaaaaat aaggaatgga gagaaagaat tcgaagatga    159420
     aattggatta cttgatagaa taacaaactt taagttccag ggagtagttc tttcggctgt    159480
     tcccagtctg atcacagtca tccttacctt ggttaattcg aatagtccta atctcaaaaa    159540
     tgtcggaatt gatactcttg caaagttgag cagcaagggt cttgaggaga agtattggaa    159600
     gaaagagtat atagagatat ttcatacact tgacttcttt acataccgtc tatacaagaa    159660
     gtcagatctc atgaaaaaag ttgtggctaa agacccttcc attattaacg acctgattgt    159720
     caggctggac agtggatttt ttgtctcgca ggcatcggat gccaacaaca aaactctagt    159780
     actgaaaagg atctcgttca ttatattttc agcaccctac aactactttg caagcttctc    159840
     tttgaagctc atcgagaaga tagcgagtct gataaattat ccttcttcaa aggtcagaag    159900
     ggaggtgttt ctgctttcta agatgctggt tctcaagatt tcccacgaca agctaatcaa    159960
     tctgtatccc attcttctct atgatatcgg gataataatc gagagttctg attttgagga    160020
     cgtgatgctt ctcgccgagg tgctgaagct attggatgtg gtgtttctgt tgaacacacc    160080
     tcaatttaca gagacgaggg tggtgtttct tgggcctcga tgcaccacga cgatggaagg    160140
     agaaggaaag aagcctggct tagagaatct aagggatttg ttgaattgca agtacgggaa    160200
     ggagattccc agcgagttcc gaagacctaa gaagaagatc ccgtttctgg ggccagggaa    160260
     aaaggatatc gacgagatat tggactttac aagcaatgca ttggagtatt ataactggct    160320
     cgatgagaac tgctctgaaa tcgactatga atacctattc aacctcactc tggaagagct    160380
     gacagaaacg accgagtaaa tgtgtttttg atatctctac ttgtttttat ttttagatac    160440
     aagaaataac atgggaaagg cttcagggcc ctggacaagc cggatgaagg ataccatggc    160500
     tatcttcaaa aaaaatcaga aaatatattc tacaggcgcc tttgatccgc tgattctaga    160560
     tgcagtgact ggattgaggg agatggccag gatggcctat ggggatgagt tactctatgt    160620
     tgaggcgagg ggatgggtga tcagctctct tttcggagta aatgacgtag ttgtgatctt    160680
     agtaagcagg ggactagatt caaagaagct gaagcatatc tacgagtcgt accgtgtatg    160740
     tgaagcttac aaagacattg gactcatgga tatccttcta aggatgtatg gcaaaaaggc    160800
     aggagcaggg agatgatgta tcccagtagt gccagtgttc tttcaaaggc taataaaaat    160860
     ttttagcaaa tggcccagag aaatggtaag tcggctttag actggttaat ttgtagagta    160920
     aaggtacagc cagctttgga aaaaagaaca agaggaacac ggaaatgtgt agaagatgcg    160980
     gaagacagag ttatcacaag cagaagaatt catgctcatc atgcggatat cctactccga    161040
     agatgagaaa cccagggtct atcaaggcaa gacgtagacg cactgtcgga acgggcagaa    161100
     tgagatacat gaaaagagaa ctgagggctg caaagaacgg acatagggga aatccaatat    161160
     tgaggcccct ctggagtgga aattaaagtg gttttctttc tgttttaatc agtaatgcct    161220
     catacataaa agactttggg cctagaccct gaaatgaact tgttgtgggc gggatatgtt    161280
     tttgggaaaa tgattacaca cgaggtcgag agggtcttgg aaaggccaag cgaaatggag    161340
     ccattaaaga ccatctccaa tggaatgtcg agtttacacc tttacttgca agagaccgag    161400
     ggagacgtgt atgaaccggc tttttcccag cttgtgcaaa ggctcaagaa catcccggat    161460
     tttgttatgg agcagggaga caagatctat cgcattgttc cttttgaatc gattgagata    161520
     gattctcctg gaggaaagaa aaatcatggg aagttccatg agatagcaag catgggaaac    161580
     gaggtggtca tgacatacac aagcagtgga cgtgatggcg aagagggcat gtatacaacc    161640
     ataacagtta tctttacatc ctctgatgga gaagagaaaa tagagaagat ttacagtgga    161700
     tggtcggagt cctgtcttct aagggtttcg acaccaaagc tcaaggttaa gcacaggaaa    161760
     agaattctgt ccatgtatct tgaggatttg gagagtaagg atccaaagga ggaggccatt    161820
     ggacactgga ttgagggggt taattccgaa ggaaaaggat ttaacaacga cgccattctt    161880
     aaagaggaga tgatgatatt cgaagaggca ggaagaaagg acagtgggga ctctgttaaa    161940
     aaagcagact agatgatgaa agagattaaa ggttttgtgg attttatcta tgtcggcgag    162000
     taacgcgagc cctttcctaa tcagcaaggg cccttagtat aatggtagaa cacttggctt    162060
     cggaccaaat agtccgggtt cgaatcccgg agggctcggt tttatgccat ccttttcaat    162120
     cagatgaaaa caatccttta tttctttcta atcttgtttt tttccctcag ataaaaagcc    162180
     attttctctc caaagcttct gttttccctc acctttaaag cctccgcatc cctgttgtat    162240
     ccctgcttca tctcgaggac tctcttgctc ggctcgggga ctatagtatc gaagagaccc    162300
     aggaagtcat caataaattc ggggttctca agaagagata ggcctgcctt caggaaaacc    162360
     tggctttcaa aggaaggaga gtcttcgatg tcttgaggag cataacttac aaagaagata    162420
     gagacatcgt atttctttat gaactcaaga tgcttttccc ccagggcgcc aaatgtccta    162480
     tatccaggta tatttccaag caagcatttt ttggtgtatt tcagaccata gtgttttgga    162540
     ggcaatgtct ttctaaacac atacatgcac ggggtcctaa ctttcagctg tcccgttagg    162600
     attagactct cttttggaac agagccgaga atgtagctca agcagaagtc tcttttgaga    162660
     gtgattattc cgcaaagata atccagactg ggatgtccta ctaacttcaa tatggactgg    162720
     tggatggacg ggaattcttc agcacttctt tcaaagtgtt tcttaaacgg ctcaagaagc    162780
     aaagtctttt tgtccaaaag cctcctcttt cgattcacaa ggaaaaagca aaatgcaaga    162840
     gccaaagcca caataactac gtcgtgcagc atcggggcaa caatatatta ccctaaaaac    162900
     caacatcggt ttgcagaagc agatgggttc ctttggggcc tatcttgaac cctgttagct    162960
     caataggtag agtgttggac ttttaatcca acggttacgg gttcgagtcc cgtgcagggt    163020
     gttcttttgc tcttcaaaac atttttcgaa atagaaaaca tctttaatct cctaccgcaa    163080
     caggtattta cagtactcgg ccagctcgac catttccctg cacctcactc caaaagcatc    163140
     ttccagctca ttcagtctct tgctcaagta ggaaaccttt cttttctcct cttcgtacat    163200
     ccccttagcc tcttcaactt gcccaaccaa aaactctatt ctttcattgt ttgccttccg    163260
     gagagactcc attttgtctt cacttgcaaa caaatccctc ttcaacgctt gaatgtaact    163320
     tttcagcctg tattcattag actttaacct ttctatctcc tcattcatga tggtactctc    163380
     caaaagaatc ttctcctttt cgtttctttc caacgcatac gtaagagttg cgtcgtagtt    163440
     cctcagcatt ctattgcatt cctcttcttt ttttttaaga tcctctatca ttgtcctgct    163500
     ggaggcaagt tcggaacagg tcttctcata gtcagacctc ttcagaacaa tggtttcgtt    163560
     gtcgggattg gtagtccttc tgcagccctc tgtcttttca ttcatatcta ttgaacttag    163620
     aggaactgtg gattcttcag caggagcatg ggtacttgag gagatgctca tgaccaggga    163680
     gctcagattt gcaatggagt ctgaaagata cttcacaaac ttcgatccca tgtgatgggc    163740
     cttggcaaca gtccctatta aatccaaatg tccaaaagaa aaagttacag cacccgggat    163800
     tcccgagtgg tctcccgcct cagtactatc cgggctcgca caggcttaac tgcggagatc    163860
     tgacgagttc cggtgctttt ccgtggatat ggccgtaact gtcccaaatc ctaatcagag    163920
     ttaaatactc tactccacaa tcctcataga cactccaccg gccaacacta caaaatccat    163980
     ctctattctt agcaaattta atatagtaga atagaataag cccacttgcc cattctatat    164040
     cttttcctcg gaatccacag ctttactttt ccctatcttt tttcccccaa gcatcccacc    164100
     tatcagaggc tgcacaacaa atatcacaac agtagtcaat aatacagaga tcaaaactaa    164160
     tcctacttca aacccatttg tctctacaaa cttgtattta ctcagccacc aggacgtcca    164220
     tcttggaaat agatacaccg tcatcaggag acccatggtc actagaaggg aaagacaggt    164280
     aaagcttttg aatagtaagt tgtctcttaa ctcttgtcta tgtggagaac agtcgctcag    164340
     atacaacccg ttgaggatat agataaatgt catggcaaaa aacactagct cggatgcaat    164400
     ggactggtcg ttcatgacag ggctagactc cccgtatcgg gacaagacca gaagggttaa    164460
     gctttcaaat gctatggtca gccagaacgg gatgaaatcc ttctttgata aaggaaatat    164520
     atccgggcgc cttggataca gtttatcgga tgtgttaaaa catgtcagca tgtatgcaac    164580
     agggaccgag acaaacagct ctgtgtgcat tgtctgcaaa tcactcagaa agtttctctt    164640
     gaagagaaga aaaagaagcc ctacataacc gatcacacag gaagagacaa catatttgaa    164700
     tgtggcagtc gacgtcacaa acgccgagcg tccctccttt atcaggtcca ggacagatcc    164760
     tatgtcggag gaagtgaaat tcgctgccag gctggcttcg ttctgtgcta gagccaggcc    164820
     gacattagca ctgctaagag ctccgctatc gtttgctcca tctccacaaa acattgtgat    164880
     ctttccaatg gccctcagat tctctatcag ggccttcttt tgtccagggt tgaagcgtgc    164940
     aaatatagct cctttctcaa gaataaactg aaagtagtga gtgtttcgga agaagtcaaa    165000
     ctcccttcct tcgcatgcaa caacaaactc gttgttggat accctgtcgt ttcccctgta    165060
     aagactcaac ctcaccttat cgaaagtaaa ttcctcctca tctccaacac aaagccagtc    165120
     gacatcaaaa atggattttg cattctcctc aataacagga aatatcaccg gaacaaatcc    165180
     ttcaacaatc ttacactctt tgcccaccga tatggctgtt agtatgttgt cccctgtgca    165240
     catgatactt ctaatgcctg cctcattaag ctcctcaata gttcttctgg aattctcctt    165300
     gagcttgttt gaaaacacta tgagagcaag aaacatcatc tcagactcat ctgtagctct    165360
     atcaatgctt ttgcttattt ctttgtatgc caatgatatc accctgtatc cagccaagga    165420
     atacccctta actttctctt catattcctt tgggctgctc ttcagaatct tctggatcga    165480
     ctctggagat ccttttgtaa atacatacct cttacttcca tcgtctacca ctacactcat    165540
     tcttctaatg ttcgaatcaa actcgtaagt cttcataatc accgcattga tcttgtctcc    165600
     ttttacttct tcagtacaat tgtttaagcc atatctgttg acctcgtcag tatcaaggac    165660
     taccgaggaa aagtccttgt cttcttcata agtgtttgtg tctccaacag caaacttgct    165720
     cccatagatc cgatctttct gataatacac catttcttca ctgtcgttgt actccttcag    165780
     aatgggcccg taaatcttac tatcccctcc aataactaca ctccgtgtgt tctcattctg    165840
     aacaagtttt gatgaagaaa aaataaacat cttcaagtca agagtatctc cagaatacct    165900
     tccatccaac tcatacacta gatggcatgt gcttagccca attctggtca ggatgctaac    165960
     tttctcaaca tcatctacgg cctcctcgag atcgtcgatg caaagaagat caagaccctc    166020
     gcacgtcagc gttcctgtct tgtcaaaaac tgctgtgtcc actcttccgg caagatgaat    166080
     cttactcaga ttgttgcagt agatgttctt cttgatcagc tttctgtagc atagctgagc    166140
     cccaagcttc aggtacgttg gaagagcagg atttgctagt gtgaaaaaca gatcaagatt    166200
     atatacaaga ttcatggtct tgttgaagcc cataatgttg agcatatagg ctataccaat    166260
     agaaataata attgcaatcc cggttatgct gaagattatc atttctgcct ctcttataaa    166320
     tcggtttcga gtaggtcttg agtcaagcat attctttaga atttgccccc gtgctgtctg    166380
     gaaacccgtt ctaagtacca ttccaatagc aaaattctct gggatgttta tagacccaac    166440
     ctccccagag agccgaggtt tattcttacc cgtaagactt ctaaccctac aaagattttc    166500
     atttctcaag ctgttgaata tcggcattgt gttgatactc ttcaaaacat ctgttcccga    166560
     gtatactgtg gaaagctgct cggcattctt gtatattgga accgcctctc ccgtaaggag    166620
     acactcattc gttatagcat ccccaagaat cacaagagca tcacaaggaa attccttgca    166680
     cggctcaata tacattatat ttccaggata tatttctcgg ctgtctactt ccataaattt    166740
     ccctcctcga agtattcgga ccattctctt cttcataagc tttttcatat tgatcgaatg    166800
     tagaatctct tcccagtttg taaacacaaa cgaatagacc ataagcaccc ccatcaccaa    166860
     tgcatagctg gtgtattcaa tgaacttcca tacaaatagg catgtcacat ttgacagaaa    166920
     tgtaatactg agtatattct tcagaattat gtttgaaaca ctggggatag ggaggtttgt    166980
     gatgttcttc ccatagaata tgtttctttg tacgccctct atcctttcgg tctccagaga    167040
     ctttgaaacc tctgtcctgt agaactcttc aaaatcccct gaaggatgct tctgctctgg    167100
     aggaacaaca aatttcccta aaacaacgtc atatataaac cggaaaaact gagagtctat    167160
     cacacgagcc tttcccccca atgtatatct cctaagcgag ggaattccgg ccgtatcgta    167220
     aaaaagaaca tcaacaaatt cttcttttcc attctgtgat gttattatgg cgcaatctgc    167280
     atccaaaagg ctgcaaggag agctaagaag aaaatgcttg acccggggta gatacctaca    167340
     caacatgtag agccctccca aagtcagcat gcaaagaatg ttgtaaagac gcacagacat    167400
     tcttcttctt cttccctcaa tacttataaa cggcctttcc tgcttaattc ccacaaacat    167460
     tcaggggctt gcccaccagg ccgattttag aatgattatc tccggaacat taaggagatt    167520
     tccaaaatcg ttatgttcaa taccatttat tgtggaaaat taaaataact acgccagtct    167580
     caatgcactg cctgcaaagg agacattcaa agcacccctc ggagcaaaat cgtcatctcc    167640
     ataaattaat gaagcactcg attctttttt gtatgaataa aagtattaac tgttaattgg    167700
     gtaatgaata aataaaattc aattaaaaaa tccaaagtag gatgactgat gtagatagaa    167760
     caactaacat ttttgatttc actgatgccg tgcataacat acttaaacag agagaaaagc    167820
     tgtttggaac tagcaaagtc cttttatttg tgcttttttc ctgctcttca atcatgatat    167880
     ttcaaggaga aagctataga aacttctgct tgtcaataat agttgggtta tgcatgatag    167940
     cttccgactc aagagtgcat gaaagacttc taggaatgag ctccgagtat ggaggggtgc    168000
     gtggagcaat aggtagcttt ctagggaaga tttttctcaa caaactatta ttttgcattc    168060
     tatgtttttt ggttgcatta acgatcaaca tgtctatgat tccaattact tggatgcttg    168120
     cagcctctgt aggaatctcc ttgcttaaga agatcttcac agaggactta gaaataacaa    168180
     acatgagcaa tattcttttc catttgggat ttttggcatt acttgtcttt tccctcaaca    168240
     atctcaagaa atccaaaata gtcatatatt cagttttctt tagcttcttt ggatcgacga    168300
     ttctatggat tactctcgag gcgattctga atgaaaacct tgggttcagc cgtgcgtgta    168360
     atgtgttttt ccgtggggag tttatggact tcatcggaat atcgcagctg tatccttttt    168420
     tactcttgat ggccattgga gtttttaccc aagtaagaat caatacttta gtctttgcat    168480
     acggaaaaaa gcggtttgcc tcgattattg ttaagcgaag tgaaaataaa gtgatagaag    168540
     tctgagtttt attgggctta tggatgttag tattcttggg tatttctaga agtagggaag    168600
     tatttagtta aacaatggtt gggcacctat gggagggctt atgaggggag ttagctcagc    168660
     ggtagagcgc ttgcttagca tgcaagaggt catgggttca atccccatac tctccatttt    168720
     gcatcgacta acttccattg ggactaagta tattatggcc aaagtcaatc tgaaaccatc    168780
     aagatcctct tgaaacacag ctgcatttag aagattgcag agtaaacaaa aagccaataa    168840
     tgagaataaa tctgctggcg atgtttatga tgcccgcaag caatagaagg gttttttacg    168900
     tcaacttaaa ggatgttaag tcgggtgagg atttgctgag tcagttgttt gaaaaagccc    168960
     atcatcttcc cgacgggtca agcgagttgc ttgaaaaaga agacggctct tcaacgcatt    169020
     tgtccaacct agcacaagag gtacaggcaa aggaaggggc atctgggtct acagcctctt    169080
     ctggacagaa ggcaccggca cagcaatcgg aaagtggtaa gagtgcacaa aagaagcagc    169140
     agagtggagg ccaggaaagt aaggcacaag ggagcgctaa aaaggaagaa cagaagcagc    169200
     agaaggagga caagcaacag aagcaacaaa agaaagagga acagaagcag cagaaggaag    169260
     agaagcaaaa gcaacagaaa cagcagaagg aggagaagca aaagcagcag aaggatgata    169320
     agcagaagga gcagaagcag caaaagaagg aggaacagaa gcagcagaag gaagagaaac    169380
     aaaagcaaaa agaagcgggg aaccagaagg aagaaaagca aaaacaaaag gaacagaaaa    169440
     agtctgaaaa ggaagatggt aagaaggaaa caaaaaaagc agataaagaa agcaaggaga    169500
     ccaaaactgc ccaagataaa ggttctaaag acaagacatc cacccaggga aagacaagca    169560
     ctgatggtgg ggaaaaagcc agtacagcga aagcagaagg aaaaaaagct tctgaaaagg    169620
     caaccagcgt caaatcttcg gatgcagagt ctaaaggtgc tgaatctaaa gacaaaggga    169680
     gtgcctccag tgctccttct tcaaatgcaa gtacctctgg aagtgcttca atagcttcat    169740
     cttcgggtag ttctttatct ggagcggctt ccagcaatgt cagcagtgca gtgtcttcaa    169800
     gattatcctc gagtgccatc caatcttcta gtgctggata ttcatcttca atacctctct    169860
     tgtccatcat gtcatcttcc atgctatcat cggccatatc gtcttctgtg ctgtcatcgg    169920
     ccatgtcatc ttccatgcta tcatcggcca tatcgtcttc tgtgctgtca tcggctatgt    169980
     tgtcttctat gttatcgtcc tcgatgccgg tgtcttccat gttgtctagt gcatcccatt    170040
     cctccatagc tgatgtctta aagaaggcat cggagataaa caaggtcaaa aacctaagtt    170100
     ctgtagatgt caacgatatg ctggggaagt gccaagaatg tgaaagggtt gatcaagtac    170160
     ttgtctataa ggaaggaagt cagtacagtg attattctgg aaatataaat ttccaggaaa    170220
     aagatggtaa gttagttgac agttcaggct tgtttgttgg aaaggattgc gggtgctcaa    170280
     aggaagaaat acctcaaata ggaaaaataa ctggaacagg gctatatcaa gatcagagtg    170340
     ttaatagcat gagctgccag aaacaagcca atgcaattga taagttatat tcttctgcca    170400
     gcaatatggc gttgaactcc ggagtatctg gaagcaaaac cgtttctgcc ggagcgtctc    170460
     aagctggtgg agctgcaagc ggagcatcta aagctgctag tgcttctgcc ggagtttctc    170520
     aagctggtgg agctgcaagc ggagcatcta aagctgctag tgcttctgca ggatcctcac    170580
     aagctggtgg agctggaggt ggggcatcta aggctgctag tgcttctcag gctggtaact    170640
     ctcaagggac tcaaagcatt cagccaagct cttttcagag tggtgcatca gggaatcttg    170700
     cacaagagac tggatccaaa cctcaaatat catctcttcc tacccaaaat aatgccgagg    170760
     aaagccctgg agtttcggta gctcaatcta ttgaaagtag gcctgaagat ttcagctata    170820
     tacctcctaa gatatctata aaggcggtca aggtcaaata cggggataca tgtggggata    170880
     actctggact cgttgttaac acaacactca cccaggaact ccctccggaa aaaacagtaa    170940
     cattacctcc aaaaacagtt acaaagacag aaaaagtgga gcttcctccc actactatca    171000
     taaaggagtt aactattatt gaaccaccat gcacagtgga aaaagaggag gtaattgttc    171060
     agggatctga aaacatagat gaagaaagaa ctgttactca ctccactaca gttgtggaat    171120
     ataaaacagt aaaagttaca gccacacgaa cgatattgca aacaacgtct ccgagagacg    171180
     tagaggttcc gatttccact attagctttg aaaccatcga tggtattaat ggagaaaggc    171240
     cccgggaaga tattacgacg attaatacaa ctatagtagt ggaagaacct gaagatatag    171300
     aatgtgagca ggagtgtgaa tgctatgaag ataattgcga aaatccctgt gataggataa    171360
     aatgtgtgtc tggttgagtt ttaactgaat taaattagga tatctacttt agatattttg    171420
     tgattttctt gacaggcctg gagacttagg aagaaacggt tactcaagtg attgtaatct    171480
     tcaaacacag tttttgatat aaaacaagtt gaaacatacg gaatataaag aaagccagta    171540
     tgtattacaa caaagatgat attggctttg cttttacttg ggcatattat aagagccgat    171600
     atattcgatg gggtgaactt ggaaaaggtt ctaagtgaag gcttgaaagg cggaggcagc    171660
     gggaagtcgg ggcccgatag cgcttctctc tctctttctt caaagaaaga aggaatgtcc    171720
     tctgcctcta gtcccgcatc cttttcctca tctataccat ccatgagcca ggcctcaagc    171780
     tcgacagtag cttcggtaaa gaagagtgga gaggagatgc caattgttat aataactcaa    171840
     gagagtccta aggacaaagg aaaaggcaag ggaggaaaag aacaggagga ggagatagct    171900
     agtattgtga agaacgcaat aaagggtacc aagtccaatg gactttcaac agagaaaaga    171960
     gaggaggagg acggccaagg agaatctaat tacgaagaat ttaaagagga gtcagataaa    172020
     tcgaaaagaa aagataagcc aagcatgatc aataattcct tttctcccat gatggcaaaa    172080
     gcggttggga acagcagtga cttagattcc tattggacaa cggttatagt cgataataag    172140
     ttgaagaaag tcaaagtaaa tgttaaggtt atgactgttg tcgagagcat tggggaagct    172200
     gcgccatgct ccaaagatgg agatgtaaaa gagaaatcga aattttggag caagcctggt    172260
     gagagctcta agagcagaga aatcccttca acggtctctg tcgcctataa aaaggatgag    172320
     atgaaaacat ctcaagatag taagagttct tcaaaaagca acagcgatga aaaaacaaag    172380
     aagactgcag aggcttcaag gtctgttgag cctgaaataa tcccgtccgt gatctcatct    172440
     ggaaaaggca ccgaatctaa aaaagagtcg gaaaccttaa gtgcatctaa gcctctttct    172500
     tccagtatat ctctaagcgt tagtgcgtct aggaagagca acgatagtga gtcggcaagc    172560
     tcaaaatatc gaaagtcagc agagtccgtg aagacatcaa caacatctac taaggagaaa    172620
     tcatcaagta aagagacaga gagtaagagc acaccgggaa taagcacaaa ggaagacagt    172680
     aagaagggga actccagtac agtaatgtcc aagagccagt ctttagcaaa aactttttct    172740
     tccatagcta ctgtgtctcc gtctgttaag agtaagaaga aatcctcgtc ttcccaaggc    172800
     tcggcatcca aggaatccag ctccaccgta tctatcggac agaagaagtc aaaggaaatg    172860
     accaaggacg ccaaaagtat tagcgtttcg aaatccgaga aggaagataa ggcagaatca    172920
     gggaaaaaag aagtcaatcc cgaaatgaat gagcttttct atgttcttaa gaatatgcct    172980
     ggaaaagtca atataagtaa gtcaggaggg aaaatgtttg tggaaggaaa ctttgttgct    173040
     ccaaaggaag agaagttgaa ggacaagaag ttccagttct caggatacat ccaggcggca    173100
     catgcttgat gaattaaacc attcaattct aattcccctt aatttacctg agtatttcgg    173160
     tatgaaaatt cctgaaacac cctgaaacaa gtttcagaag agatttggcc ggactaaaaa    173220
     gattaaaccc gccatgtttc tttcttaatg agggctccta atagaatcgg cacgataaga    173280
     gctctgtgcc ttcttgggat ttacagccat agtgttgctt tatgccagga agatgaaagc    173340
     actgttgaga ttgtacttct gagtaatgga accgaaaaga caaggccgag agaggatgat    173400
     aaaaacgata tcaatactga agacaaatcc aaggcgctta gaagtctatt aacaacgtta    173460
     gtaagccatc taatggcggg taataagttt cagaatagtc ttcttaaaag ttatgatgga    173520
     ggagatcgtt ctgattcccc aaaagaaagt ggagaccgac agacagcctc cccctcccag    173580
     aactcaaaag ccaacaaatc ccctgctcaa gaaccaacta cagagatgct ggaaaagata    173640
     aagagagttc caatgggata caggacattc tgttccttcc tccagaattt ggaccttatt    173700
     agagacaagc taaagaacaa acccggaacc agaagaatcc ggaatgttct ggtttacgaa    173760
     gggtatcacc tcaccgacta ttggggaaga ctgaaattca gaaaggaagg ggataagctt    173820
     atagacgaaa cgggatattt tgagggagtt aaagtcaata cgtttgaaga cataataaag    173880
     gagggaaaga tgaccaaaac cggcttcatt cagaaaaagg agatagggga aacagaagta    173940
     aacgaaaacc tgataaccat gaagcttctt ctaaatgaga ttgccaaaga aaaaaacaca    174000
     tccatccacg gggtaattaa cgagggatgc aatatgtcca ttgttgaaga gctggtcttt    174060
     tacgggaata gtccttccgc tcacaacgac gagatagtgc atgtttgcat atgctcggat    174120
     tcattctgca aggagccatg caaagatatc gttccaatga agatggagga gctagagttc    174180
     aggggttaga tggatagagt tcgttaggta cattgaaatt taaatgatta aagatattta    174240
     attgttgatt gcaatcttgt caataggcaa tatatcctca agctcaatct tctcatcaac    174300
     cattctatct aagatgtctc taagttcata aaggccaata ttctcattgg attttcctcc    174360
     cttccctgac ttgctcaatc tgatatttat ttcatctgtt tttgcctctt tttccccaac    174420
     aacacataca agggagtatc cacatgtctc tgctgtcctt attctcttgt tcatggtgtt    174480
     tccatcatca attacatcca aacggaattt ggaaagtaca gattttatct tctcaacata    174540
     gtctagattt cccatgttta taattgctat ctgccttggc gatatccaaa acggtagttt    174600
     tttcccaaag ctttcgagga ttatagcaat cattctttcg atacttccca gaatcgcccg    174660
     atgtattatc acaggtgtct tacattgccc atcactgtct cgatacttca gctcgaatct    174720
     ctggggaagt tgaaagtcca gttgaattgt tgcacattgg atttttctac caagggcatc    174780
     gtggagagta atgtcaatct taggtccata aaaggctcca tctccttcat taatcttaaa    174840
     agacatgccg ctttcgtcca ttgcttctgc aagaaccttt tctgcattgt tccattcatc    174900
     aatcgatccc agatattttt caggccttgt gctcagcacc aactcaaact tgaacccaaa    174960
     aaccccatac acaaaactca gaaactcaag gcatcccttg atttcaccct taacctggtc    175020
     cctggtacag aatatatgtg catcgtcttg ctggaaccgt ctcactcttg ttagtccggt    175080
     cagagtccca ctaagctcat tcctgtgcaa aaccccaaaa tctgccaatc tcaggggaag    175140
     gtctcggaag ctatgatcct gatgcttgaa cattacacag tgcccaggac aattcatagg    175200
     cttcaatgca aagttgtctc cctcaataag aaacatgttt tctttatagt tctgaagatg    175260
     tccactttct tcccagagct ttgtacaaaa gatgtttgga gtgataacct ctttaaatcc    175320
     tcgttttcta tattcttccc tcaaaaactc gatgagtgtg ttgtacataa ttgcaccatt    175380
     tggcaaaaag aaacatgatc ccggggaata ctttgaaaag aaaaagaggt caagttccgt    175440
     tcctatcttt ctgtgatctc tttccatagc ttcttctttc ctctttaaat attcttgtag    175500
     catctctttc gaagggaatg tgatggcgta gatcctttgc aaagacttca agctgggatc    175560
     gttgaggaaa taagctgagc tattcttaag aaccttaact gccttgacaa ctccggtaga    175620
     cagaacatga ggccccaagc acatgtcgaa gaaatctcca ttccgatata cagaactctc    175680
     cttgtctact cctttcttga tgaaatgtgt tttgcaaggg ttatccttat aggcatttag    175740
     aagttcctct ttactcttga ttaccttttc aaatctgtag ttcttcttca ttattttgag    175800
     catttccatc tcgatctttt ggtaatcttc agatgaaatg gagtctttta tgtcaacgtc    175860
     ataaaaaaaa ccttcctctg tgggtggccc atggactagc tttgcatccg gatataaatt    175920
     caccaacgca tttcccagta tatgtgctga ggaatgccaa aaaatttccc tagctccatt    175980
     gtcttcaaac gttaagaact ctagttcgca atcgcctggt atttccacca ccatgtcaga    176040
     atatatccca ttgattttgc aggagattac atcctttcta tccttacaat attcagagag    176100
     gatatcatag ggtgtcatcc cttgggaaac ttccagcact cgattttcaa atttcacttt    176160
     caacttaact tcgtacattt caggggtaag cttgatattt caaaaatcca atttcaggtc    176220
     caagagtcct cccaagttct tctccagttc tttttatgcc ttctaacaca aagcactcaa    176280
     gtgctcttcc aattacttta ggcatctcat tccgagtcct ctcaaacata aatctgatgc    176340
     ttctatggag agaaacggcc tgatcataag atccttcttt aatgatcttc cggaaagcga    176400
     aagttagaat aatcttatgc tttaaacaga gtcttccatt gaagaaatcg tctataacat    176460
     catcaataat aaatttagat gatttctgaa gaagagaaga aatggcgtca actttgtatt    176520
     cctcgcatcc atcgtaattc ataagcactc caaaagcctc tttacttttg tgcctaagtg    176580
     ttctttctgt tgaactttga accagatctg gaaagcactt gaaactcatc tcaacctttc    176640
     ctgcatcctt ctcatcagaa atcaccttga gagcctcctg aaggtatttc ggcttccagt    176700
     ttgtctcaag taccgagaga ttattttcta cttttctata agagttgaaa acatcatttg    176760
     gattggaaaa gttttccctt ttctcttttc tcatcaccga gtctggcata tcatcaatca    176820
     tcctctgtgt ctctcccata gtttctactc caaattcaca tgtattcagc aaaacgcttg    176880
     caacaattgc tccatgctca tagtactttc tgcgcccatc actaaaatga ttcccaattc    176940
     ctgttattaa aagactcatc ccattggaat ctatattgtg tgtcttcagt gcaagtacaa    177000
     tgcatcttgt aaagaagaag tcgtcctctt catcaaggat ggtggacaga aagctcattc    177060
     ctagtacccg aaacaggatt tccccattac ctactgtttt tatgatgcca taagacagtt    177120
     ccgacttttg tcctatacaa tatttcatca aacattcttc ctcaaactgg tcgcttctaa    177180
     tcatcttttt cttgtcctca taaagtaaaa cttgagatga tacatccaag tcatcgtaga    177240
     agtctaaaaa ctccaaatgt cttttgtttg ggttcctctt aagatacaga ttgataaaac    177300
     ccgctgcatc tggactcctc tcaagaattt ccttgatgga aagaggatag ccctcagccc    177360
     tcttgacttc gtttcttaag atgttcattt ctagggatag gtcccatctg tatcaaagat    177420
     atttattagt cctaattggc caggatatat tcatataccc gactccttaa actacagatt    177480
     gtagaggcgt tccttctcga cttcttgcgg cagtgctaag agatacaatc tctatatcac    177540
     tcaccaatgg ccccagcttc tggacaatat cgcctataac ttcatcatcc gaaaccaaca    177600
     tgctttcatt agggattttc ttttccttta tcttctctac aatcctatcg atttcccggc    177660
     tcttgctctt ttctccaaca ctcatcgttt gtggatatgc cgaggaagtc gatgaactgt    177720
     aaaaagtagt ggtttcttcc tccagatctg attccaaaag cggcttctgt gtggtagaac    177780
     tttctatatt tgttgttgaa gaaaagactt cgcttggctc cacagtctta gtagaaacat    177840
     tatttccact atatatggcc gattttgata ctacagagga tattcttcca aggctagatc    177900
     catcttcttt tgcaaagctt ttccgggttt cagcagcttt gaggctcagt agctcgtttc    177960
     ctatatgggc gaccttacta gaaaactcgt tcagtttttc ctcaagtctc tttacatggt    178020
     ctttgacaac ggagttgaca gcactaagat gcatgctact atcaaactct cttattactg    178080
     tagttcttac cgtatcagtt acggttttgt actctatgtc tttccttccg ttccttgaaa    178140
     gtgtgagaat ttcgtatttg taacttttcg ggttggtggg ttttgtaact ataccatctt    178200
     ccttctctat cgatgttttt tccttcatga atttgtttct tgaattagtt ttctctttgc    178260
     tagagaactc cttgaaaagt gtggctacag atggaagtga atgttctttg tgattcttct    178320
     catttaaagg accaaagtcc gaaatcggcg aaagaattgg atcgatttca ttatcgtttc    178380
     cgctttcctc cccagaacct ccagccatcc catcttgatt gtaagacaga gaagaaatct    178440
     cttctattgt atcctttcta tttggagttc caaggttgcc ggaagcattt tcaatctcat    178500
     atgcattatc cttccatctt ttatccaagc ctgtagtata aggcatagga cctagcttta    178560
     aacgcttttc agacattaaa cgagaggcaa tgctcttttc ataagagcta tcatccttgt    178620
     atacttcata cagcttcttc aataattcaa aagagtcatc ttcatctctc tctttttttc    178680
     taatagacaa tattgtattc ataagattct tgtactgctc ttcgttcgcc acaatcctct    178740
     gatacagatt atccatcttt tttgcataat cttcataaat atatatactc ggcacttcct    178800
     ctttcttgaa tgaagagata gaaaggatat aagggccttt tgtctccaca gggggaacag    178860
     ccgaattaac aattgtgtaa tccttaactt ttgtacttgt tttggttatg gtggttgtgg    178920
     tctccttggt tattgtattt ctgctagtgc tagaggaaag tcttttggta aaggcagtgg    178980
     agtttccccc ctttaacata tcaaagatgc ttcttattaa ttccttggta tggtcgtcat    179040
     agaatgaacc tcctgcctct tttacataag aatctacaga cggcagccta cttgcagtcg    179100
     ttgtacgtgt tctctcgaca gtagtagtta ttgtctgagg atcaacggat gttcttggct    179160
     ttgaagctgt aacactggtg ctggagcttg tatttatagg actacttccc tgtatactga    179220
     gcaaactctt gatcttctca agaatttcaa tatatgccga actatttccc acttctccga    179280
     atgctgtttt ctcagaactt tttcttgggt tcgtagatag tactgtatcc aattcttgat    179340
     tttccatcaa ttccatcttg cttcttctat ttttcgagtt ctccacaaat accgtcttta    179400
     aaacggtttt tacatcatca cccgactctc gatgcaagga gctccattgc cttgtgatcg    179460
     tcctagttat tagtatggtc tgtgttttag tcttttttat aggttcaata cgttcctgat    179520
     ccctaatctt tgtggttgta gttgtagttg tagttgttac actagtcgtc tttaaggtaa    179580
     ctacagagac agatctgcta gaatctctaa agggagttcc acttccacca ttttggccct    179640
     cagaatcagg gacaaaatca aaggattctt tgatgaaaac aggtacaaga ttgtttttct    179700
     ccagaattat tggctcggga tggtcggcag ggattcgaga tgaaatcaaa agagggtctg    179760
     ttgaattctg gtatccaata ggatattcag atgagttttt tccacagatc ttttctatcc    179820
     taggatttcc cagaacatac tcgtaaaggg cttttatatc atctcccatt ccaagacgtt    179880
     cttttgttcc ataatttctg atggcccaac tgtgcagatc gcagattcta tatgtggatc    179940
     cgttataaac gatggtattg tcatccccat caaagatttt ctgaacaggc tttctcggta    180000
     tggaatcgtc tttttccaga gtcatattat ttgtattctt ttcgatattc ttctttacaa    180060
     acttgatgaa aggccgttcc tctcgttgca agatcttttt gattgtcatg gctggagggc    180120
     tttttacctc tacggttccc agaatcttgg tccctttatt ttcaggattg tatactttaa    180180
     agcaagaatc tcggcacctt tgatcatcgg atctgcagtt gcaggagatt cccgggactg    180240
     gatttccttc gctagcctga agaatcatag tctgagcaat tacatatcca gctataagaa    180300
     aacatctgag aaacagctgg gtggcaagca tatatatagt cttttgttta ctctgttctt    180360
     ctcatggttt tattttgttt cacatgcaat ggatacttgc agaaagtaaa ccatgagtga    180420
     ataaataaag aagcttttaa tgagttgcat ttctctgaac actctccttt aaattcggat    180480
     gggccattct tcattgtacc gaagtcattg atatataaat aaagataaaa cattgttttg    180540
     ggttctctat aaaagttcaa gtatgtttat ttatataata atgaggtgtg ctctactatt    180600
     ttttcttctt aagtacgtct tttcatcggt ggaaactgct tcttccgatc ctaagaaggg    180660
     ggtaatggaa agccctaatc aagagatatc ataccgtcca gggggaagca acgagaaggt    180720
     tggggtgaag ggaactcaag tagaatcaga tggactgtct cttcgaagac acaccgatga    180780
     gggaggattg gttgtatttt tggctccaaa tccttacgaa gaatggagtt tctcatacac    180840
     ttttaccaat gcaaagctta gattcccaca tataggtggt gtgtatctat ggtatacctc    180900
     cgaaatccag gaccagggaa gttacagagg aggccatgac ctgtttgagg gaatcatggc    180960
     aggtcttgag tttagaggat cccagcccga gatagtcatg gcaataaacg atgggaagac    181020
     cagtcttgtg ggttcagaag aaatgacttt gtatagagat acagtaaacc cggaaagact    181080
     taagggagta aaagacatca cggttaaggt gatctccaca cataagaatt ttaaagtcga    181140
     actatatgac ggagacagac tgctatacga tagcttcagg tattaccgta aaggaacact    181200
     agcaggaatt ggatctggaa agtactttaa cattacgtcg ttctacgaca aagcaccttc    181260
     tgatagcgtt tataagctca aagaggcaca gctatttgaa aggacagaga caagtgacta    181320
     cgaagttcat agtattcatg caccgtcggt ggacaaaacc ccaagatctc cagacggaat    181380
     catgcatgaa gatgaagaag taagacatct tatctcaaag atcgagtatc tgaatgagta    181440
     tctccacctg gtagtcggag agcctcataa ctcatcgttt gataaggttg ttcacattct    181500
     ttctgaacaa ctcaaagcat ttacaaagaa gtttgaagat accatcacgc caataagaag    181560
     tgtaggaggt tcggagacaa agcttatgaa tctgaatgaa aaaatgaatg ggattgacat    181620
     aaaacttcag aagattcaaa aagcatttgc agacttggat catgtggtag gttctctcaa    181680
     aaatgactac agccgaagct cgaactttct tgtttacata atcctaggag ttggggctgt    181740
     aggactagga cttatggcaa tgaaagagta taatgcattg aagtttaggc aaaaggccct    181800
     ctgagaaata aatatttccg atcattttta ctgctttatt aaataaataa tgtgcgactc    181860
     tatccatatg agaagattct gggaggaaat acaaaaacca tatcttgcag ttgcacctat    181920
     ggttggaaac tccgaagagg cttggcgcag attatcaaag agacatgggg caaatctatt    181980
     ttacacagag atggtacatt gtgaatcttt tttacgtgga tccaggaacc ccgtgaagaa    182040
     tcgatggtac acaacgtctg agagtgatag gcctctggta attcagatat gcggaaattc    182100
     gccaaagacc atgctagaag cagctttgat aatgcagaac cattgtgatg caattgatat    182160
     caattttgga tgtccacaaa aagtggctag aaagggaggt tacggtgcat atctgcaaga    182220
     gaactgggat ttgacagaga ggatagtgaa ggttttatct acaggcctta atgttcctgt    182280
     ctcctgtaag ataagggtgt ttgaatcgat agaaaagaca gtggaatatg caaagatgat    182340
     agagaaggct ggatgctctt tactggcagt tcatggtaga acaagagatc agaaggggcc    182400
     agcaatgggg cttgcgagct gggatcacat caaggcagta aaagaaaacc taaaaattcc    182460
     tgtcctttca aatgggaaca taatgactca tgaggatgtc tggaaatgct tggaatatac    182520
     gaagtgcgat ggagtgatgg ttggagaagc tcatctttac aatcctctta tattcacagg    182580
     agaaaataag tcatgtttag agataattag agagtatttg gacatatgca tggagtctcc    182640
     tggatgtgca gaaacagggc acatcaaatc gcacatgttt aaattactgc atagttactt    182700
     caccatcaat ccagaaaaac aacctgatct cgattcctgc agcaccatag accaatttta    182760
     taatctttat ttaaatctcg tgaaggaagc ggagtctgca gtaagcaaag aagtatattt    182820
     aagcatctac aaaatggcac ctctttctat ttctggcgcg agcatacatg aaaacaatag    182880
     taaaaacaaa taagaagtat tatgtctctt tatttatacc catcaaatgc ttgaagaaga    182940
     tattatagct ttaatagagg aagagaaggc catcgaagaa gatttaaaag cctgtgaaga    183000
     aagtctggag aatataggag ctctggccat ccggatacaa tcgttttcta gatctgtttc    183060
     cagtttggaa acaaacaacc ctgaagtgga acgactatct aagcaagccg atttgtttaa    183120
     caagtctatt ctgagacttg gaagccagag atctaagaaa agaaatgagg aaaaagagga    183180
     gatggcccga tccaatataa atgtagatag ggaatacatg gagaacacaa gtgtgcccca    183240
     gccggttagt gatgatgact ttttttcgtc cagcacaaaa aggataaatg atgttcttat    183300
     gaatgcaatg gatgcatttg agactgtcaa gaggcaaaat atatatataa acagaacgag    183360
     cgaaaggata aagactgcac ttgaacgaat aggccttagc aaacaattgg ttgatcagat    183420
     cgacaaaagg tatctatccg acagagtcct tttcatggga ggaattgttt tactggttat    183480
     tatgtttttc cttcttaggt ttttcttata gaagaccctt ttggagaaaa gatatcgaat    183540
     ttacacatta aaattttctt ttagggctat tcttgtgttt tcttctggcc aacgagtctg    183600
     tcaattcttt gggttatcct ttttgtgttg aatctaaacc tggattttct catggcctca    183660
     agtagatatg aagctctttt gaaagcggct gaaacaatag aatatcctct tctatattcc    183720
     ccctttgtca gcttctttat cgataaccac ttgatctctt cgatttcttt tctcgtctgg    183780
     gcttcaaatg gaaaggatgg cctgacattg aatacaaagt aaagggtaat cttatcgaat    183840
     atcgttattg ggagattaca tattttgttc tgcacatcgt aaccggtttc ctcataaact    183900
     tctctgatag cacagcttgt accatcctca tccatgcatt tctttccctt tgggaaggag    183960
     taattctttg ttttcttctt ttccttaaca gccagtacat gagaaatgtt agagtccaca    184020
     agaatcgctc catagacctt tacagactgc ctgtatctaa cgaagctttt aagagcctcc    184080
     tcgatgttca ccttgatccc aacatgatcc aaaagctggc ggctgaagtc tccaaacgag    184140
     gtgtccaaaa ttttatagtt gtctatcaag aaccaatggg cttcctctac tgcaaagaag    184200
     agcctctcga ctgcattttt ttcctggtct tccagaccta gtaggaacct cgaggctata    184260
     ctatctaaaa tatctggcga gatcatttgg ggctctgtga attctatttt gacacaatac    184320
     aagcccttgg atgagtagag acaaatcaga gcaggataat cttcaagaca caactacaat    184380
     aaacttgaag agacgtaaaa gagtgaagga aagtaaggca gcttctaaac ctccacaggt    184440
     atatcctcag atgaagtgta aactaaggta cttgaaattg aagaaactag ctcatttgtt    184500
     gtcattggag gacagtatat tgagcttgtg cgagcctgac aagtcctccg aaggatccaa    184560
     cagccaaaag catgttgtcg agcaacttcg tgggagtcct ctctctgttg ggacacttga    184620
     agagtttatt gacgaccatc atggaataat tactactggt gttggcttgg agtactatgt    184680
     caatataatg tcctttgttg acaaagactt gcttgagcct ggatgtactg ttcttttgaa    184740
     ctataaagac aacagtgttg tgggagttct ggaaggagaa atggatccta tggttaatgt    184800
     aatgaaatta gaaaaggcac cttctgagac ttacgcagat ataggaggtc ttgaggagca    184860
     aatccaggaa attaaggaga gtgttgaact tccgcttatt aatccagagc tttaccagga    184920
     aatggggata aagcccccaa agggggtaat tttatatggg cttcctggaa caggaaagac    184980
     tcttctagct aaggctgtgg caaaccagac gtctgcaacc ttccttaggg ttgttggaac    185040
     agaactgata caggagtacc ttggagaggg gccaaagctt gttcgagaac tttttagggt    185100
     tgccgacatg catgctccat cgataatctt catcgacgag atagatgcaa ttggaggaag    185160
     aagatacaac acatcctctg ggggtagaag agaggttcag aggacaatgt tagagctcct    185220
     gaatcagctg gacggatttg atactaggaa tgatatcaag gtgataatgg ctactaataa    185280
     gatagaggct cttgatccgg ctttgatcag gcctggaaga atcgacagaa agatcgaatt    185340
     tggaatgcca gacgcagcta caaagaagaa aatcttcgat attcacactt caagaatgac    185400
     tttggatgaa agtgtaaata tcgaatcttt gataacaagt aaggaggatt tgagtggtgc    185460
     tgacataaag gctatatgca cggaagctgg gatgatagca ttaagagaaa gaagaaaaac    185520
     tgttacaatg aaagatttta tttctgcaag agaaaaggta ttcttttcaa aacagaaaat    185580
     ggtctcagcc gggctttatt cttgaataaa ttgttcctta ccacactcgt atttctcttc    185640
     ttaaggttga gctattttca gccggagcta ttcctctgaa acttctctat ttgtttcagc    185700
     aatagattga tcctattccc agtcaccggc tggtttcttc tagttttctg catgtacaat    185760
     ctcctttgaa cggctttttg tgctcgaatt ctttctatct cttcctcagt ttttctattt    185820
     tctcttttcc gaatggattt gtcttgtttt tttccatctt cttttctata cttcatcgag    185880
     gctaagagac tattattttt ttatgaaccg attagctttc attttggatc caataaatat    185940
     gtactctatt ccattatgag gaattatgaa atcagttgtt ccctttaagt aagtttttac    186000
     cgagttattt tccaggacaa caactatcga attggctctt tcttcgacta ttattccatg    186060
     cgttcctccc acaaccttga tctttgcacc tgttagctca cacatgtaca ttttgtttac    186120
     aaaagttgat gggctcattc ctccctttaa ctcggataga tactcagtaa actttttact    186180
     tatctccacg aagtccttat atcttatttt ttgtctttca acacttggaa tccctgcggt    186240
     ctgtttcctt ttggaagttt tgacgctttt gtttgccaac gaaaatcttt gggaaagagc    186300
     tcgaatggtt tccttcctca tgtacgagcc ataatgatcc tctacgctaa acatctcgcc    186360
     tttgcctggg gatagaaaat gcatcaatgt tgcattaagt tccatggaga agaagaacag    186420
     agagctggct agagaaaaca cagaactcaa aaaaaagatt acatctatga agaggatcga    186480
     gggagactta ctgaaggaca agataaaaaa ggagtacttt ggatttaggg tatggaagag    186540
     gatttctgga gagcttgaaa aaaacattaa tatggttgag aatgtactgt ccagtcttaa    186600
     gaaccttaag atggatattc ccaagaacgg gccagaagag gttttagggg acaagtcgaa    186660
     tcagaaggaa taagtcttcc caatgcatct tattgctggg agtagtagat ttccaactta    186720
     ttatttcaag ccctagatgg tgccaataac acaaaggata gtggaagctt tgaaggtaca    186780
     ggatgaagta agatcttctg atattgaagg gctttattcg gaggtacatg gagcattgat    186840
     aagccttgag agcaaaggga tatgcaactt gagaaaggag gaatcgtatg aggaagtgtt    186900
     gacttctgaa ggagaaaaaa tagagaagaa tggaagccaa gagtatttgc tctttcaatc    186960
     gataggagaa gatggaataa gtaccgacaa actgtcagga catgaggtgg gaaagatgaa    187020
     tgcattcaag aataaatgga taagaaaaga gggagacaaa atttttcgaa atagagaaga    187080
     tgttgaagac atggttcgga atatggtttt aagcatgaaa aaaggtacag cttctgcaga    187140
     ggagatagag ttattgagga aaaggaagct agtggcagtg aagaaaaaca ttacgttcat    187200
     agtaacgaag ggtcctatgt tctttgatag tacttcatat gcagctgagc taacatcgga    187260
     aatgattcta gacgggacct ataaaaacct tagtttcaaa cactacaatt tcaataccac    187320
     aggaaacatt cctcgatgtg gatcgattca tcctcttatg aagataaaag aagatttcaa    187380
     aagaatattc attgagttag gatttagtga gatgtcgaca aaccaatatg tcgaatcgtc    187440
     tttttggaat tttgacgcat tgtttcagcc gcagaaccat ccatccagag atgcacatga    187500
     tacttttttc ctttcggacc ccgaactaag ctctagattt ccagaaaact atcttgaaga    187560
     ggttaaggaa acacactgtg gaggaaggca tggatcctta ggatatatga acagctggga    187620
     cattaaagag gcgcaaaaaa acatattaag aacacataca acatcggtca gcgctagaaa    187680
     cctatatcaa cttgcaaaaa aagaattcaa gcctgtgaag ctcttttcga ttgacaaggt    187740
     ttttcgaaat gagagtgtgg atgcaacgca tcttgctgaa ttccaccaag tagagggtct    187800
     gattgcagga aagggtttaa acataactca tctcatggga attcttcaag agtttttcaa    187860
     ccgacttggg atgagcgaca tccgattcaa gcccgcattc aatccgtata cagagccctc    187920
     gatggaggtg tttgggtacc ataaagggat gaaccgatgg atggaagttg gaaactcggg    187980
     gatgtttcgg ccggaaatgc tagggcccat gggatttgat cctgatataa atgtcattgc    188040
     atggggattg tctttggaaa gacctgccat gataaaatat ggactaaaga atatcaggga    188100
     gcttgttggg cataaggtcg acatcgaatt ctccagaaaa agcaaaatat gtttctttga    188160
     ttaaacacta tctatattat caatgcaggt tcccccttcc gaatgtttta cttaagtcga    188220
     gctgttgtga acatggatct ctatatgaaa gtattatgca actcgtcaga catatactta    188280
     gtgcaatctt cgtcgatagc tatttataca attaagcatg gaaagctaat atatgtaagg    188340
     aagacagaat tttttgatgt gatcaagtcg gcagtcatta ttggaaacga gcttcttgta    188400
     gtcttcaacg gatacattgt atttctggac agatttcttg atgaaaggac ccggtacaga    188460
     cttggaagaa gctccgtaga ctatagacac gttggagcat acattgcatg tggaaaatcc    188520
     agtatctgtc ttacatcttt ttttgggaac atgactttct gtacccttgg aagtggcttg    188580
     gagagtccta tcgaatactc tgctgacaag agtgtaatta tcgacttcaa gagcgtggaa    188640
     gggacaggac agtacatttc attagaaaag aacccaaagg gaacatttgc caagatttat    188700
     gagcatagtc cggaaattat agaagtatta agggaaataa gtgttcctgg aggatacatg    188760
     attgttccat taaaagatag atttgcagta ttttcaacga atagggtatt cctttttaga    188820
     agaaatgaag aagttgaaat ctataaggtt tcgaaaggac gagttggaag cttagacttg    188880
     gcccttgatg agggaaatgg agaatgcaga tgctcagata ctttggaaga gaagatgttt    188940
     acatgttata cgtcatattg tgatgaaaaa tgtttgttga cgttgattgt ggatgaagat    189000
     ggagagcttt tcaatcttaa taccacctat ggtctaaaga tggaacatgt aggaaagatc    189060
     aatccttcaa aggatatagc aatccattct tctggactct tagtttcaat aggctataat    189120
     tccgataact gtatatatta tatagagaga aaagagggga aaattagtct taagctggtt    189180
     gccatgattg agacgataag aagattcaat acttctacaa tggttttcga tggagtatat    189240
     catacctatg tctctgatgg aaagtacata ggagagatag ttgagaaaac acctatttct    189300
     tttcggagcg aattgaacct ttttgaaaat gggaaggaaa agatagtaag aggtttgttc    189360
     aattgtggag cgtttgtatg tgcccaatac gaagatgaag tccattgcct ctacttagaa    189420
     ggagaagagt taacaagtat atataagttt gtgtctgatg acgagataat tggatatttc    189480
     aggttgggaa ggattgactt ttacatgtct ggagggttag ttagggcata cgagatgaat    189540
     ggggaaggag agttagacac aaaggaatat aaaatcgatt acacctcatt ttcatcaaac    189600
     tctcattgta tatttcttgg acagagaaat aaaataatca agctaggatc tgaggggcta    189660
     gaaactattg aaatagagtt tgctatcaaa gaaatggaat ctgacgagag atatttattc    189720
     atactgactg gaaaaagagt ccttagagta tacagtatag atggtaggaa atttgtattt    189780
     atccagtcgt tccgttttga tgtgatattt ctgtcggtgt ttgatggata cctatatacg    189840
     atcggatcgg atatatataa gtttcaaata aaagaggatg gatctctctc tcttcctata    189900
     agaatgaaag aggcaggaag gcccataggg aagaaggaaa gattgataat atttgattcg    189960
     caagttatgg atctaaagta cgaaggaatt ttaaacattg atggatggaa gagtatcttt    190020
     tcaagagata tgatattggc ttcaaatgag catgggataa aagtttatga gtacaggaaa    190080
     cataaagtag tccttgtcga tgagattagc aaagaaaaag attgtaaaat tttgggtaag    190140
     gagcagatgt atatcgataa caacctagat ggatttgtaa taagaagatt taacggatct    190200
     tccgtaatag aaggacatgg cgaggccatt ggattttcct cttctgaata ccaaattgtt    190260
     tccatgcgca ggatcatacc aggtcttgaa aaacccgaaa gtaaatgctt cttaaagata    190320
     tacaaagaag gaagtttcat gtacgatttt gaaacacctt acaggattga tataacttac    190380
     acaagcagag gagaagttta ttgtagtgag gaaaacagac tttattgcta tgaagtagga    190440
     gtgaagtcat tgctcagaaa gtttaagtta aagtttccat caaaaataag cggaatatgc    190500
     tctgacaggg acaaactatt tgtcggaaca gaaaaggact ctgtattcat ggtaaaggac    190560
     agaagaattg tttgtagaga taagtttcca agacgagtgg tagccttgga gagaatgaat    190620
     gatgggaatt tagtggttgg agattgggca ggaaatataa ttgtcatgga ggttaaggac    190680
     gattccttaa tctcgggagc atcaatattc gtcaatgaca tggttgttca atttatttct    190740
     caggacaaag tctttggaat atgcatgagc ggaaaagtag tcgagatagt ggagattgga    190800
     gaggagttgt ttgagtttct tgagactatc ggggagaaga taactgaggc cttaaatagg    190860
     ccattttttc aggcttttag gagaaataga tttatcaact cggagtacat caaagagttc    190920
     agtaaactga gtgagcagca aatcaaggaa gtactggaaa aaacgaatgt agatatcgaa    190980
     aagatatttg aagtggttaa tgcaatataa aatttatttc ttaaaaattt acatcaggaa    191040
     aatacccatt taaaatgtac aaggctgagc ctatgctccc cagtgatgtc ttctcgttgg    191100
     actgggtgaa tcttgacgag aaatctgaaa gctttccctt aagttattat ctttattact    191160
     taatcaacca cggggaagat tgtattgtta ttccttctct agaagaaaga gtgacttctt    191220
     ttgcatataa gagggtctcc tatgcataca tgataggaaa gttagaagag aaagacagag    191280
     ttatatgtat acatatttca gcggtttcgg ttgctccttc tttcagaaga aattgctttg    191340
     gaaagctatg catggacata gctgaagaga gcggtaatgt ttataatgca catttttccg    191400
     atttgtatgt aagggaagga aatagaattg caattgaatt ttacaaaaaa ttaggttatg    191460
     ttgtttatag aaaagtattc gattactata tcgatggggg tggcgaagac gcgctcgaca    191520
     tgagaaagtc attaaaagca gataagggga aaatatacat ggcgagaggt acagacattc    191580
     cagcctcgga gttaaaatga ctggaaataa aatatagcca aattcttttt aggtttctta    191640
     taattcaaat gttactttgg aggaagtctt gctttgaaat ggatagggtt atgatgcgtt    191700
     acaaagactt cctatatttt atgaactcat caagattttc aaagcttttt ccttcgtaca    191760
     ctaagttatc atccactgta atatattcct tatagttgcg tccattgcga tacatcatgc    191820
     aaagtttccc aggatatttc tcactgaaga aaaacccata tcttatgtag cttcctcctt    191880
     gattaagata atccagaagt ttttcctcat cctcgaagta gtacttgtga ttctttatgt    191940
     tcttaacgtt cgtaagcatc ttcttggcta ctctggatat gagttcatct aaatcgtcgt    192000
     acgaatttcc tttgtagtag tatttctctg cttcttgtat ttttatatgg acatatatgg    192060
     agtctgtaac ccttaaaacc accacgggag taccatcttt cctgcttctc cttagaagta    192120
     tggaagaaga attcttctta agatattttt cagactcctc actattgagg tccttaaaca    192180
     acggatgtgt catgaaccgg gaatgatgtg gcttcttcgg cccagaaatg gtgaaactgg    192240
     cggtatacga tagcaggtaa tcgttcatat actcaatttt cacagtaacc aactgattta    192300
     aaaaaaactc ttcctgtcct ttggtctttc ttacgtatat tgacgcagga gtggagtcgg    192360
     aacttacaag atagtatgta tttccacact ttgaaatcct tccttcaatt actttaccaa    192420
     ctaggctccc gttggatccg gttagttctt cgaagataag gtggtctgga aagcctgaat    192480
     atattggtct ttccccatcc tccaaagctc tataaacatc catggccagg ggatccgaac    192540
     attccgggat cgaaggagca gaggcttttt cgttatccaa ttccctcttc catgtatttc    192600
     cacatagttt tcttgcaacg ctatagtttt ttggatgtac aggagtagag tctaacggtt    192660
     ctcctcctga gaccccagaa aatactccag gatagatcct aagatatgtt gttagattgt    192720
     catattccac ttcattttcg cacagacttt tgagatcttc tagctttgct acattcttta    192780
     aactaaacaa gttgttcttc gaagcgttgc tcacagggat aagtgatatc aatccttctt    192840
     ttctcttgtt gttgagcagg taattggcat caactccaac taccgatatt gccgttagga    192900
     ttcctctctt tattgtctct attattacat ttcttggcaa tagaccttgt atgtagatga    192960
     tattcttgtt taacatatca ctatactcaa tctccgggca ctgaataatt cttgcgatgt    193020
     tacaacaaaa ggaataggtg tcctgggact tcatctgagc aattcggcct tctacgtaca    193080
     aaggattcca tgaagaaaga gtcttcatta aatatctgat agatgtagta aatccgctaa    193140
     ctgctatgca acatggattg aacttttcaa tgaaccccaa gagttcattt tcttcatcct    193200
     ccttgaccgt tattgaatct acaaggtctc cttcaaagtc cactgcaaca gccttaagat    193260
     actttttttc ctttgtaact ccacatacat atgtgccatc tcctttgatt ccaatcgatc    193320
     catttactat tctgtcgatt gtctcgagaa aaatctcttt cttcatagcc tctgcctcca    193380
     ttttcttaag gatagatgga ataaccactt cttttgatac tttttctaca gaagaacgaa    193440
     cgatactttc tcgatatcta ttccatgggt cttcagatga aatatcgctc aaataaaagt    193500
     ctatcaggtc cctttttata atttcatctc taacctcaag ctcgttcctt tcattccgta    193560
     ctccatagct tttgaatatc acttccaaag cacttctaaa gataggatgc aaggagattc    193620
     tctggattag ttcgccttcc tcttcaaacc ttggaaaaga agatgaatcc agaggctcat    193680
     gtattttttt ctttgttctt atattttcac aaaactcttc ggctgaaagg agttctccgg    193740
     gaagatcgag gttctttcca agatgtttct tgtatccata gtaccatcga agagcacgaa    193800
     tgtctttaat actctgaaag agtgggtcgc ttccgtatct ttcttccacc cttttctttg    193860
     aattggcaaa ctccttatac tcatcgaaaa tgtcgacaat tttgtaccct tcctcaatac    193920
     taatcccttc gatcccgttg tgcaataaca caaaatggat actgtatcct tttcctagta    193980
     attcaataac cttcctgaga gattctggct taatttccat attattcata gcatattcac    194040
     ataccccgtc caagtcgatt ggatcatatt ccaatgcatt tacattgccg ctgtttgtct    194100
     cttcagttga ctcggagttc tcgtcttcga gaatgtatct gtattcatct ccagtgccaa    194160
     agatttcgta aaacagggaa ttcctatctt cataatcgat ggaagagata ctttctgagg    194220
     aagcctcgtg ctgatcttcc tcaaataaat cctcaagaat acgttttctt actgtctggt    194280
     ttccccttct gttgatattt atcatttctt ccgagctaga gtcattcatt tcaaggactt    194340
     ccaaaaaatg agtttaacaa caaaatattc caagacagcc acaatggcaa gaagatccct    194400
     ataggaaata aatccgcttt tattgttcaa atacggcttt tatcgagttg attaagaata    194460
     tcggcaaact ccagcaatgg attcaatgtc cttggcttct cctcccactg atccggaaga    194520
     atcatcgagg aggttgcttc tagagctgca atggaagcct tagcaaaatt ttctgttgtt    194580
     gaagtggcac cggaagatat cgtgtagaga tctttaatac ctgccagctc aaatatcttc    194640
     ttgttgatcc ctccagatac aattcctgtt cctcttggtg ctggaaccac ccggacaatc    194700
     gaagttccgc actttccaga tcccttgcag gacactgtgt gtggctttcc ttgggctcca    194760
     tcccaaagcc ctaaccttac tggtcttatt gcacacttag ctctagatat agctcctcgg    194820
     attgcagatg ctgcttcctt cgaggccttg gttccaaggc caacgtgccc atttccatct    194880
     ccaactacaa ccactgcctt tattctggtc ttctggcctg ctcttgtctg cttttgaaca    194940
     gatttaatcg ataaaacttc ttcctttatc gaattgccgc atagcatatc aactatttcc    195000
     ggttcacgga tcacatggga gaatttgaag atctgatcaa gagacgttat cttgaacatc    195060
     ttgacgagcc ttccaacagc agtcttgggt acccactcgt tttcttctct cttcggaaac    195120
     ggcctacctg tatttctttt ctcggtatgt tccattttaa gggcctatga gagatcaaaa    195180
     aatttgcttc tccaatccgg cacaagaata taaaggtctc ttcttaaaca caaagtgtta    195240
     tttacggatc agtatttcaa aatatcgaaa acttttaata aacaacagaa catgaagtgt    195300
     agaaaggttt gttcaaaaac tctcttatct atttctctaa cacctgttgg aagaaccata    195360
     gacaacttta ctagggacat gagcctggtt aaaagtaatc cgacacttct acaaacattc    195420
     tatgactata tttcgataaa gtacggagtt aaatgtgaga caggaatcga cttggtggaa    195480
     agagtggtga tggccgatgg tttcaagcag taagtggaaa agacctaatt ttagtcttct    195540
     agatgcgaag gatcctacta atgaacttat aaataagaag attcttctat atagatggat    195600
     tagtccagaa cacttggaac ttaagaatac agagagaagt gtgctggaag atatctctag    195660
     ggagtttaga ggtatcacct ccctgcaaac accgactgaa aagataactc atatgatggg    195720
     gataatggaa aagttgtgtg atgtagttgg aagaaccgaa ggccaggaca taatcctacc    195780
     atctatcata tattgcatta taaagtcgtc tcttcccaat atatatttgg aagttaggtt    195840
     catggctctt tatagaagga agagcatgga aaagtgcaaa gaaagatgca atcacggatt    195900
     tagtatcgat gccagctgtg agtgtttctc cagcaggcca tacgatgaga aggaggtaaa    195960
     ctattattta acatcaatgc aggcggcagt agaattcata agaaaaatgg aattttatga    196020
     tctaaaaatc agtgaaggag aattctatga aaacatgatg gatgcggtaa agctcgtaaa    196080
     agatatttga ccggggcttt ttatcggtat ctaaagcctc ccctgatgaa ggagagaata    196140
     cttaatgggc tacacaaact ttttatcacc aatattccaa ggaaggcaag aagacaattg    196200
     gtttatgaac ttctcacaca agtgtcaaaa attggccacc tctattacaa ccaagatagg    196260
     ggatattgct ttgtagacta tgagacatat gaggaattag aatacactta taacgttctt    196320
     cggggtgtta agctgtatgg aaaaagactg tacttcagta aagtcgaaaa acaagtgaga    196380
     attgttgtca ggaatatagg acaggaagta gatggggttt tcctctggga cgttttcagt    196440
     aaattcgggc cgtgccatat tgagatgaat gagggcggac taggtgttgt tatatataga    196500
     cgagaagact ctgctattaa agctgtagaa gtggtgaacg gaaaagttat aggaggctca    196560
     gaagtatctg tggaaattga taaatagtat cacctatgca accttgattt gtagtcttag    196620
     aatataataa ctcattcgta tgcatcctca tttaccacgt tcaagccaaa ggcttcttct    196680
     ttcttttttc tttcggaaaa cgcctttaca gcattcataa gacattctcc ataatttata    196740
     tctcctgttt tcatcgtaat tgatttcaaa tcatggctca tatcaacagt taaggatttt    196800
     atctggtcta tgaagttgtc cgcactacgc gccttcagaa agtaggctcc atatttgaga    196860
     tattcttctt gcttttcaaa cagattctta attacttcat acttctggag aagctcggaa    196920
     ttgggaaagg attccttgaa agcattatat atcttttgag acttctccaa tactcccgca    196980
     ccttccttta atctggattt caaatctaac agctcttggt agtctaagga aatcttttcc    197040
     atttcgttct ccttaaagaa agaattcacc tcgcttggga agtcggagta ttggatagga    197100
     gccgagatat ggccttcttc ctgaggcgct tctctagagc caatccgatg ttgaatctcg    197160
     gaatctttac tgttatagtt aatgtctttc tctgtttcat atacattata agcttctcgg    197220
     gagttttctg gctgattctc tgccaaagta ggtcccggag ctctagcgtg gagaattcca    197280
     tctttgaacc atggagagtt acccattctt ctttgagaag aagctgcgtc cgaagaatac    197340
     gggaagccac cttccgggaa gaagtttcta aatccactct ggaaccatgg agcaggactt    197400
     gagtagcccc tgtattcccc agtgtttaca gaaaagcccc tttcctcctt cttggtgttg    197460
     ggaaaatact ctatgttttt ttttgtattc tcatgccttc gtagaaactc ttcatatgga    197520
     atcctcggat cttcatccgc agacccaaat atccactggt tgaagttttg ggtgctcaaa    197580
     aaagcttgtt ttccatctgt tgttgggcct gtttgctcag ggttccgtgg agcatgaaaa    197640
     tagggttgat gatgcatctg ctggttaaaa aagatcggca aaggttttgt tgtttccttc    197700
     cctgtatttg gatagtgcct gttaaatgcc aaagagttgt ccatccaccc ggcactagtt    197760
     ttagtttgag gagggcccat tggaaacatg ttcatagatc ggtcctgggg gtctgaatga    197820
     ggaaagctgt ccatgatttc ggaagacgaa gccatgggaa agctttgcat atccggcatt    197880
     ctagaaggat atttgtgtga ggggattgaa tgactagggg aagcaaaagg cctttgattt    197940
     ccatacattg gttttcctga aaactgaaac atattcatac ttcttggatt ggaataggat    198000
     gaagaagaat tacgattaaa ttgccgagga ttctgaaggg ggacaaagcc tctcccattg    198060
     aatggagcaa ctcccggaga tttaccttgc tgcatttcat cgaaattcat atcaatagaa    198120
     ggcttcgaca tgttttcatc ctttggaact tcccttccat agtcgtaatg gccaaatcta    198180
     gtgccaaatc cctgatttac atatccaaaa ggttgcgatg gcacttcctg atgctgcccc    198240
     tccctttgca taaaaaaagg cctttgatca ggagtgttct gaaagttttt cctgctgttc    198300
     aagccgtagg gatccacctc aggctgagac ctcctaaaaa acatagggtt tccaggacta    198360
     ttagagaagc tttcttcgtt tacaatgtga tcagactcat gatgagaatt ttgaatgtta    198420
     catgagttgg accttcctct agtactgctt tccatacctc ggtcattgaa tctggaaatg    198480
     ccatctgatt catagaggtc atgcttccga cttatcctca tgatttcagg tggaacaaat    198540
     ccatcttgct ttccaaaaag ttgtttattt tctgtaaata gctgctcaga caatctcctt    198600
     tctcctcttt caaaattagg atttccatag gaataatttt gttttgcaga agccagaggt    198660
     tctccagaga tgcttccgaa ttcttggtcc ttagtacatg tgtaaggccc cacttgctct    198720
     tgggtggctt ttcctcttcc atcatttcta cttctattgc ttacgactct ctcgattctc    198780
     tggaatcttt cattcattcc tctcaggtat tcctcttcgg aattactttc ttcatatatc    198840
     ctctgctcgg ctcttatagc tgcttcttta atctgcaccg gtgtatatcc aggaaagatg    198900
     ttggactcct tcaatgcgat aaacaacttg aaaattatct gcttcctttc ttcttgagat    198960
     aacataggct aaaaatattc ctttttttta tggtggaaat tcgccttggc gttgtatccc    199020
     attgggcata acctctattc ataaattaac aagagcttca tactgctaga gtatctatcg    199080
     aagatggatg taaagctcta tacagcttgg gataaggtta ttttatttaa cataaaatca    199140
     tcaaatgtcc ggcaatatat ctaataaatt cattgtctct ccctaaactc gttgggtgcc    199200
     tcagctttgg gatatccctt gtcttcggga ttcggtctct ccttgggaaa attaggtttg    199260
     tagggcattc cttctggtct attcaggcag ttttgtataa tatcttcatg ctccgttata    199320
     ataggcttca acttgtctgt ggcaaaggta aatacatggc cactttcgct ggctaccagc    199380
     aagagaatct cggtcccagt aagaatattt agttcgtacg ctttcttcat tatgcccctc    199440
     tttctcttac tgaagcaaac acttctcttg ttttttccag atatgtattc aagctttatc    199500
     ttctttttcc catggctctt ccccctaggc ttttcaaaca taatcggatg tgtttgatcc    199560
     tgcacgaacc cttggggtat catcccagtg ttgtgaaact gaggaacatg actataatag    199620
     ttatattgct gatcaaatgc atagttcata ttttgaggca tccagtgtgg ataggtaaat    199680
     ccctctggta cattctcatt gattccatat ggaggaagat tatattcagt ctctcctcgg    199740
     atctgggggt ttctcgtctc ttctttcttt ccatatttcc tattttcatc catttcctta    199800
     aagggtcaaa attcatcttt ctaaagaaag accagtccaa tcaagatttg cagggaggaa    199860
     taaaaggata acttcggctg atactgtaat aaaaggagta tccaaagaac ataatccgaa    199920
     tatgtacacc aactgtccaa ttctacaggg acatctcaat gctacagact ctcatcaacg    199980
     gatggacttc agatctattt aaacataaga tttttccgaa cttccccact tatttcttac    200040
     atttttccag ctttttatca gcagattatg cccagagaat catcatttaa agtcccaact    200100
     gcatatatct tggtagagtc tatcttagtt ccaatgatct ttaatctaat catcacatcc    200160
     tttgttatct cattttccaa tagaaagtta ggtatttgat ggttagatat aaacaccgta    200220
     agaggcccaa cagacgcaaa cacccccatt ttgtttgttt caacaacatt cgcatccact    200280
     atttcccctt tcagtggctt tagcgtaagc gctttgtact taacagtaaa tatggtctct    200340
     cccgtcaaaa tgattctgct ttcacttatt tcatctatac taagaaccat aattacatat    200400
     ccactggagc tgcatgaccc ttcgactttg ctcagcaagt attcttctat aagagtctgt    200460
     atatttgggc ctagatagct tggactcaag tgaatgtttt gtgtaaagtc tctcacgaaa    200520
     aacatttttg caagggcttt cttaatcaat cccttaaacg ggctctgctt ataaatgaaa    200580
     tacttaatat gctttctaag ttgtttataa tttctaaaac tatcaagtaa taagatttaa    200640
     tgatatatca ccatttctct ttctttctct ttcattccac atcttctgta gaactcaaga    200700
     ttctttaagt cgcaaactag tgcagttttg tagcacccca tatttttgga aatctctatc    200760
     agcttttcta ctatatcctt tccaatccct tctcctctgt actcactaga aacaaccacg    200820
     tcttctatgt gacctttgga aacacatcct ctgataaact ttttttcgac aaacaaagtt    200880
     ccacttccaa taatcttatc tttatgtgga ttatatgcaa ccactatctt ataacatccg    200940
     tctttgcaaa gtgatagata cctttcctta aactgttcct tggtaacttt accaggaata    201000
     gttagttcat tcaggcattc aacaaatcct ctttcataat catttatatc aagacctttc    201060
     agtatatagt tctctctctt taaaatcgga atgtcacaca tactcaaact tggggagcct    201120
     gaagagataa catttgaatt ggaattcccg agatctcctt taccaaacaa actatctgac    201180
     agaaccagca caacgataag ggtaccgatg catccaatgg tacataagac ttgatctctt    201240
     tttctcattt tgggattatg ggaaatttac ttccaaacct ttatcttgat tggacaacat    201300
     ataggagggt ccatataaat gcttcaaaat ttttaaggac atgaaatttt tacaactatt    201360
     tgttatgata gccactatac ttctaatagt attgattata gtggcttccg agatgctttg    201420
     gcagaagaga aatgacttga agaaggaaga tttacaaaag aacgatggca agaagattcc    201480
     aaagatcaaa gaggaaaatg cagctagggt tatatttagg ataattgctg gaatagcatt    201540
     gataaagatt ataaagaact ttttctttca aaaaaaagat ggagagggaa agccaaaacc    201600
     acaagataaa ggacttactc caagcgctcc accactaccg tacccctatt atccagggga    201660
     atattatcat cacactctcc aatccaattt ccctccttca tcagactacc aagatatcac    201720
     aaaacatcca tacataaatc ccagtagaac atagaagtaa cattaagttg ataaaacact    201780
     gtggtatact ctctttttaa aatttttctg ttcgttacaa aaatttaaaa gaaaaataca    201840
     agtaccgcca tacatgagat accatgcggg ttttactagt aatattgatg ttagccactg    201900
     caattgtcct cacagtaacc ctgacaatta tactggaaaa tatggacagg aagggagatg    201960
     atgatccctc ggattcattt gatggcaatt cttcgggcta gagttaaaga caagaagaat    202020
     tttaaggaag ctaagccgat cttgcatcaa ccagactgat agagaaggat agttacattg    202080
     gagctttaca gttttcaaga ttccaatcct aattaatgca gggaataaga agaccaaaag    202140
     ttctaataat aaatctatct cgaagttaat tcaaaagctt ttcagaaaca ccaaaataaa    202200
     atcataatcc aagctagaac agaattatct cgtttttctt cagaagatcc attacatcat    202260
     ctaagggagc aacaaagaag tctcctttaa acatttccac catttcccca tcgattacta    202320
     ttccatggat atcggcacag cagtaaaatc caacaaattc gtgggtttga tagaactttt    202380
     tctctgtaac atatatatct ctttttttta acaaagaaat atatttctcg taaaaaacgg    202440
     cctctctcgg agacaagaac gatctgtctt catataggtt tgtaaccaac tttttcaatc    202500
     taactttcac gtactccttg gcaaaaaact ttattctctc caattccaac tcgtatatat    202560
     tcttcagtat cgatttgtct aatgatttca tgccttcagt ccttcttgaa actgcatcga    202620
     ggaagtagtt cattacctgg gaagcataag gaagtagcct tttcgccgac ttttcattct    202680
     ggtatgcaag aataagatca tttaacgtag gagagcgcat ggaaagggct tggaaatcaa    202740
     aatagtttgt ctccaaccct cagaatgatc cttgtgacac acgatggaaa atttcacctg    202800
     gatgaggtga tggctacagc cgtactgctt aagatatatc cggattccga aataatcagg    202860
     acgagaaata tgagcgttat gcggagtgga gatatagttt acgatgttgg aggtacattt    202920
     aaccccgaga ccaatagata tgaccatcat caggagtcat tcaatgaaac ctttagctcg    202980
     aaatataaga taaaactaag tagctcagga ttaatctata aatattatgg cgaaaagctt    203040
     ctagagaaat acggagttac caaaacagat gagcacttcc aaagactact agaagagatt    203100
     tatgcaactt actttttatc tgcagatgca atagacaacg gatacgaaat tttcggtgaa    203160
     atagtcccaa gatccctctc acatattgtt gaatcattca atgtcttgaa cttttcagga    203220
     ggctcaaaca acgagcagga cagaagattt cttgaagcag tacgattcgt ttccatggat    203280
     ttagataatt tcatgcatac tataatcaac ggatggatgc caaactataa atatctgagt    203340
     gagttaatta gcaaagttga tggagacatt ctgtgtgtcg acagatattg tttcatagac    203400
     gtaattcctg agatagaaag aaagtacaaa aaagatatca actttgtact aaaaaaggga    203460
     gaaagttctg tgagtatact ggctgttcca aaaaaaagaa aacatttcga gtcgaaaatt    203520
     cctttaaaga aagaatggag gggcctttct ggaggaaaac tggatgccat ctctggaatt    203580
     gaaggttgca attttgttca tttgtctgga tttgtagggt ccaataaaac tattgaaggc    203640
     gccatcgaaa tgtgcaaaga atctatcaaa gcttatctta aggaaatcaa aaatgctgat    203700
     aatctggaca aatatttata aaagcttatg ataactaaca tcaaacgatt taatataaaa    203760
     attgtggaaa ttataaattt ataataaata tataacaacg tccttgtatt tagaagcatt    203820
     aaatggaaaa cttaaacgat gaggatatca aactcaaaag ttccctagaa aacacattta    203880
     aagaaataga tcaatttttt agtgatgctg ggattatctt ttctaaatcg gaacacttta    203940
     atcttgtgaa agaaattaat gccacaatga atagctttct tggccctcga aaagaaattt    204000
     ataataggaa cgttcaaact aatgctaaaa actttttgga gagtgctaaa gaagttgcaa    204060
     aggcatttaa agaagttttc aattctttaa aaaaagaatc catcgaaagt ttcaaagagg    204120
     cttacaaaaa atataacaga aaagtagaaa attctaaaaa tatttatagt gaattggaaa    204180
     aatgtctttc tgagtatgga agtcatacct ccagtgcctg ttcgggagtt tcttctagta    204240
     ttccagggaa agaaacttca tgcaaacatt taaaatcaga aagagctaat agggctttaa    204300
     gtcaagcttt gagctttaaa aaaaaataat tccagtgaac aggaatttat tagaaaaagt    204360
     agaaggatta gaaaattcaa tcaatcaatc tatcaaaaat atagaaaaaa aactatccca    204420
     tattgagagt gttcgaaagt gtctagagaa ggcgaagagt gaaagttcga gagattttaa    204480
     cattttagaa atcttgaaaa ataagatgtc tgccttggat acaggtaaaa tggaatccta    204540
     cctaaagtgg aaaaaggatc aagttcaatt atatgatgac attctaaaag aaaatcaaga    204600
     gaaaattgaa gttttcttaa acaactatag agaatatttg agacataaaa aagagaaaag    204660
     aacttcttct gttgtcaggg aggcttttgg agtagtagaa agctttcagg acgtaaatag    204720
     ctcctacaat agatttctct cccttctaaa agaccattgg aagttttgga aagatatctt    204780
     tcgccatcta agaaacaatg atgatggaaa ctggttatca gaagtaacag gaaatgaaga    204840
     aagaatctca ccgacaagcg atatcgagac ttttttagat acccctgtct cccaagactt    204900
     gctttttgat cctcaaaagt tggaagaatt gttctctgga gaagaaagcc aagttctgga    204960
     acccatccaa tcagctatcg aatttcttaa tcaaattcaa cattacgata aagacaccac    205020
     agagattcgt gaatatgctc agtctattat tcgtaccgat atctacagag ttttcgtatt    205080
     gaaatattta ttaagggaaa gcccagtacc ggaattctct ttggaatctt ctcagcagga    205140
     tgccctcgtc tctgagatct tagaaagtga ttatttcctc tttttttgcc ttcttgtgtg    205200
     ttctggattg attgctcttc aaagtatctt tagaaagact agtacatcca aagagacaat    205260
     gaatgccttg ggaaagatat catatgcagt atctattctt ggcccaattc tacatgggat    205320
     gtggatacta tcaaatgaaa attatagtga agggattatt aaagtaataa gcagtaactg    205380
     gaatgtgatt gcaagtatgg ctcctatgtt tcttgttctt agagatatta aatacataaa    205440
     gaatggagaa ctaatgacat cagaaggggc aacagccata ggaggccatg gcgtaattgt    205500
     ggccatgagc atgatcatga tgtgtgcaca aacacttgga aagaaacatg agggagaata    205560
     tagtagacaa acaatggtat ttatggctgg aaacatcata atgacaacaa tgtatggtgc    205620
     gaagttattt gggccatgga ctaagagcag gaatcatttt attatactcg gatacattgt    205680
     gtttgcactt atacttttct taatggttat gatgagtgaa aagaaaaaga taaagaatcg    205740
     aactaatgac aaaacagaat ggatgggggt gctccagtgg attataatat gcacgtttct    205800
     tatacttgga ctacaaaaac ctgagtttca ctgtcttcag tatgctaaaa atgaaattat    205860
     agtttcatga aaggtacttt ataaatagcc attaaataaa tttcaaaacc aaataccata    205920
     atatagacaa tagaa                                                     205935
//

If you have problems or comments...

PBIL Back to PBIL home page