(data stored in ACNUC8465 zone)

HOGENOMDNA: ENINT1_9

ID   ENINT1_9; SV 1; linear; genomic DNA; STD; FUN; 204910 BP.
XX
AC   CP001949;
XX
PR   Project:42703;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Encephalitozoon intestinalis ATCC 50506 chromosome VIII, complete sequence.
XX
KW   .
XX
OS   Encephalitozoon intestinalis ATCC 50506
OC   Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-204910
RA   Corradi N., Pombert J.F., Farinelli L., Didier E.S., Keeling P.J.;
RT   "The complete sequence of the smallest known nuclear genome from the
RT   microsporidian Encephalitozoon intestinalis";
RL   Nat Commun 1(6):10-10(2010).
XX
RN   [2]
RP   1-204910
RA   Corradi N., Pombert J.-F., Farinelli L., Didier E., Keeling P.J.;
RT   ;
RL   Submitted (22-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Botany, University of British Columbia, 3529-6270 University Boulevard,
RL   Vancouver, British Columbia V6T 1Z4, Canada
XX
DR   StrainInfo; 819376; 0.
XX
CC   Linear chromosome is missing portions of the telomeric regions.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..204910
FT                   /organism="Encephalitozoon intestinalis ATCC 50506"
FT                   /chromosome="VIII"
FT                   /host="Homo sapiens"
FT                   /strain="ATCC 50506"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="host nasal tissue"
FT                   /db_xref="taxon:876142"
FT                   /culture_collection="ATCC:50506"
FT   gene            complement(<51..>632)
FT                   /locus_tag="Eint_080010"
FT   mRNA            complement(<51..>632)
FT                   /locus_tag="Eint_080010"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(51..632)
FT                   /codon_start=1
FT                   /gene_family="HOG000149936" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080010"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0100"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D2"
FT                   /protein_id="ADM11938.1"
FT                   /translation="MGKLFKKFRIEKANERKKSKEKPKIRKTQEIKSHLKERSEIEKIF
FT                   WCLDVSSKRKIGYRKIIGLDESELERNVLLVLEKVLEIVVTFDPVDDLFYSVLKRLIHL
FT                   KNSASTHSTLIDYFLASILCGVNYEKFGCFLFRYLPQLLLDNRDRILSKIPDSELKKKI
FT                   SALKPKSKFSTIEYRQRFIILKDRVLVNID"
FT   gene            complement(<679..>2637)
FT                   /locus_tag="Eint_080020"
FT   mRNA            complement(<679..>2637)
FT                   /locus_tag="Eint_080020"
FT                   /product="White ABC transporter"
FT   CDS_pept        complement(679..2637)
FT                   /codon_start=1
FT                   /gene_family="HOG000149337" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080020"
FT                   /product="White ABC transporter"
FT                   /note="similar to ECU08_0110"
FT                   /db_xref="GOA:E0S8E5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E5"
FT                   /protein_id="ADM11939.1"
FT                   /translation="MKKRILRFEDVFLKAPNNNKDLKGEYIDLISGISGEVASGKLTAV
FT                   MGGSGSSKTSFLNLLMGKVNSNVLTSGIITLNGEQRKVYKWLESTSYLEQFDTFTSGLT
FT                   VEESIRYSIIFRGREIKDSTIPSIVDDIIRDLGLNRLRGSLISSISGGERRRVMLAIEL
FT                   VVEPDIIFLDEPTSGLDSRLALETVRILKKYAETKNKIVLMTVHQPGNSMFTLFDDIIF
FT                   LDKGKIIYAGPISGIDGFLLSIGMQRPFNISVAEYLFELEMDIRKQQGLWLSSDQHQEV
FT                   KYCNESLLERNSQRFVVSAVSWKHIWHLLIRQFKIDYRSGVMRNVFLFKMAVATVLFFF
FT                   LCDKMRYSVFLFINRMCPRYLAAGEMYLNDLRNFLQKNYEDLNILYSDVLDFFAYNMIP
FT                   FVTCFSIFNDSSFLDHRALLQKESFRCDYSPISLLISVLIYECIFSIIRSLYFCFLLSL
FT                   TQLKEILTGRAISMFVLTPLGMVIFMTMVKAFSSGSYPLNITRVAAFVLSTFLRPLYLS
FT                   IELEELSNRYSFMKYLYPVSYGLFLCPFLLLDAFFYVTLGGRSSISLGFISFLNQINGV
FT                   QTSQEDIPLKNTLNYTITFLNRCYLSDGFLVILALFSFLSVLILSTLFFVLKFSPNVRL
FT                   TMSVKSLDMKLDEITVN"
FT   gene            complement(<2855..>4141)
FT                   /locus_tag="Eint_080030"
FT   mRNA            complement(<2855..>4141)
FT                   /locus_tag="Eint_080030"
FT                   /product="zinc finger domain-containing protein"
FT   CDS_pept        complement(2855..4141)
FT                   /codon_start=1
FT                   /gene_family="HOG000149935" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080030"
FT                   /product="zinc finger domain-containing protein"
FT                   /note="similar to ECU08_0120"
FT                   /db_xref="GOA:E0S8E6"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E6"
FT                   /protein_id="ADM11940.1"
FT                   /translation="MHDIEYLLKYLLDSTTLRIEKLEDITSLQQAAAFEKKFGDTKRIK
FT                   AFCMEIGPVTYFPVFGVPLSRDSITHKVKLCSVAVGESIYVSKEYVKQMNPPGHYNSFI
FT                   TSDIGYQVGFLSDSQADVKNYWYAIKDPSRILPLFDITFEYDSELEMRSKGSFVCDRCR
FT                   VNQSISFCPAERASFCGECDEEVHSDHFLKRHVRYYFNEVGKKKFIYCASHMDTMVDYF
FT                   CEECFIPVCTKCKISGNHSELPNGSHSLLNYVEACDRLQEILKVGEVRLVEEERKLKES
FT                   INEFKKNVEDFQNNISSLRDKIESEYRNAMNELHAFEKKEFQVINTHYISYLSRLAELE
FT                   RMREYPSGLEPSQLLRTFKSVTIQRESLTESTAGEVFKPAEISLKGHLTLKDEENYITR
FT                   KGYSPRMEKSTQLYVETRGINVNSHGKSK"
FT   gene            complement(<4248..>4871)
FT                   /locus_tag="Eint_080040"
FT   mRNA            complement(<4248..>4871)
FT                   /locus_tag="Eint_080040"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(4248..4871)
FT                   /codon_start=1
FT                   /gene_family="HOG000149934" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080040"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0130"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E7"
FT                   /protein_id="ADM11941.1"
FT                   /translation="MGKIDLSPLLHNILVFVRKFASKITVTNTSICSRSIFVEMPKFCD
FT                   CSFTVRVKDFIAMLKQTQEFTVEEKELRYSYEASMEGSLVNVERRIKRYEEEYQIAGGV
FT                   PLLSIAINGLKVLSSEEIEIKAGKDGNFVMESFGVVRTRSKYSGLRVPESTVDSVTVKV
FT                   RGRDLRILEELKGDVIFSFLDSHILAYSLGDNFTIVIQISILNT"
FT   gene            complement(<4950..>5171)
FT                   /locus_tag="Eint_080050"
FT   mRNA            complement(<4950..>5171)
FT                   /locus_tag="Eint_080050"
FT                   /product="putative Sm-like small nuclear ribonucleoprotein"
FT   CDS_pept        complement(4950..5171)
FT                   /codon_start=1
FT                   /gene_family="HOG000149336" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080050"
FT                   /product="putative Sm-like small nuclear ribonucleoprotein"
FT                   /note="similar to ECU08_0135"
FT                   /db_xref="GOA:E0S8E8"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E8"
FT                   /protein_id="ADM11942.1"
FT                   /translation="MELPALEILKKNRNKCVRIITLSSKTYRGVLENFDMHVNTHLKES
FT                   YLQIDGESETYIGEVLINGGTIACFDII"
FT   gene            complement(<5196..>5879)
FT                   /locus_tag="Eint_080060"
FT   mRNA            complement(<5196..>5879)
FT                   /locus_tag="Eint_080060"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(5196..5879)
FT                   /codon_start=1
FT                   /gene_family="HOG000149933" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080060"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0140"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E9"
FT                   /protein_id="ADM11943.1"
FT                   /translation="MHFTLLYPEGEKWKEIKKAALKSVVRGNLEEDDMSSLSKDSEDYK
FT                   NYIMVKRNYARVVKQIEKGEVYDFYSQRRRFKRKIHSLSEFNRFKVVAILKDGSRSYLF
FT                   EDGRYKEIGQTTRYQRCPFCNENIASEEINNHLRAKTCNRELESDEGGRVTVIFDKGIR
FT                   TEYESLEFNCNNVRMLKKFVYDKTGISVSKQEVYRGETVLKNSDSLGRETVIIKQKKRT
FT                   QKNSG"
FT   gene            complement(<6316..>6612)
FT                   /locus_tag="Eint_080070"
FT   mRNA            complement(<6316..>6612)
FT                   /locus_tag="Eint_080070"
FT                   /product="adaptin small subunit"
FT   CDS_pept        complement(6316..6612)
FT                   /codon_start=1
FT                   /gene_family="HOG000149335" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080070"
FT                   /product="adaptin small subunit"
FT                   /note="similar to ECU08_0150"
FT                   /db_xref="GOA:E0S8F0"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F0"
FT                   /protein_id="ADM11944.1"
FT                   /translation="MVLAQKERNIANGRETVVFNKFGNMFIAFVVENENEMYVLSLINN
FT                   LMSIYDRFFTKVCELHFIYNFKETHLILDNYIVNGKCIENDPFEVMKYAYYIK"
FT   gene            <6777..>7379
FT                   /locus_tag="Eint_080080"
FT   mRNA            <6777..>7379
FT                   /locus_tag="Eint_080080"
FT                   /product="Ca2+-binding protein"
FT   CDS_pept        6777..7379
FT                   /codon_start=1
FT                   /gene_family="HOG000149334" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080080"
FT                   /product="Ca2+-binding protein"
FT                   /note="similar to ECU08_0160"
FT                   /db_xref="GOA:E0S8F1"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F1"
FT                   /protein_id="ADM11945.1"
FT                   /translation="MGSLSSTMLCEEEIEELKNTTVFDEREIEHLYERFQFLDRESRGY
FT                   LTYNELNNIPEFQSNPFSHLIMKSIEKMTDYEKMTFPHFLEFLGIFSEKNNRKNRIRYL
FT                   FDIFDLNGDGKLCRNVLVRINKMMGQDGKMEEVENLLNIYDEGGKGYLDTSDFAKFYES
FT                   DPLIDRNMIIDFSKNLKRPRQVGFMQVLWPSTYKDEE"
FT   gene            <7499..>8899
FT                   /locus_tag="Eint_080090"
FT   mRNA            <7499..>8899
FT                   /locus_tag="Eint_080090"
FT                   /product="putative vesicular transport protein"
FT   CDS_pept        7499..8899
FT                   /codon_start=1
FT                   /gene_family="HOG000149333" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080090"
FT                   /product="putative vesicular transport protein"
FT                   /note="similar to ECU08_0170"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F2"
FT                   /protein_id="ADM11946.1"
FT                   /translation="MFFKKHEEPKALGAGERLNLLSNRLTGSIYYEDRADALEKILEMS
FT                   KVYPVEVGVHALEDVICSMERMDDVSIHLKILSNVLRCIHRLEFIDIIVKNSESLRILC
FT                   DCIGNGKSGKEVYDLLCVLSVSEFFSPKAVGIPSMAHYCVQMVKEKRMGLIPRLALGDL
FT                   NFRRELTFMGIFENLLKELQDEFSRDAMSTLALLLKDSPFNQNYFNELRWDFLLKYIDK
FT                   HPNEVFDVLSALIDLKNIEFQKLQSSVYRRIDLVVLLEFRRWDLLYLIVKDNQPYTEKL
FT                   LETSVFDKIEEWLPKETLTTKQNELYLLVDYLLFWSNPDVSKMNSYKIYTMKSLREQDI
FT                   STNDLMEGAFKIIGQLDSREETVVFDALIFIIFNFEKSRAEKMISVLSEIFCDYTKPKL
FT                   HRFLCLIILLMLETPVDRVNINHYTAYHLLREARFLLCSIDLNSPLYLTNEMVDILVNN
FT                   IGDLVRIR"
FT   gene            complement(<8974..>9774)
FT                   /locus_tag="Eint_080100"
FT   mRNA            complement(<8974..>9774)
FT                   /locus_tag="Eint_080100"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(8974..9774)
FT                   /codon_start=1
FT                   /gene_family="HOG000149932" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080100"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0180"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F3"
FT                   /protein_id="ADM11947.1"
FT                   /translation="MFGEELEGKIFTYDSKNNLVAYSNRVESNTKVVYIGGLTSRFPIC
FT                   LPTIMLNQYCIENGYEFIIPQLRSHPEYGLFTIDDDIEDLGCLLSQTNGDVILVGNSTG
FT                   CQDIVYYLNNTKDRKIKLAVLLGAVSDVEFEEHENKNLPDLLRWAKETIERKKEDVAIK
FT                   HQSGLYLTPKRILDIFSRYGKEDMFSSYLEDKFYMELNKGGTRLLFVVSGKDEYSVRNI
FT                   ESKLKLVRNSRVEKIPEGTHVLSRVEDVEMFLRFFSEEIKEIIK"
FT   gene            complement(<9932..>11152)
FT                   /locus_tag="Eint_080110"
FT   mRNA            complement(<9932..>11152)
FT                   /locus_tag="Eint_080110"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(9932..11152)
FT                   /codon_start=1
FT                   /gene_family="HOG000149931" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080110"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0190"
FT                   /db_xref="GOA:E0S8F4"
FT                   /db_xref="InterPro:IPR009723"
FT                   /db_xref="InterPro:IPR012590"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F4"
FT                   /protein_id="ADM11948.1"
FT                   /translation="MVEREISPIDFVEERSKEIQSIEAAIETNRKKSMMFQRLPFYLRR
FT                   RLRSHEKRTRKKNRMRKKDRHGLRTHVWYAKRFEMLKVWNTSIPLRRRMKSSKFIYKSQ
FT                   KKRGFVFDESYKDIVVYKRPDVEISGIDFSLGDVVQRIQQKNIVFEAIVSERFLIIITS
FT                   DLEEIEFGMILEEYGRIECCLSLIQVDELFLDEVNDETGRLTRILSHKEKGKIDRALSD
FT                   RSSMAIFVRSLSQAESGKVLLKRNMVMSFWQDIVNVGIIPICIEELQRLALENDYMVYP
FT                   FDYSTTRLYKDFEQSYTEPIKSKYERTPRSKKMALNMDLMYIYTSDPVVFASFELEKGR
FT                   ADRCAFIFDENDTVIGRVIRGGFCFTKGLCRGLCYILCDVKEGDEFYSRNLNSLSFNQM
FT                   KITKVFR"
FT   gene            <11204..>11977
FT                   /locus_tag="Eint_080120"
FT   mRNA            <11204..>11977
FT                   /locus_tag="Eint_080120"
FT                   /product="hypothetical protein"
FT   CDS_pept        11204..11977
FT                   /codon_start=1
FT                   /gene_family="HOG000149930" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080120"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0200"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F5"
FT                   /protein_id="ADM11949.1"
FT                   /translation="MVISNKGRHSNDKSLWPSLPMDCMISPQNAFTIDRILQAVRTSTI
FT                   LIDTTKEITFQLVSSDKTLVLNLDLKETFFETLSSKNRLALIPRQKFYIKKMKLLKITT
FT                   KEYIITFEYVFDKYILRRRVFYNPSSFFSVGFKTDYSGEVSPSIMRLALKEISDQLVTL
FT                   KIDNGRGEIYNEETKMGFPLEFSGEFSVDLVGGNLRSMLEVSDLFARTIVNYGASNPSI
FT                   NFIFLGNEIRASFFAAINHNPIKKENLSSGGAFGR"
FT   gene            <12131..>14986
FT                   /locus_tag="Eint_080130"
FT   mRNA            <12131..>14986
FT                   /locus_tag="Eint_080130"
FT                   /product="WD40 domain-containing Sec31-like protein"
FT                   /note="involved in vesicular transport from ER to golgi"
FT   CDS_pept        12131..14986
FT                   /codon_start=1
FT                   /gene_family="HOG000149332" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080130"
FT                   /product="WD40 domain-containing Sec31-like protein"
FT                   /note="involved in vesicular transport from ER to golgi;
FT                   similar to ECU08_0210"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F6"
FT                   /protein_id="ADM11950.1"
FT                   /translation="MKFNKRCLTVFSDEKPFMAMGTKSKLFDTSFSLTSELFLYDYSLG
FT                   VQYPPLQTDNKFYKLKWCGWGDGEILATGNEDGKVTLYTPAPEKNISFELLSSCCVLEG
FT                   DVLGLDFNPSKGVLAAGSSNGKIIFWNLNRLDSQYTSDIPLTSNITCLSWNKKVSRILC
FT                   AGTDDGKILILDIRAKNVAMTLGGDDITMVSDVMWHPNGSTSILAATNQKRLQCFNLSS
FT                   DSTSQIGEHESGIIRLSLIDKGYMAASSKEQVDIIEVSSNKVIDTIPVDGIFEVSFSKR
FT                   DPLMALSYVGGTTEILPRVTTDVLPTNPGCIVGCNIVGKDLYEIEDKKMKDVEEDAFVG
FT                   KIKKLLYPDGNYSIDRKGLGELLLGEAIGRNNKKNLEVDEELNKKVSGMSLELKLDLED
FT                   PLTLALIKGDLEEAYSESVESNKTVPFSQFLALAKGSESLSFDSDDPLILLATAQITAR
FT                   FSDLLEKISTSQWLALLSIISFSPLSDSDFFSNALELANKLGNEEKLLVYAIVNRLDDY
FT                   FELKESMYRMPKSIYEVRDFFQRYKEIVSDLESMGGLYKSPMISEYFWYASTHGETPTR
FT                   IKYEDLGINIYLGRATSSISSPKSSSPSIGDSYGRQNVFKRSPSLEPQTRQDSGATVKY
FT                   GMASIKPNTPMTGPSLLSSHSGMSTTTTSSLGRPIIPGASISSAHKNIVQSPPSPVISQ
FT                   QRMKVPSPPLGPNKSPYSSVGLSAAQKMYIPRPGYKTMPSTPTYNSASKGISQKTYSSM
FT                   PDISSLSSSSQPVSTYGTMSRGPSSQEHSSQSNVSKPYIPKPGIPSSPSLSPQNNLQRP
FT                   NIPIPQPQGRDLEPSAQSQASSPQKSTDNLNSEEILKTFESITEGLIEKASSKANLIVR
FT                   NKLKEVTKRLSIYGSVAKDTFSPLILGGIDRINKEIKNNENTDTMKQKVREIILECTES
FT                   GENRADLWMPSIYTLLQIVYH"
FT   gene            complement(15054..15125)
FT                   /locus_tag="Eint_080140"
FT   tRNA            complement(15054..15125)
FT                   /locus_tag="Eint_080140"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA Type: Glu, Anti Codon: CTC, Cove Score: 60.88"
FT   gene            <15246..>16055
FT                   /locus_tag="Eint_080150"
FT   mRNA            <15246..>16055
FT                   /locus_tag="Eint_080150"
FT                   /product="cell division protein kinase"
FT   CDS_pept        15246..16055
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080150"
FT                   /product="cell division protein kinase"
FT                   /note="similar to ECU08_0230"
FT                   /db_xref="GOA:E0S8F7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F7"
FT                   /protein_id="ADM11951.1"
FT                   /translation="MTRYILGGIIGSGTYGEVYEAIDTETKEKVALKRIKLNEKEGMPG
FT                   TALREISILKKLNHKNIISLVSIIHTDALLTMVFPFIDYELKKYIGMNTGKNIMELVNQ
FT                   LICGVHYLHQMNVVHRDLKPQNILVTSDGVLKIADFGLSRSLEIRVPPYSSEVVTLWYR
FT                   SPELLMGSTSYRFYVDIWSLGCIIYEMITLEPLFPGESKENQLTLIRRKAGTRRSLKHA
FT                   IEKKLTAPKFVVDIILRCLDFNYDQRITADEIVEILENEYGTRGGIS"
FT   gene            <16120..>17250
FT                   /locus_tag="Eint_080160"
FT   mRNA            <16120..>17250
FT                   /locus_tag="Eint_080160"
FT                   /product="GTP binding protein"
FT   CDS_pept        16120..17250
FT                   /codon_start=1
FT                   /gene_family="HOG000149331" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080160"
FT                   /product="GTP binding protein"
FT                   /note="similar to ECU08_0240"
FT                   /db_xref="GOA:E0S8F8"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F8"
FT                   /protein_id="ADM11952.1"
FT                   /translation="MKTEWGRLIIEKRFGAKPKIKPKVQRCSATEYGGIEKLSEQLTVK
FT                   NRKISAGRPANSVEEFEEQSEVDVIVERLSQSFEFSRTIPPRVPYKGIEKELFKEVEGK
FT                   VFDRWKGLQRCTVFERNIEIWRQLWITCERSDVIVQIVDARNPEFFLNDDIRKLYPKKE
FT                   HVVLINKSDLSSNRTEIKGYRCFHYSALEGKSLLKFVLGYKGKMVGFVGYPNVGKSSTI
FT                   NSIMNSKRVKVSQTPGKTRHIQTIYIEDGPCLLDCPGLVFPRHRKLDLILHGILNVDQL
FT                   LDLNSSVDYIIELIGIGKLCRFYSLKGFYNDSRYSKGTNYINLMSMSKGWETSRCLKTI
FT                   VKDFVSGKIPYEKIDENCLEAMFDWYEKEIPQKSFM"
FT   gene            complement(<17376..>18503)
FT                   /locus_tag="Eint_080170"
FT   mRNA            complement(<17376..>18503)
FT                   /locus_tag="Eint_080170"
FT                   /product="vacuolar H+-ATPase V1 sector subunit H"
FT   CDS_pept        complement(17376..18503)
FT                   /codon_start=1
FT                   /gene_family="HOG000149330" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080170"
FT                   /product="vacuolar H+-ATPase V1 sector subunit H"
FT                   /note="similar to ECU08_0250"
FT                   /db_xref="GOA:E0S8F9"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8F9"
FT                   /protein_id="ADM11953.1"
FT                   /translation="MFLKKLEAKTRDSLSPEVVSESVERFREASKHGDRKEVSMLLREE
FT                   NVGASILLSCPELLGEDDLIDLLFCPDIYSRYISAEILTRIYGDKNHRKEYISFFKQML
FT                   KENTSYEESNYLLSLLVDLLSCKSNSEFDVEKRKMELASNKMFIEILHTSVFVKEIQYN
FT                   TLMIILIFSYSKECIDKMNTLIDDVVIIVKERAREKILRVCYGIITNILDSGYIFSPGK
FT                   LNDISKCTEILLEGGYSDEELMADLEKVRAKIMQSTKQFCIRNYLNELFSGRFEDSEYH
FT                   HKEDFWSTNLDMLMKNKVEIVKVLKKYLKSNNPSWVCLACSDIFQLVKVSPEINTVLNK
FT                   YQVKEILFNLINSENDDIRFHAIQALYTCISSEWS"
FT   gene            <18715..>19617
FT                   /locus_tag="Eint_080180"
FT   mRNA            <18715..>19617
FT                   /locus_tag="Eint_080180"
FT                   /product="G2/mitotic specific cyclin 2"
FT   CDS_pept        18715..19617
FT                   /codon_start=1
FT                   /gene_family="HOG000149329" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080180"
FT                   /product="G2/mitotic specific cyclin 2"
FT                   /note="similar to ECU08_0260"
FT                   /db_xref="GOA:E0S8G0"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G0"
FT                   /protein_id="ADM11954.1"
FT                   /translation="MVALFRKSEPLRNVTNKIVKRAEKTQFPLSKVEEVVYRQQKIMDA
FT                   SQIVMADKYSDDIFEYFSAIDKPFVYVNDGVSWKMRSLLVDWIIDIHDKLGLCHDTLFL
FT                   AINLVDRFLSMRSIPSSKLQLVGISALMIACKYEEVVCPALQTFVLLTEKTLTGDDVRK
FT                   AEKYMLHTLNYDLQYVSPLNFLRKCSKANNYEINSRAVGKYLLELMTLYEEFLKFKGSV
FT                   RAAAAMYLSRKMTSQDQCKNLFTMYSGHTKDDIKECFNALVRVISESIPFENIQNKYNT
FT                   PKFLHVSSFVREYAEKNFK"
FT   gene            complement(<19985..>21166)
FT                   /locus_tag="Eint_080190"
FT   mRNA            complement(<19985..>21166)
FT                   /locus_tag="Eint_080190"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(19985..21166)
FT                   /codon_start=1
FT                   /gene_family="HOG000149929" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080190"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0270"
FT                   /db_xref="GOA:E0S8G1"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G1"
FT                   /protein_id="ADM11955.1"
FT                   /translation="MQLPIPRINSTNYKRILAEARLSEDREKVISEIKSVILLMPHRSS
FT                   IISNLINDLAEDNPEFKDKIVSMANDISMAEDTYGLISASFTFKRLGVEGTEGLFWVKE
FT                   IPTTNSLLGSTSFEMPPASLDRCKKEVERMLGISNEKSFEEVFCVVQIIRSFRFSVHEC
FT                   LGQLGYISKQKTLVDGLRILHKEENSLYLSALILELAKKQGFLKILLEDLPLFDQEFRD
FT                   ILLPLVFEYFYGPSDESNSVYISSSYIPLGTSEDIDPFRRLITETTVRNMKRISGSNKV
FT                   EAFLNKKENLEAKKVPRMSREEFEKTNFEDKNAFFRNFCLLGSPSVSHFLTYLEIYKEQ
FT                   LVLNEEEQKLFLSIFFKTFEGLESFSRIVLEKLVLFKIVDFKLLENFNGEHSL"
FT   gene            <21322..>21915
FT                   /locus_tag="Eint_080200"
FT   mRNA            <21322..>21915
FT                   /locus_tag="Eint_080200"
FT                   /product="proteasome subunit beta-type 2"
FT   CDS_pept        21322..21915
FT                   /codon_start=1
FT                   /gene_family="HOG000149328" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080200"
FT                   /product="proteasome subunit beta-type 2"
FT                   /note="similar to ECU08_0280"
FT                   /db_xref="GOA:E0S8G2"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G2"
FT                   /protein_id="ADM11956.1"
FT                   /translation="MDSSIGIRGNNFVIVAADTKISTSFLVVKEDYEKFQTVGNRIVMS
FT                   MIGDQGDAFRTMLYVSESAYYEEIQNGIELSPSVLAHMIQNKVHKALRKRQLDMSSIVG
FT                   GKGPEGYDLWSVDRYGAISSVPFCANGYAAYFVYGIFDREYTEDITIDAALNIIQKCIN
FT                   LLKERLMINLEGFMVKIVTDDGISTRTLTPEIKS"
FT   gene            complement(<21976..>24045)
FT                   /locus_tag="Eint_080210"
FT   mRNA            complement(<21976..>24045)
FT                   /locus_tag="Eint_080210"
FT                   /product="DNA replication licensing factor Mcm3"
FT   CDS_pept        complement(21976..24045)
FT                   /codon_start=1
FT                   /gene_family="HOG000224126" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080210"
FT                   /product="DNA replication licensing factor Mcm3"
FT                   /note="similar to ECU08_0290"
FT                   /db_xref="GOA:E0S8G3"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008046"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G3"
FT                   /protein_id="ADM11957.1"
FT                   /translation="MESEFIELFKGFVESYRTPQDKDIGEVISKLPYEDYQRIILNIND
FT                   MRAFDKTLAKGILEEPGTLVPFAEDELSDMGGRKIFLGVKGSFGDHLLNPRTLTSVYIG
FT                   KMVSVEGIVTSCSICRPKIMRSVHYNRLKNVFYSKEYRDATMVTKLPVTNTVYPTRDMD
FT                   GTLLTTEFGLSEYFDHQTIVLQEMPEKAPPGQLPRSVEVILSFDLVDQLKPGDRTKIYG
FT                   IYKSLCFGNQQFPSRFRTVIVANNIEKIQEEEGETEPEMEMEFEVLSKMKNIHNSIAPS
FT                   IFGHDIIKKSIALLLVGGNEVVMKNGSKIRGDINILLVGDPSTAKSQLLRYVLNAAQLS
FT                   VPTTGKGSSGVGLTAAVVLDKDTGEKRLEAGAMVLADRGVVCIDEFDKMSDGDRVAIHE
FT                   VMEQQTVTIAKAGIHTTLNARCSVLAAANPIWGQYKESRPPQDNVRLPESLLTRFDLIF
FT                   VTLDKSNADTDQLISEHVLRMHMLGQGYEEEGIGIKQEVFRAYIQHCRRKKPVLSREAS
FT                   RLIVEEYTLLRQSKDRKQQIVSITPRMLETMIRLATANAKLRLSDVVEYDDAECAVNLI
FT                   KDSLFQKVIKTSKRIKVGGAEPQDEFDLVDEKGTLKQRLEEAMIDEDKVDFVSHALYDY
FT                   SADPKNPRVLDIKDFMEYLGVDVSVTEPEVEAILSGLAEKDLILFENGRIYLLN"
FT   gene            complement(<24133..>24813)
FT                   /locus_tag="Eint_080220"
FT   mRNA            complement(<24133..>24813)
FT                   /locus_tag="Eint_080220"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(24133..24813)
FT                   /codon_start=1
FT                   /gene_family="HOG000176611" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080220"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0300"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G4"
FT                   /protein_id="ADM11958.1"
FT                   /translation="MFKRFSRFKTFFSVILIVIMLRNVRRLRRSSLLPGRHLLLIAHPD
FT                   DESMFFAPSLLSLRERMDILCLSNGNKEGKGKEREKELRKVGSYAGTKVIMTALFADGE
FT                   DWDPLAVYLKLLWIYITRPFDVLMTFDEFGVSGHKNHISCYKGARLFLKLHNVKGAFLK
FT                   SKDLLRKYVIDISFSRVSSTIPFSMYMSSTKMMLLHRSQMVWFRYLYVLFSNFMSYNDF
FT                   TIVN"
FT   gene            complement(<24865..>25770)
FT                   /locus_tag="Eint_080230"
FT   mRNA            complement(<24865..>25770)
FT                   /locus_tag="Eint_080230"
FT                   /product="WD40 domain-containing protein"
FT   CDS_pept        complement(24865..25770)
FT                   /codon_start=1
FT                   /gene_family="HOG000149928" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080230"
FT                   /product="WD40 domain-containing protein"
FT                   /note="similar to ECU08_0310"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G5"
FT                   /protein_id="ADM11959.1"
FT                   /translation="MKLEKMSKIKSLGHPASSIDLAISENRRYLLSVGVYKPCVKIYDF
FT                   ENLAQKVERHLESEPARVLSLVPDASKICILRGDRTIEFHAKYGHHEGIRTPTVCFDIC
FT                   LNKFRAELMSGGKGSAVYRFNLDQGRFLRSYAVTIDEIYSIEMNECNGLIGVGGAGGVQ
FT                   FIDQRCKEIVKSVEYNESPSSITFAENGIDFGVGTNEGTVYFHDLRARKELFSVKHDQR
FT                   IKKVTFNGKILISLDRGALRCCSRTGMVGEYLSSSEMNCLTCDGGVVFIGLDNGEISEM
FT                   ISEDLGEIPQWCKVFGDQVD"
FT   gene            <25833..>26183
FT                   /locus_tag="Eint_080240"
FT   mRNA            <25833..>26183
FT                   /locus_tag="Eint_080240"
FT                   /product="DNA-directed RNA polymerase subunit K"
FT   CDS_pept        25833..26183
FT                   /codon_start=1
FT                   /gene_family="HOG000225272" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080240"
FT                   /product="DNA-directed RNA polymerase subunit K"
FT                   /note="similar to ECU08_0320"
FT                   /db_xref="GOA:E0S8G6"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G6"
FT                   /protein_id="ADM11960.1"
FT                   /translation="MDSEDVRLSSEYSTEENNTEIVSMSNAEVRISSSDRKTLPRMTKY
FT                   EKAHVIGVRASQLSAGAPPFVDIGNESNPLAIANMELNEKKIPFIIRRRLPDNSFEDWA
FT                   IDELMIPGVDFQ"
FT   gene            <26724..>27752
FT                   /locus_tag="Eint_080250"
FT   mRNA            <26724..>27752
FT                   /locus_tag="Eint_080250"
FT                   /product="hypothetical GTP binding protein"
FT   CDS_pept        26724..27752
FT                   /codon_start=1
FT                   /gene_family="HOG000149927" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080250"
FT                   /product="hypothetical GTP binding protein"
FT                   /note="similar to ECU08_0330"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G7"
FT                   /protein_id="ADM11961.1"
FT                   /translation="MIIRCIPRACSKDIRQTKLQGRIKFEIISPGMGIKKKRQSKRLTT
FT                   RKRESMLKKSRIDERKKRRMNRKMQAKMEKVPPSVLRTDEENIQYAEIKRMEKLRKMEY
FT                   EETLKNSEKKEPYLNEMVSLVSKSDVVIEVVDARDPDGSRNGEAEKIVSLHGKKLIIIL
FT                   NYTHYVPREIVSEWKVHLRKNGANCIELGEEDISWIGEEARIGIFGNPGSGKNFVLQSI
FT                   SRVLGRKPKSSIVSVPPSGVTPSSILRGCNGLIGIPFKSYIDAIIERIDKKEVAILHRI
FT                   PEFGSSEELLESICEEYQIDGDNKHIRYMKASEKFLESFLLHKILFWRRVDEDGLSFAF
FT                   PS"
FT   gene            <27856..>29118
FT                   /locus_tag="Eint_080260"
FT   mRNA            <27856..>29118
FT                   /locus_tag="Eint_080260"
FT                   /product="putative coatomer complex subunit delta"
FT   CDS_pept        27856..29118
FT                   /codon_start=1
FT                   /gene_family="HOG000149326" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080260"
FT                   /product="putative coatomer complex subunit delta"
FT                   /note="similar to ECU08_0340"
FT                   /db_xref="GOA:E0S8G8"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G8"
FT                   /protein_id="ADM11962.1"
FT                   /translation="MIIGLFVANSLTGQMVSRMTRTMPVSKMEHFVFDFISSGASTNGV
FT                   LTRSFYKYVYNVIDSTYYVAITSIGYNNVKAQRILDLLQKNTDGEVIDVLVTIDNILYG
FT                   QTTFDSNITLIKDMDSQEEKIHEMMMKNKSKELIQKQKEFQKRPVSDIDRELERVKNLE
FT                   IEMRNESIQQLKSIVKTNSNPVKEKRRALETSLSPVFIVFKERLRMEIDKENNIKSGEV
FT                   QGDMSITIKEEEYRDIEIKLGNVGKDVKFSPNLNKSMSGEGILRCEKGFPIEKNVALVK
FT                   WKSSDVREAPITVTFWPSETGLNVYQIMFEYTAECNMKDLSIFFSKSKVSNVSINGPAR
FT                   ERDSHIEWNIGDVEKGSSDTLEFSCTCADPSEVFPLEIYFTSDFVFTNLFVERVVRKGE
FT                   EIDEVEIKKVFEVDKFSVVDE"
FT   gene            <29178..>29651
FT                   /locus_tag="Eint_080270"
FT   mRNA            <29178..>29651
FT                   /locus_tag="Eint_080270"
FT                   /product="ribosomal protein S15"
FT   CDS_pept        29178..29651
FT                   /codon_start=1
FT                   /gene_family="HOG000111561" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080270"
FT                   /product="ribosomal protein S15"
FT                   /note="similar to ECU08_0350i"
FT                   /db_xref="GOA:E0S8G9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8G9"
FT                   /protein_id="ADM11963.1"
FT                   /translation="MSETNEIENVEREDDISKKKRTFRRYTYRGVPVEELEKMAFSEVA
FT                   KLFPSRLRRKIRRGLSSREVQLIKDCIASKAACSSTLEKPEMVRTQARSAIIWPAMIGA
FT                   LVGVHVGNGYLPIEIKPEMIGYTLSEFAPTRVIPKHGRPGIGASSSSKFVPLK"
FT   gene            <29722..>30822
FT                   /locus_tag="Eint_080280"
FT   mRNA            <29722..>30822
FT                   /locus_tag="Eint_080280"
FT                   /product="hypothetical protein"
FT   CDS_pept        29722..30822
FT                   /codon_start=1
FT                   /gene_family="HOG000149924" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080280"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0360"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H0"
FT                   /protein_id="ADM11964.1"
FT                   /translation="MSKKATGDADESDFSYEYTSSDSFETVSEEISEYEKEYFGDISEE
FT                   AGAESEEKAAWEDSDDDPGIREDHKKTVTWLDGKQCKKQIEVRKKKVRFEYEKNLFLSK
FT                   CKIKLAKAHGEYLVVVDTYNNIYILKDFKIHKTLWIELFGISDFIYTGERILFSSHKQS
FT                   NLKEVTFDGDVRNISIKSVEGIKKMISIGDFIYTIGKKLILLNSSYEVVEVMEGEFMDI
FT                   AVSEEAVYAMGCGGDIVMLTPDLQILRKESFEDKFDFHSIYFFANQVFIGMGMGVKVLD
FT                   KDMKPVKEFKNLKNGVTGLTGHREYVIYGSDYTNSLKIILPGLKCFNKFPFNAISIPSI
FT                   NSLESDGKNIVVCSGRSVSILRMKVE"
FT   gene            <30909..>31340
FT                   /locus_tag="Eint_080290"
FT   mRNA            <30909..>31340
FT                   /locus_tag="Eint_080290"
FT                   /product="60S ribosomal protein L26"
FT   CDS_pept        30909..31340
FT                   /codon_start=1
FT                   /gene_family="HOG000216571" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080290"
FT                   /product="60S ribosomal protein L26"
FT                   /note="similar to ECU08_0370"
FT                   /db_xref="GOA:E0S8H1"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014723"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H1"
FT                   /protein_id="ADM11965.1"
FT                   /translation="MKNLRRQKTSSRRKQRKAHFACNIGEKIIRSSARLSHELRKEYGF
FT                   RTFPLKSGDTVLVKGGKFDGKEGVITSINYEDYKVYVEGCFVTKNDGTNALVPIYPSRL
FT                   TITKFFLGEGRDQQLERKKKAREYNMEILRKKQEEVATN"
FT   gene            complement(<31431..>32075)
FT                   /locus_tag="Eint_080300"
FT   mRNA            complement(<31431..>32075)
FT                   /locus_tag="Eint_080300"
FT                   /product="cleavage stimulation factor"
FT   CDS_pept        complement(31431..32075)
FT                   /codon_start=1
FT                   /gene_family="HOG000149325" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080300"
FT                   /product="cleavage stimulation factor"
FT                   /note="similar to ECU08_0380"
FT                   /db_xref="GOA:E0S8H2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H2"
FT                   /protein_id="ADM11966.1"
FT                   /translation="MKSGCSIFVGNIDFEVPEERIIEELGAVGKVVSFRMVYDKTTGKS
FT                   RGFGFCEYESPLIVEKALQNLKISFNGRPVKINYAENDMPAKAKEPDNQVPEIDNLISV
FT                   LDNMDKDNLKEVLFYLRKLALDQPSYLRELLNKNSSLVYAIIHAILKLKLVDPGAIDEV
FT                   LKESFDLSKQKMQILERICSISEDDLCFFPEDVRNKIKKARAMVLKSRADK"
FT   gene            complement(<32162..>32557)
FT                   /locus_tag="Eint_080310"
FT   mRNA            complement(<32162..>32557)
FT                   /locus_tag="Eint_080310"
FT                   /product="Hit-like hydrolase"
FT   CDS_pept        complement(32162..32557)
FT                   /codon_start=1
FT                   /gene_family="HOG000061063" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080310"
FT                   /product="Hit-like hydrolase"
FT                   /note="similar to ECU08_0390"
FT                   /db_xref="GOA:E0S8H3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H3"
FT                   /protein_id="ADM11967.1"
FT                   /translation="MEECIFCTLYQKDANIIYETDTSFVLMDRYPLSKGHFLVIPKAHH
FT                   PYFHQCRPEELSDVLGVIGHLVKKFGLEKYNILQNNGNHQSVSHVHFHVIPFVSSSERL
FT                   KISWEAKPISDNEYLEEVQEAKLKISQ"
FT   gene            <32620..>34167
FT                   /locus_tag="Eint_080320"
FT   mRNA            <32620..>34167
FT                   /locus_tag="Eint_080320"
FT                   /product="putative methyltransferase"
FT   CDS_pept        32620..34167
FT                   /codon_start=1
FT                   /gene_family="HOG000149324" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080320"
FT                   /product="putative methyltransferase"
FT                   /note="similar to ECU08_0400"
FT                   /db_xref="GOA:E0S8H4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H4"
FT                   /protein_id="ADM11968.1"
FT                   /translation="MPKREYMEYYKRTLGMDGGDFDEFHRFSERDLAYAFRITNTPLAG
FT                   MIRSKIEKHPFVRKIKYLEDVYEFHKKKEKDDEYREFSKFLVNQTSIGLIQRQEIVSMI
FT                   PVSLMELKKDSKVIDMCAAPGSKTKQILDIVTNGLVIANDSNGKRLKVLVSETSKKPNG
FT                   SLIISKHDATIFPNVYEGGKLVRFDRVFCDVVCSSDGTIRKSPGILEGWKLSRTTGLFN
FT                   TQFRILKRGCNLVAEGGLVSYSTCSLNPIENECVVQKILLEGEFELVDFRNDPRLVPFP
FT                   TCGDGTRLVFREGLRKWGTEDLIFKNPDYRPSDVDVGLEKCIRLYPHDQDTGGFFIAIL
FT                   RKKRNFGEEINTKEVSNASFHHFMFLSKSEKEEIFKTYSIYIDGELYKKRKSSSTISTV
FT                   SSIAAKVLSGNPVLNVISAGYRILEKSGLSNADFYLKNLFHRGEGLECSLKISMDQFKL
FT                   LLNETFVSNDLLGFEHIGLAIARIEVIGITLCGYGSHTSFTLFMNNNLRRALKDLVL"
FT   gene            complement(<34233..>34628)
FT                   /locus_tag="Eint_080330"
FT   mRNA            complement(<34233..>34628)
FT                   /locus_tag="Eint_080330"
FT                   /product="histone H2B"
FT   CDS_pept        complement(34233..34628)
FT                   /codon_start=1
FT                   /gene_family="HOG000112844" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080330"
FT                   /product="histone H2B"
FT                   /note="similar to ECU08_0410"
FT                   /db_xref="GOA:E0S8H5"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H5"
FT                   /protein_id="ADM11969.1"
FT                   /translation="MAKSARHVTGKAPGTSLDGGDKKKSKKKSSSMCVGGMFKSAVKRI
FT                   SREVSPDNNIMLTSNSIQVLCGISFDFVDTVADLAGELARKVGKQTVGSDDIVSAFEIL
FT                   LKGELRKLAIREVHNALSKSQAKSRGK"
FT   gene            <34777..>36039
FT                   /locus_tag="Eint_080340"
FT   mRNA            <34777..>36039
FT                   /locus_tag="Eint_080340"
FT                   /product="hypothetical protein"
FT   CDS_pept        34777..36039
FT                   /codon_start=1
FT                   /gene_family="HOG000149923" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080340"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0420"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H6"
FT                   /protein_id="ADM11970.1"
FT                   /translation="MFKHDFHDPYKMEEYFRISDRTRTLEHQYTDLLTRRLRFETLLVE
FT                   EDYSNLLAAHEEFISKAKTSEDNYKEQIDGLKAMVDQLNHDMAEREDNIRRLMEENINL
FT                   VSMVQRLEEKSKEDQGVRKGLNELVEDRLWEAQDFKKMDEMHRIVKSVEDELRSNLSKL
FT                   QEDCIRYRGDTERMSSEIEKLKLKNAEHIEKMKEIKESRSVLEDKMKKLEEENNRLMRE
FT                   NIHSDELRRFISEKDEIISALKENMRQKSEVIEMQKKMIASSPKESRVVLSNDVYNVFE
FT                   EDLKAEESDGELELGDGYGTKEQLWNDISSQPKPVGKSAKSLGSGRKKTAAPKREKTRK
FT                   VPPKLTATIDRSNARENADNKISGKLLDIQEAPKASEPSKKLFTPGFLLKPENSSYFAD
FT                   LTFNNSSPIIKKDQPNLPKKR"
FT   gene            complement(<36134..>36961)
FT                   /locus_tag="Eint_080350"
FT   mRNA            complement(<36134..>36961)
FT                   /locus_tag="Eint_080350"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(36134..36961)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080350"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0430"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H7"
FT                   /protein_id="ADM11971.1"
FT                   /translation="MKELDWARQIQENIEELHEKNEKNIKEFHVKVRETLLDEDGEKSS
FT                   FFICRIGDRVNIHWKFDIDYDIIFSFILILKSIMLGIFKMESKYFSFCILMTAIVFSWI
FT                   EAVERLHASYRRNPDIRKLLEFKNLISVFQIAFGIILTTHLLYIQEEESSKRDARIYSL
FT                   MVSLVYLFRCTWKSSFFLQSDDIYQFLYPTALTIMFFMAFLSWRNKTMLYDIPCALISI
FT                   LIALKNYVGKPVSLEKEGINLLSIIFCSLFMLGILATVYTASGFFKIFIPRLF"
FT   gene            <37030..>37581
FT                   /locus_tag="Eint_080360"
FT   mRNA            <37030..>37581
FT                   /locus_tag="Eint_080360"
FT                   /product="hypothetical protein"
FT   CDS_pept        37030..37581
FT                   /codon_start=1
FT                   /gene_family="HOG000149922" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080360"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0440"
FT                   /db_xref="GOA:E0S8H8"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H8"
FT                   /protein_id="ADM11972.1"
FT                   /translation="MNKEDDRDVTGVGKSDPAENRSRQKRARGGEGRGEKRDQSPEEIL
FT                   ELSRSLRKRMQRILREDNANNQKGLPAIGKMESVEEISDILMNKGLQESLLDEGILNEI
FT                   KGWLEPLPDKSMPNIKVKKRLLDVLKNMRIHKEHLVTSGVGKIVYFYTINPKEAKEIKS
FT                   MAKTLVQKWTSEIFKPENDD"
FT   gene            complement(<37645..>38004)
FT                   /locus_tag="Eint_080370"
FT   mRNA            complement(<37645..>38004)
FT                   /locus_tag="Eint_080370"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(37645..38004)
FT                   /codon_start=1
FT                   /gene_family="HOG000149921" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080370"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0450"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8H9"
FT                   /protein_id="ADM11973.1"
FT                   /translation="MILFKRISPCLSMNRKRTEGVERQKRYNEKEIVKKFLVSEKGIAF
FT                   LVDHTNRTSSEEDVRLNEKLIRKEVDNLIDYYFAWIHGLPVRKSMNMNRYEFIKYLEEF
FT                   CMKNDVSNLFEFLFI"
FT   gene            complement(<38027..>38569)
FT                   /locus_tag="Eint_080380"
FT   mRNA            complement(<38027..>38569)
FT                   /locus_tag="Eint_080380"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(38027..38569)
FT                   /codon_start=1
FT                   /gene_family="HOG000149920" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080380"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0460"
FT                   /db_xref="GOA:E0S8I0"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I0"
FT                   /protein_id="ADM11974.1"
FT                   /translation="MEKELYGLYDRQIRLFGKDTQKSIEESHVVVVQGPPYIMAGEKRI
FT                   NDVGGEILKNLVLLGVRKITVNADVLVSFKKIFANKIEKINEEVKVTTIDQEKDEEIWA
FT                   RCTQAIFIDMKMRTNCPSIYVCSRCMAFHPLDQEHVCREYDSVSVAHDCLLGAIIVQEW
FT                   VKKLQKRSFVDEFRLEI"
FT   gene            <38626..>39147
FT                   /locus_tag="Eint_080390"
FT   mRNA            <38626..>39147
FT                   /locus_tag="Eint_080390"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT   CDS_pept        38626..39147
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080390"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="similar to ECU08_0470"
FT                   /db_xref="GOA:E0S8I1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I1"
FT                   /protein_id="ADM11975.1"
FT                   /translation="MSEKKKQDVYFDVYANDESLGRIVMKLADDIVPKTAENFRALCEM
FT                   PEGKGYKNSTFHRIIPGFMIQGGDYTAHNGTGGKSIYETGKFPDENFVLKHSKAGILSM
FT                   ANCGPHTNGSQFFITLEETPWLNGKHVVFGEVVEGMDVVHKIAKYGSQTGQVRKGYKIE
FT                   IRDCGVLKEN"
FT   gene            <39205..>39840
FT                   /locus_tag="Eint_080400"
FT   mRNA            <39205..>39840
FT                   /locus_tag="Eint_080400"
FT                   /product="hypothetical protein"
FT   CDS_pept        39205..39840
FT                   /codon_start=1
FT                   /gene_family="HOG000149919" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080400"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0480"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I2"
FT                   /protein_id="ADM11976.1"
FT                   /translation="MEKFSKYNDPLSGINPFVEIKKKPLSILDYLKAILKIPLVPLLLG
FT                   TRINVVQLLVRIKSNKIERPKVLAANASSLLDIFVLKYLTGIKNFYYVTESGFVDARTG
FT                   HFCVKTIEPCVLFPEGCRTNNRAVLQFARDIKVDHVCGIKYSKECIDMYGNPIWFILRL
FT                   LASGGTVDINFRKSNDLSDICKLSGLPQVKWASKDKDRFVEEFVKKSE"
FT   gene            complement(<39846..>41294)
FT                   /locus_tag="Eint_080410"
FT   mRNA            complement(<39846..>41294)
FT                   /locus_tag="Eint_080410"
FT                   /product="cysteinyl-tRNA synthetase"
FT   CDS_pept        complement(39846..41294)
FT                   /codon_start=1
FT                   /gene_family="HOG000245250" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080410"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="similar to ECU08_0490"
FT                   /db_xref="GOA:E0S8I3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I3"
FT                   /protein_id="ADM11977.1"
FT                   /translation="MTMDRTLKLYNSISKTSEVFIPRRDNEVKMYICGPTVYDSPHIGH
FT                   ARTYVMFDVIRRVLSDYLRYNVNFVMNITDIDDKIIVRANETGVSMDEVTRKYTEEFFE
FT                   DMKALNVRPPSFVTFVTSYVDKIIKFIEKLEVNGFAYESEGSVYFNLNKYQDKHGYPLF
FT                   KNKDGINTEGDENKDKRNPCDFVLWKKSKENEPRYESKWGYGRPGWHIECSVMSSDILG
FT                   EDLDIHAGGIDLAFPHHENEIAQCQAYFMKEPWVKCFLHTGHLNIDGLKMSKSLKNFTT
FT                   IKEALEVISPRQLRILFLHHQWNKDMNYEREHLKFAESIEKKIFNFMSVAESMRKNTLE
FT                   FKTLEDADREVLGELKNVQKVIHNSILDNIDTPTVMKKIVEMINFTNSRMKDISSSTVL
FT                   VVKDYIKEIMEVFGLNEVEAQTSSKEDSIAQLLGDFRENIRRMARQKEPYSSFLKKCDW
FT                   IRESIKDHGYIIEDNNEGSILRKK"
FT   gene            complement(<41563..>42288)
FT                   /locus_tag="Eint_080420"
FT   mRNA            complement(<41563..>42288)
FT                   /locus_tag="Eint_080420"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(41563..42288)
FT                   /codon_start=1
FT                   /gene_family="HOG000149918" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080420"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0500"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I4"
FT                   /protein_id="ADM11978.1"
FT                   /translation="MIFFISSVILESMGDDSSSEIVLAERVDHDSDEVSIVEIVREGRK
FT                   LPNERRKGSGRAESSRKGRKRAVEENPNDEDDRKRLKDDSYRGKGLCRVTVVDQGLERI
FT                   FHLKSTDTLEDIYKVYHREDSPIKMKYKSVPISRHLTLEEIGFDESHWIMIHRQGQTSR
FT                   EAGIRLKINVDYAKVVELSVSKELSVEGIFERLGEMGFEGDLLVRNGVVLNPKASTADV
FT                   TRPGDIIDLVSKDEIVYRG"
FT   gene            <42263..>42646
FT                   /locus_tag="Eint_080430"
FT   mRNA            <42263..>42646
FT                   /locus_tag="Eint_080430"
FT                   /product="hypothetical protein"
FT   CDS_pept        42263..42646
FT                   /codon_start=1
FT                   /gene_family="HOG000149917" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080430"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0510"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I5"
FT                   /protein_id="ADM11979.1"
FT                   /translation="MTEDMKKIISDVEVSSNQPQAWCMFDSNEDTCWFSGHGGQQDINI
FT                   YLKQAVYVQRVRILFQRGFHCTKGKGCMILNNSRDYKEIEFQDGGSTGSLDINQTGDHI
FT                   KIVLERGADMYGRYCIYKLSFDL"
FT   gene            <42678..>43940
FT                   /locus_tag="Eint_080440"
FT   mRNA            <42678..>43940
FT                   /locus_tag="Eint_080440"
FT                   /product="polyadenylate binding protein 2"
FT   CDS_pept        42678..43940
FT                   /codon_start=1
FT                   /gene_family="HOG000149323" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080440"
FT                   /product="polyadenylate binding protein 2"
FT                   /note="similar to ECU08_0520"
FT                   /db_xref="GOA:E0S8I6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I6"
FT                   /protein_id="ADM11980.1"
FT                   /translation="MRNILPFRMRIVVKNLPESTTKEEIEKEFSKHGKITDVFMVNNEQ
FT                   GKFRRICFIGYIEEKDGMEAIKYRDGSMFKNHKIRCETTKEDSYETSESEERMIRYSRK
FT                   IFIRNIPADADERFISDVFKEYGEVEEVGLLPRHEGKGAYVKFSKGECALEAYRKVKLI
FT                   GGVKPRMRPWKDRGEKREHEHYNTLFFNFESVVKKICESERIGIKDLVDVNDKDLGARM
FT                   ARAETHLVQETKEFLENNGIYLDHLTGSVDRKKLIVRNMELMKCLDLVDNGCKISIAPS
FT                   KCLALLKFDSEEDAKRCYKKLSLRRMREHVIYCEYAPICNAPSKREEPPKEHTEKKSRK
FT                   GTNKLLIRNVPFQASKEDVRKIFDSFHVVNVRIPVKREGTSRGFCFVTFQSPEEVSAAI
FT                   EYFGSSTHLYGRRLVLEKAKS"
FT   gene            <43987..>45600
FT                   /locus_tag="Eint_080450"
FT   mRNA            <43987..>45600
FT                   /locus_tag="Eint_080450"
FT                   /product="sulfate permease-like protein"
FT   CDS_pept        43987..45600
FT                   /codon_start=1
FT                   /gene_family="HOG000149916" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080450"
FT                   /product="sulfate permease-like protein"
FT                   /note="similar to ECU08_0530"
FT                   /db_xref="GOA:E0S8I7"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I7"
FT                   /protein_id="ADM11981.1"
FT                   /translation="MKSVMKTAKQKILSLISSSFLLFTMTSLDLLSFGTKLLSTENSHN
FT                   KNIGNVSAMMFLYSTIASQFVFGLFSKLGGIAAGAIFEAQKDTRRIHKVCFKMSSTFGE
FT                   EISTTYACIFLSTILFAFFSYVLKTLKIGSNLKYIPIPALYGVMVSIGAMSIECGFEEV
FT                   YSITWKYVHVCLAVTIVLALLAVVLDILFPEYFLMIPMFSFSIFAVFYLVFLAAGKDIE
FT                   WMKSVGLIPKAGGIDLNPLETLKHLKIENIKIEAVKANLMNILGLSLFNLVHIAVNVPS
FT                   FAETFGINADLNKELGVQSIGNIVSAFFGYPTYFICSTSIYFNKSGGRSRIHSFVGAIA
FT                   MSSLLVIGGPIRERIPTILSGTIPMFIGFGFLYSYLWTPILKLSWVDLLTLVMSSVVSW
FT                   FLTPIFGLVFGMLFNSFFVLWSHLFTTKVFHSKLGETIRISRETTEEMYRVVDLGPLTS
FT                   FGNLSESVKAMKVLCKENVLFDLRSCMYFGANANMALEEVAGAIEENGNQVLMIGSPQN
FT                   LYTHLFSKYMADLPESELSR"
FT   gene            <45755..>46597
FT                   /locus_tag="Eint_080460"
FT   mRNA            <45755..>46597
FT                   /locus_tag="Eint_080460"
FT                   /product="hypothetical protein"
FT   CDS_pept        45755..46597
FT                   /codon_start=1
FT                   /gene_family="HOG000149915" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080460"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0540"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I8"
FT                   /protein_id="ADM11982.1"
FT                   /translation="MIYNNPVSKMMMKEGKNITNLLLGFDCIFAFLSIIGCTLGILGLF
FT                   VDRLKTISQHGLIGIFALASLGLLWSFANSLHKKIESPFFEKKGGFLNPAILLSLIEMV
FT                   VMLLCIKAVLFYPSSCSLTCEDSKVCKFGFLGAIFMPYVFNECIRQLLGSGKSRKQDTV
FT                   ILGILILGCLVMAGLIGLDIKMKKNYTSIGIFSIGVLSLLVRLAFIGENENTESSDDSE
FT                   DEGLKEDPKYIGMVTTLMLVTLIFARSHRILFSKDGTTLFDSLKSLNLLGLKAGSQAS"
FT   gene            complement(<46701..>46967)
FT                   /locus_tag="Eint_080470"
FT   mRNA            complement(<46701..>46967)
FT                   /locus_tag="Eint_080470"
FT                   /product="U6 snRNA-associated Sm-like protein"
FT   CDS_pept        complement(46701..46967)
FT                   /codon_start=1
FT                   /gene_family="HOG000223549" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080470"
FT                   /product="U6 snRNA-associated Sm-like protein"
FT                   /note="similar to LOC581143"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8I9"
FT                   /protein_id="ADM11983.1"
FT                   /translation="MGLSLGKYVNYRVKVKMKDGRWMEGTMLSVDEDVNVVLDDSEEFR
FT                   NARGSKEPRRRVLGLVMARGDFVMDIEILSKPEKGEMELQQNL"
FT   gene            complement(<47004..>48695)
FT                   /locus_tag="Eint_080480"
FT   mRNA            complement(<47004..>48695)
FT                   /locus_tag="Eint_080480"
FT                   /product="arginyl-tRNA synthetase"
FT   CDS_pept        complement(47004..48695)
FT                   /codon_start=1
FT                   /gene_family="HOG000247211" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080480"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="similar to ECU08_0550"
FT                   /db_xref="GOA:E0S8J0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015945"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J0"
FT                   /protein_id="ADM11984.1"
FT                   /translation="MFNELFKKVVEQVSNVSKFSPEEIERCMEKSCQPKKPNVTLFLIK
FT                   ISSSPQEDAKELHEALEKASIELIQNLAIRGPSVCFDINKKAILKDVLGYIQSNKETFG
FT                   NNSIGKGKRMVVEYSSPNIAKIFHIGHLRTTILGQFIVNLLKASGYETVSMNYFGDWGK
FT                   QFGFVLLGYSKYGSEEELEKDPLKHLFNVYVKISADAKENPEVDLEAREIFRKMEEEND
FT                   EWCMNLWKRFRELSVEKYKSLYERLNVRFDVYSGESLYNKKGKEIVEAYKEVKTDEDGS
FT                   KVFDLGKNRKVLVMKNDGTTLYITRDIAAAIERLEKYSPEKIIYVVSTEQNKHFEDLFK
FT                   ILGILGHDESKFLHVSYGLVAGMSTRAGKAQFLEDIIQESTSVMKKVMMSDSTKNSFTM
FT                   DEIDQTAEVLAISTLLVMDFTARRVKGYEFDIEKRARNTSGTGPYLQYAHCRLKSIESR
FT                   NSDVDYSDINTIDFSLIHVPEVFNLVYKLLWFEHAVEKCLDDYEPSRIVTYLQDLASCV
FT                   NVAINSLKVLGVEKELARARLLVLSSARIVLHNGLKILGATPLNKM"
FT   gene            <49203..>49967
FT                   /locus_tag="Eint_080490"
FT   mRNA            <49203..>49967
FT                   /locus_tag="Eint_080490"
FT                   /product="putative zinc finger domain-containing protein"
FT   CDS_pept        49203..49967
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080490"
FT                   /product="putative zinc finger domain-containing protein"
FT                   /note="similar to ECU08_0560"
FT                   /db_xref="GOA:E0S8J1"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J1"
FT                   /protein_id="ADM11985.1"
FT                   /translation="MDGRVLFNVSDLADIFRCFGTFVSSSQIHEYMESAGYIERLEQLK
FT                   DFFGKDCLEVVCSSVLNSKLLERIESSADGGKGSGHLDDTRIEFTGSKFSFGEYKFESQ
FT                   KEDQDLDRFRNVNELYPFNCQWTDNIMDGILKNIYTSDGKKAEDGCMKKGSDVVRAGSR
FT                   GRHMKVSGSLKDRPFVCTYNDCKRAFKRYEHLKRHNLMHTGERPHKCRFPGCSKAFSRS
FT                   DNLSQHYKVHTTTSEIHAKSYESYRYLNKEFN"
FT   gene            complement(<49974..>50408)
FT                   /locus_tag="Eint_080500"
FT   mRNA            complement(<49974..>50408)
FT                   /locus_tag="Eint_080500"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(49974..50408)
FT                   /codon_start=1
FT                   /gene_family="HOG000149914" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080500"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0570"
FT                   /db_xref="InterPro:IPR007590"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J2"
FT                   /protein_id="ADM11986.1"
FT                   /translation="MKSALNKKKSSKPKGLPTRLATPFTIKCLSCGAYIYKNKRHNATR
FT                   EIALGKDYLGVESHRFHIKCTGCSKILSIKTDPKNGVYITEDGCVKVEEEPGIQEEAED
FT                   TSMKLKKESAMKDEINRLRMQANHVNSSTSAFGSKDKLEK"
FT   gene            50480..50551
FT                   /locus_tag="Eint_080510"
FT   tRNA            50480..50551
FT                   /locus_tag="Eint_080510"
FT                   /product="tRNA-Cys"
FT                   /note="tRNA Type: Cys, Anti Codon: GCA, Cove Score: 72.84"
FT   gene            complement(<50802..>51341)
FT                   /locus_tag="Eint_080520"
FT   mRNA            complement(<50802..>51341)
FT                   /locus_tag="Eint_080520"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(50802..51341)
FT                   /codon_start=1
FT                   /gene_family="HOG000149913" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0580"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J3"
FT                   /protein_id="ADM11987.1"
FT                   /translation="MKIIKSLRFGSNSLTPKLLAIAGIMMVIIMCMMMFPSPKEINSKI
FT                   ETPNDEFQTRTYLNASKEMREELKIKREDFEGFYFTLRLINPMRDRVVMIVNGTKIKTI
FT                   VSSKYIIRLVETIDNEEKSPFYFIFLSYLIGSLYFPAGTINFISNSEGVWYNGVCYTGH
FT                   PSIFRRICLLLIKDIK"
FT   gene            complement(<51460..>53214)
FT                   /locus_tag="Eint_080530"
FT   mRNA            complement(<51460..>53214)
FT                   /locus_tag="Eint_080530"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(51460..53214)
FT                   /codon_start=1
FT                   /gene_family="HOG000149912" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080530"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0590"
FT                   /db_xref="InterPro:IPR007528"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J4"
FT                   /protein_id="ADM11988.1"
FT                   /translation="MDVLLKKKDHLEYRLEQFKQKENDRIEYRNQLLEQAQKERSAIEA
FT                   LEKEINGMVSALLEKKEGFMELKDKVSKYRKDVLRSIKGEFESLYREIFEEASRIHPST
FT                   SFAAFEEFTKIKGLIKRNVFRNLGRRLERFYAEEKGKLREYILSQMEKKLQDKQKMHEF
FT                   VFNMKFLRKYEEYFCEDTMIDFLYERISKGFEYHFMSNRDTNRLDKPEWFLDFILLKLR
FT                   ESRGILDIYLELSKKNKRDGEGNGEFRDLVVRTGNLIKEKIEEISGSSSKQKRNLALHL
FT                   GTQVMKFRYEVYHSYNIVLEFPSLGSVLCQEQKKYVRERLVKIHEARHVKWFGGYKELS
FT                   RECLLYIYRFRTLDPVFGMEDAIKIIVDYNRVFLESLRYINRQEVRVLCWVYSEFERLK
FT                   TFLLEQESEVVFDSRLSIENKTMVVKEEGGNPQDMLHEAVTGSLERISDFNSENLKLIM
FT                   SLAMNDTAERLRPIRKFFHDPGMVFRNLVVDVERCLEDYKECLSYNAIKHSVKEKIDGF
FT                   VLEEIVLKHRLESSEYFELVGMVKKLKEVFEGEEWKSEMGLRCVRDIFEGREPGDGPLS
FT                   KMVQGLYE"
FT   gene            <53399..>53920
FT                   /locus_tag="Eint_080540"
FT   mRNA            <53399..>53920
FT                   /locus_tag="Eint_080540"
FT                   /product="ribosomal protein L18A"
FT                   /note="L20 in yeast"
FT   CDS_pept        53399..53920
FT                   /codon_start=1
FT                   /gene_family="HOG000149322" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080540"
FT                   /product="ribosomal protein L18A"
FT                   /note="L20 in yeast; similar to ECU08_0600i"
FT                   /db_xref="GOA:E0S8J5"
FT                   /db_xref="InterPro:IPR002670"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J5"
FT                   /protein_id="ADM11989.1"
FT                   /translation="MTNPITKEYRIHGSAMPTEDCPRPQVFVATIFTKNHVFAKAKFFK
FT                   ILEKKYKIKASRGLIINCEQIPEPSFKEVQNYGVRFVYRSRSGIHNGYKECRAISRCGA
FT                   VDYVLRELAGRHKLKRSAVDIIGVEVVPVEQLKRAKTMEFADENVEFPVFTKILNTKSL
FT                   LIPAEYNPSE"
FT   gene            <54017..>56197
FT                   /locus_tag="Eint_080550"
FT   mRNA            <54017..>56197
FT                   /locus_tag="Eint_080550"
FT                   /product="chromosome condensation condensin complex subunit
FT                   G"
FT   CDS_pept        54017..56197
FT                   /codon_start=1
FT                   /gene_family="HOG000149321" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080550"
FT                   /product="chromosome condensation condensin complex subunit
FT                   G"
FT                   /note="similar to ECU08_0610"
FT                   /db_xref="GOA:E0S8J6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J6"
FT                   /protein_id="ADM11990.1"
FT                   /translation="MTTAEACNLERMQLIFNEIQQCDTKRYSETLKEMVEMLTTQELFE
FT                   EFCKVINIILVCKRTSIPSRISNFLRRTFEDVSDVPKGAEFVLQVFCYLSKLAESKIAK
FT                   VRKNSLSLLRLLTETVGPEAIGNGFLERISERLFDKEKGVRKEALKVLSSYQGMELNPK
FT                   VRIVNLFKDIVRHDPSDEVRALALSLISIDQSTYGCITERCMDANESIRKMFYENCLLE
FT                   IDLKGLSQDRRILLMEKAILEREFDAKGLLIDAILAAYKLPSELKAMNESFYSRSSQRY
FT                   LETLLRGIFERVGCEKEFGYLLSEPSEENTFLSRVELLYIEEFFGRDDLQLPDLESFVT
FT                   VMYQSCLSVVESRDALEREVRVEAMKNLFKIARFYDFFNETSRKYILSAVYKLLGKNSV
FT                   EEVVEEAMQIASLVCDDDLNSFIGSIIKKNAKASPRVCLMVCKQVMKHIHPFGQLHEAI
FT                   IEEIVLPNLGLQETVAEILEVGFYYVLNKTHHAITQSLIHNIEADNKVLKMCVDLALSP
FT                   NGEELLSHVLRYIEKKLEDGESEDIIIPGSKIVLSKTKAPKELREKFIAFALERYYHTQ
FT                   DDHLKQYCSILFFELFSEDSSLLTSVFCGLLEALGSSCKVFIDQSLYWIGNSRYPNGSQ
FT                   LLFYNICVYLAGGYGKDQTKKTLLKVLERIEVLRCWDPRITKKILFCCPLMAKKLGGRF
FT                   NVSEVTGRLREIDDGVPISPEDLCDVRKDLEN"
FT   gene            complement(<56210..>58003)
FT                   /locus_tag="Eint_080560"
FT   mRNA            complement(<56210..>58003)
FT                   /locus_tag="Eint_080560"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(56210..58003)
FT                   /codon_start=1
FT                   /gene_family="HOG000149911" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080560"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0620"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J7"
FT                   /protein_id="ADM11991.1"
FT                   /translation="MSSRIYEVIKEEGSLEEQIKKILKMGVLADSSEILAYFLRKTMDV
FT                   FKEDPSIHHYLLNRIPSELITRFVPGLLSFYFSLLKDQKTNRRTERMVIDSIKHVLESA
FT                   ARLNDVAEARIHEFFYFRRGPMFEEIYKICAQKFKTSRRVFFISELLLLGYPLEDSDYD
FT                   AINEGIEEIFSLELIRKLLDREKYRNNEEIFEKLIQMYKKGEDVSDIILRIQETCGVVC
FT                   RVPELCVVNKETTRTVLDTNDLRKIEMFLRNATDVPLHVEVIGKYLELCDSPKQVLGSD
FT                   VWKRLNVRKVVSENYDELLEYAFNKLKTSPRILINLIGIEFRPKLEDFILQSIEFVSRC
FT                   SDAKDLSLYLYFLKVVVEKNFLRRSILRRIFDGLIYLDNEDYRVRCMKYEVLGELFVQY
FT                   SLLDKAIEHSRHLNESQKTWNVECTCSIPENIFERVDTRDVDEDNVNVLAAIAWDELTI
FT                   VPAEGELMAVSVFLKKIIDSTGMFYENRISKSNFILHLVDLHGISRFNETKRRLMDEFF
FT                   QLLGSIVRFSLSKKLLSKMFLISLDYFHIFDTSCLIRSIVRNDRYYCLFIFYNLAKNKE
FT                   KTLSKKLLEFLKKSLRESQES"
FT   gene            complement(<58026..>58871)
FT                   /locus_tag="Eint_080570"
FT   mRNA            complement(<58026..>58871)
FT                   /locus_tag="Eint_080570"
FT                   /product="DNA primase small subunit"
FT   CDS_pept        complement(58026..58871)
FT                   /codon_start=1
FT                   /gene_family="HOG000149320" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080570"
FT                   /product="DNA primase small subunit"
FT                   /note="similar to ECU08_0630"
FT                   /db_xref="GOA:E0S8J8"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J8"
FT                   /protein_id="ADM11992.1"
FT                   /translation="MGLDERLMKTYYRTLFPLDLIFKCLRIDENREISFGLGSGGYIRF
FT                   LTFKTAEEFRKKLLGIVPERIDVGAIYKDRPVKHNVPKVAGKELVFDVDLTDYPRECCT
FT                   EKLVCNKCLVLIKVAVRILDYSLRKEFGFKNVGFVFSGRRGMHCWVFDEAALELNDIER
FT                   GEIVRYYDTVVKKKVYSKEYEEILREYSFFLGDETFKESELFEKMYIRIDKEVTQKSKH
FT                   LIKMPFSVHPSTEIISVPIDPSSLDSVKLEDFPRLGDVLESPERLQPYLGIAEKWRGLS
FT                   "
FT   gene            complement(<58901..>59800)
FT                   /locus_tag="Eint_080580"
FT   mRNA            complement(<58901..>59800)
FT                   /locus_tag="Eint_080580"
FT                   /product="putative nicotinic acid transporter"
FT   CDS_pept        complement(58901..59800)
FT                   /codon_start=1
FT                   /gene_family="HOG000149319" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080580"
FT                   /product="putative nicotinic acid transporter"
FT                   /note="similar to ECU08_0640"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8J9"
FT                   /protein_id="ADM11993.1"
FT                   /translation="MWSKKKLEIFVVMSIVAAVMLSVLKVVILVNYKVGGLLMLISSFI
FT                   KMAISYLNMQSFDFKMKYTFIVASLSFLGGYLGVLSYYSKASSTSYVISSDLQYLFTAL
FT                   IAIIWNGTKYSYTQYIGLLMVLGGFLIEISSGESLSIPLHMFIGSLSGLFGAVSLAVFE
FT                   AKIKPTLVDFKKFWCYMTTYGFFLTLFSLFYMTEEALSQKSTYVKIVSSPGIYLVLLME
FT                   IVTTYLLSEISLFLDKVEKSTLLNVITGFSAIVTDLYLCREIDVQRFLAFSFTVIGVQV
FT                   FNFFWKESVQPFEQACTS"
FT   gene            <59985..>60518
FT                   /locus_tag="Eint_080590"
FT   mRNA            <59985..>60518
FT                   /locus_tag="Eint_080590"
FT                   /product="DNA-directed RNA polymerase subunit E'"
FT   CDS_pept        59985..60518
FT                   /codon_start=1
FT                   /gene_family="HOG000157370" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080590"
FT                   /product="DNA-directed RNA polymerase subunit E'"
FT                   /note="similar to ECU08_0650"
FT                   /db_xref="GOA:E0S8K0"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K0"
FT                   /protein_id="ADM11994.1"
FT                   /translation="MFYSAKIEDKIKISLNSNVEKKREVFEELKKKYVGRTLENTSMCV
FT                   LIERVIDVYEYKVYDEFLVAEVEFEALFFRFFKDEVGCGTILEQNEKGIRIGVSFFHNL
FT                   WAKKDFLPSVSEKAYVSDCGEKQLAWVWIYRENKLYFRRKSCIRFRVLHPEEKSSLVLC
FT                   GLNEAGLGPLEWWV"
FT   gene            <60777..>61646
FT                   /locus_tag="Eint_080600"
FT   mRNA            <60777..>61646
FT                   /locus_tag="Eint_080600"
FT                   /product="hypothetical protein"
FT   CDS_pept        60777..61646
FT                   /codon_start=1
FT                   /gene_family="HOG000149910" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080600"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0660"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K1"
FT                   /protein_id="ADM11995.1"
FT                   /translation="MKVQKIIELIKRSYDQPILFHRLHCHLAYILEKGNLLYEISDEWS
FT                   RILVLSATQSKDPNQGLERKILSFLKEIRPPVSSKESRLKLWIILYYLSSRSPTQVNHL
FT                   VLFELVSNFIGTSPFVDGLILSIFSRAVTCTSFGLESNKKLGNESIGHLLEIIKKKSLG
FT                   VLCRALALPCYINHKVEPPSLLDLVVENDAQTLIVLERVFFYAKYSKHVEFVKKIVPDD
FT                   AVFVSSLKEFISKSFRVSTKDGGGCQVADSVVDNLGILNEIKRAYEEARDKKRFVSRIT
FT                   EFVMELDK"
FT   gene            complement(61675..61747)
FT                   /locus_tag="Eint_080610"
FT   tRNA            complement(61675..61747)
FT                   /locus_tag="Eint_080610"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA Type: Arg, Anti Codon: TCT, Cove Score: 69.56"
FT   gene            <61818..>63122
FT                   /locus_tag="Eint_080620"
FT   mRNA            <61818..>63122
FT                   /locus_tag="Eint_080620"
FT                   /product="gamma-tubulin"
FT   CDS_pept        61818..63122
FT                   /codon_start=1
FT                   /gene_family="HOG000165714" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080620"
FT                   /product="gamma-tubulin"
FT                   /note="similar to ECU08_0670"
FT                   /db_xref="GOA:E0S8K2"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002454"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K2"
FT                   /protein_id="ADM11996.1"
FT                   /translation="MREVITLQVGQCGNQMGAEFWKTLCKEHGISNCGTLQDNRDLGDR
FT                   KDVFFYQSDDNVFVPRAMLVDLEPRVISQAPSFFNQENIFLSNEGGGAGNNWGHGYYMG
FT                   KTMGDDVVEVIQREAEGCDSLETFFLLHSIAGGTGSGFGSLLLERIREEFPKKIVQTYS
FT                   IFPNNDESSDVVVQPYNSMLTLQRLIENSDCIVVMDNSSLGRYTLDSLRIGTPTFDHIN
FT                   HLISTVMAASTSTIRFPGYMYCTHQSINSCLIPVDPLKFVAPSYTPFACDEMSRIVRKT
FT                   TCSDVMRRLLLPKTRLASYEQTKVQSVVSMLNILHGIEDPGEVSRTVMRFLDKGIVNFV
FT                   PWMPPSFNVALGKNIANNIMPSRISGLSLTNSTGISSVLSKISGQFDKLKKQRAFLDIY
FT                   KRFGVEPEMFDHAKEIVQKTLEEYRMAEMSTYLSH"
FT   gene            complement(<63158..>63658)
FT                   /locus_tag="Eint_080630"
FT   mRNA            complement(<63158..>63658)
FT                   /locus_tag="Eint_080630"
FT                   /product="vesicle coat complex subunit zeta"
FT   CDS_pept        complement(63158..63658)
FT                   /codon_start=1
FT                   /gene_family="HOG000149318" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080630"
FT                   /product="vesicle coat complex subunit zeta"
FT                   /note="similar to ECU08_0680"
FT                   /db_xref="GOA:E0S8K3"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K3"
FT                   /protein_id="ADM11997.1"
FT                   /translation="MSLFDVEGLVVASSQGEILYKKVFTKDEGVVEKIVEKTVRDRESI
FT                   AVFRDRIVMCKRLDEILLIIYSPMEVNEAFVGQAFDEFAAAFVDVVKTPTQERVWKKYD
FT                   QIVLLVAGFLYEGVIMLGKSDEMLSKLPKRNFEGVDGIKVPKGFASFLHRASRSLNIGN
FT                   NNK"
FT   gene            <63721..>64581
FT                   /locus_tag="Eint_080640"
FT   mRNA            <63721..>64581
FT                   /locus_tag="Eint_080640"
FT                   /product="WD40 domain-containing putative poly(A)+ RNA
FT                   export protein"
FT   CDS_pept        63721..64581
FT                   /codon_start=1
FT                   /gene_family="HOG000149317" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080640"
FT                   /product="WD40 domain-containing putative poly(A)+ RNA
FT                   export protein"
FT                   /note="similar to ECU08_0690"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K4"
FT                   /protein_id="ADM11998.1"
FT                   /translation="MHELNCVPQETITSVSYNKDILISLWSGELMLYSGVTFGCKGSVE
FT                   AEIPVTRAILTSDVVAGDIEGSVRIYDMSLNEKAKISSGVGGIQLLHEYKGSVVAGGWN
FT                   KKIVFVNGCVENVINTEKKVYCSDILNDVLLVGQQEYVVAYDLRTNSFFFRRQFNTVVR
FT                   SLALGPGGFFAGTTDGRIYYEDFEDKSRSYVFNAHYSISGDSKIFYPVNSIVVGKYLLS
FT                   GGSDGRVLRWKLEAKKTYKEIACDKVGVSGLCTAEEKVAIGFSYSHDRGEKEEMSCSRV
FT                   VLVDL"
FT   gene            <64653..>65153
FT                   /locus_tag="Eint_080650"
FT   mRNA            <64653..>65153
FT                   /locus_tag="Eint_080650"
FT                   /product="Rer1-like protein"
FT                   /note="Golgi protein involved in Golgi-to-ER retrieval"
FT   CDS_pept        64653..65153
FT                   /codon_start=1
FT                   /gene_family="HOG000163668" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080650"
FT                   /product="Rer1-like protein"
FT                   /note="Golgi protein involved in Golgi-to-ER retrieval;
FT                   similar to ECU08_0700"
FT                   /db_xref="GOA:E0S8K5"
FT                   /db_xref="InterPro:IPR004932"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K5"
FT                   /protein_id="ADM11999.1"
FT                   /translation="MDLKTLKQIYLDRLAPRPDVRWGITGVAFVLYCIRIWTTGAFYLI
FT                   TYCLGIYLLHALILFLTPKGEMIPDPFENIEDDDYVPEAIDNEFKPFIRNLPEFDFWMF
FT                   VTKTVGVALVGTYFDILDIPVYTPILVFYFIFMVGYTTKRLVAHMKKYNYNPFLQSKEY
FT                   YKK"
FT   gene            <65241..>67628
FT                   /locus_tag="Eint_080660"
FT   mRNA            <65241..>67628
FT                   /locus_tag="Eint_080660"
FT                   /product="hypothetical protein"
FT   CDS_pept        65241..67628
FT                   /codon_start=1
FT                   /gene_family="HOG000149909" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080660"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0710"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K6"
FT                   /protein_id="ADM12000.1"
FT                   /translation="MERIRLPLKRHKIEQEGKGWRGREQKKVDLKRFVEMFVNQALKEM
FT                   KEALGKFHSISEIVCRRELSVFFKQKAADFECLFLLISGVEYLKEANSNRHRMEKIKDV
FT                   DGEYVMMADRLAHLFGSFKSMIVPKSDVFTSLQTVYNSSYLLPSLVGDSTEHEVASFEE
FT                   INRITRMYLDKEDLSVYDSVVIDRGITVLSTRFFSFSLALCGEISRPEWKLINVRGDNE
FT                   VFNRHLLFGMPHQIDKISRFLRVYEAHTKARDIFLMVKRSSERIELSIKGHYKRFEVSF
FT                   HVFKMAVHVECSDINGKLFIEEDVFPSGKNVVESFESRVSEYLCRDGRNASFSFEKGFV
FT                   ALGDEEIQTFRSFTDLDVFLERKKENSSFYSFFEERFPCYRNHRTNMFGDRNVFIIENG
FT                   LFVCIRLVRFVDSHMEIKVIVGSCELVDFPSYTEVIMEEDDRGEIVGIINGGKVKQSTI
FT                   KTESLCKYFEKGMELLFLSYRLLPMINGKISVGEQILLNHRVKNTQIDIYIEKREEKFI
FT                   VTTSRFGARTATTSGDVHNCVAFALLLMDIFTSSKDSELLNVISIDLFKGTTLRISGLP
FT                   VSLKLDCSKSLKASPLAVNCGLRNSSILGALGLLYCFHGFFSNGLVPTASTPTSLIFVF
FT                   RHLFKGHVKVKMVDRTKYMVSLNGGRIKDALGGFGREISSMDTSFPRKLSSFYFKEKIG
FT                   LISDVARKSYKITASESEVSISTACGNFKIYIEDCRCKFQICSINTVEPSDQFIEAISE
FT                   YFGEAMSEGRDIPSCIKLLDSSEELKRLFENIESKRKGNYSN"
FT   gene            complement(<67716..>68777)
FT                   /locus_tag="Eint_080670"
FT   mRNA            complement(<67716..>68777)
FT                   /locus_tag="Eint_080670"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(67716..68777)
FT                   /codon_start=1
FT                   /gene_family="HOG000149908" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080670"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0720"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K7"
FT                   /protein_id="ADM12001.1"
FT                   /translation="MAKETLDLYEKSKGMPSKIRIVGGPNNLAYGEGDELDVLDANTVE
FT                   TFTLEEFKTIVLDCRSKNKDFILARVTTPDPDDQSVIYNFYYAASELNRILFRFESDRR
FT                   LLHRMKVRNPLNNMYILGQVYYYKVPPQEVDRALVEYFFIETKVEGKTTKKAFSQVFRH
FT                   KVEEASEDNKRCHKSRDSLDASDRSLKISSMEENPREIIEKIQKGTIAMPKSIPPERSV
FT                   MYSANYFASDDDFLMQPEIREYFRRNTLDADDDFLFEIDRTQNDFFALLETASEDENEE
FT                   VLGWKRVLTAHISMLVTLLTVCLVLGVGPQMVLVALPLAVVLIFSFIGSIFYILFCRRN
FT                   TFDTLAVNSIEEV"
FT   gene            <68979..>69572
FT                   /locus_tag="Eint_080680"
FT   mRNA            <68979..>69572
FT                   /locus_tag="Eint_080680"
FT                   /product="Rab5-like GTPase"
FT   CDS_pept        68979..69572
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080680"
FT                   /product="Rab5-like GTPase"
FT                   /note="similar to ECU08_0730"
FT                   /db_xref="GOA:E0S8K8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015599"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K8"
FT                   /protein_id="ADM12002.1"
FT                   /translation="MPGIKEDMKTYTFKMVVLGYYSVGKSSLVLKYVKGEFNPNEESTI
FT                   GASFLTKTVFTPEGSIKFEIWDTAGQERYNSLIPMYYRGAQVALIVYDITSVESFETAK
FT                   RWVEELSFEKPREFIKVLIGNKSDLEEDRKVEFQQGKEYADSQNLLFFESSAKTGKNIA
FT                   EIFNAIAEKVPKEEVKKNTKGFRLRDDYIKYLCC"
FT   gene            complement(<69585..>70304)
FT                   /locus_tag="Eint_080690"
FT   mRNA            complement(<69585..>70304)
FT                   /locus_tag="Eint_080690"
FT                   /product="MRP-like ATP binding protein"
FT   CDS_pept        complement(69585..70304)
FT                   /codon_start=1
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080690"
FT                   /product="MRP-like ATP binding protein"
FT                   /note="similar to ECU08_0740"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8K9"
FT                   /protein_id="ADM12003.1"
FT                   /translation="MVMVAVMSGKGGVGKSSISIMLSTAMSERGKTLLLDFDLCGPSVA
FT                   SGLGIKEKIYKGEKGLIPAKASENLYILSMALLMKESDSVIWRGPKKMSVLSMFYESAD
FT                   GFDNVVIDMPPGISEEHGFLVGKDISVLIATTPQNISLGDSSRAIDFCISNGIQILGLV
FT                   ENMSGYCCESCGNPTNIFGARGGERLAMEMGVRFICELKIDPLLCEALDEGKFLEKCGS
FT                   IESYIRLRRSVLEITNI"
FT   gene            complement(<70329..>70937)
FT                   /locus_tag="Eint_080700"
FT   mRNA            complement(<70329..>70937)
FT                   /locus_tag="Eint_080700"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(70329..70937)
FT                   /codon_start=1
FT                   /gene_family="HOG000149907" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080700"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0750"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L0"
FT                   /protein_id="ADM12004.1"
FT                   /translation="MDEIFIGRPSKREIDMYLLNREYSLLNNIGLRSEILKRGMAKRLE
FT                   ENKTELGFGAFKRRKPRKKKEAKLVEDGTIRKRKVSVGYQMRKGKDPLAKKDSNGHAKG
FT                   TKKKCMKEIVEKNTLKNSGYRYVVLVFDGESRCPEHISRRRKRKIKFQDRPNAKVHNIK
FT                   EFPSILLPTAKPRRLPVVKRKERVFVKKLASVNESEEIE"
FT   gene            complement(<70930..>73137)
FT                   /locus_tag="Eint_080710"
FT   mRNA            complement(<70930..>73137)
FT                   /locus_tag="Eint_080710"
FT                   /product="Rad1-like DNA repair protein"
FT   CDS_pept        complement(70930..73137)
FT                   /codon_start=1
FT                   /gene_family="HOG000149315" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080710"
FT                   /product="Rad1-like DNA repair protein"
FT                   /note="similar to ECU08_0760"
FT                   /db_xref="GOA:E0S8L1"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR020819"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L1"
FT                   /protein_id="ADM12005.1"
FT                   /translation="MSSSNPKMLLEYEKEALQTCDGQNSLLVMGGGLNIQGIILEVVKK
FT                   YLEKTYLVLLVNFNTEDESMLLRMESPFLHDVRTLPRTRRREKYLNGGVFIASSRVFLA
FT                   DMIDGTVDVEKIDCILVNHAETVTETSLESFISHVFRSKNKTGFINGFSESPVPLSLGF
FT                   SPLARKMKSLKMNKVVFFPRFHSSVEKSLKGDADVVEIKFKMSESRSHLQVILLEIING
FT                   LLKMAFRGPDREEVDAEAIIFGSIRKTFKQMNVLNSRIMEDLYDIRGLIFLLFSCDPGS
FT                   FYGYVKEIVKKQVELGKDSTWINLPISHVLIDGAREQFEEAIQKIEDIREQKEKRNEKN
FT                   ELESLLGLSDSKLRAFYTLNPKIKKLIEILQELGEASSIVLVSNRAVRNMILNVFVVFG
FT                   LVSVESIEKKENTVKILTHYEFKYYESSYENVIFVESGQDSVRKIERYRVMHPVKVFFL
FT                   MHSSSLEEQRYLNEIRREKTSFEKLIEERSRLPLQLDGEDVIDLEEHESGEKDYTVVVD
FT                   SRELRAELPFFLFRARNKICISTLPTGDYLIGPTICIERKSISDFISSLGTGRLYSQMS
FT                   MLCHRYPSPVLLLEFDGRPCLSDHYRYDQDTFKNSIAAKFALLLFNFGMLRVIWSESRL
FT                   FSTKVIRDLQRKEDVPSVSERHKMDPVLHEILLSIPGITQFNILKVRKCFKSLKDLIFS
FT                   SMDRLELTLGRENGVLIYNFFRQEGGGENKTKAKAGEEIDG"
FT   gene            <73220..>73534
FT                   /locus_tag="Eint_080720"
FT   mRNA            <73220..>73534
FT                   /locus_tag="Eint_080720"
FT                   /product="DNA-directed RNA polymerase II fourth largest
FT                   subunit"
FT   CDS_pept        73220..73534
FT                   /codon_start=1
FT                   /gene_family="HOG000195281" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080720"
FT                   /product="DNA-directed RNA polymerase II fourth largest
FT                   subunit"
FT                   /note="similar to ECU08_0765"
FT                   /db_xref="GOA:E0S8L2"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L2"
FT                   /protein_id="ADM12006.1"
FT                   /translation="MLAEARYLLEGQKERFRADFRSNASKIFRSTLGYLDEFCRIKDKS
FT                   VAEDLRTTFSGLGFSEVEIALLGSLFPQSVEEAKSLIPSLASKDDDTISHAVEKIQQLM
FT                   "
FT   gene            <73611..>74519
FT                   /locus_tag="Eint_080730"
FT   mRNA            <73611..>74519
FT                   /locus_tag="Eint_080730"
FT                   /product="8-oxoguanine DNA glycosylase"
FT   CDS_pept        73611..74519
FT                   /codon_start=1
FT                   /gene_family="HOG000149314" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080730"
FT                   /product="8-oxoguanine DNA glycosylase"
FT                   /note="similar to ECU08_0770"
FT                   /db_xref="GOA:E0S8L3"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012294"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L3"
FT                   /protein_id="ADM12007.1"
FT                   /translation="MEGKCWISLRTEEAIDLELTLFSGQVFSFKRTGEKEYTGVLGECL
FT                   VSFLQDGSRVLYKVLSGKRSPKEVEEDIFYFFTLDIKLKPLLEKWKVDSDGLLNGLRAL
FT                   RYDLIPTIFSFICSSNNNISRITRMVEFLYSKGEFIMKYKGIDFHRFPSLEELVSIEGE
FT                   LKAKGFGYRSSYICNAATYLQENYSKLQQRSRIREALVSIKGVGEKIADCILLIGVGEL
FT                   SAVPIDTHIFKHSKKMFRIHGKTLTRRAYGAVQELYKEKFGEYAGIAQLYIFKRMVDQA
FT                   KKRQRGIDRFGHLGMLDEKKK"
FT   gene            <74534..>75301
FT                   /locus_tag="Eint_080740"
FT   mRNA            <74534..>75301
FT                   /locus_tag="Eint_080740"
FT                   /product="hypothetical protein"
FT   CDS_pept        74534..75301
FT                   /codon_start=1
FT                   /gene_family="HOG000149906" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080740"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0780"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L4"
FT                   /protein_id="ADM12008.1"
FT                   /translation="MKWDVDKEYSTNEPQEEVKRVKRAIEGMDVKPMESGRVSLTAEEN
FT                   GVEGHDLNFKRQVKKKVNDYKYKTLYNVGKTKNPYALTRNSVVIAMEEELGVEILVKGS
FT                   YKPEELNGDTDDSDGLVYEISAPTPEILQEAMFKIPSMVKTVPVLPWTSSSILGRYVWK
FT                   NGTRYHSYRIFVDPDDLSGKMNEFRKDIEAVAADKSVDIAIRGKFSGHVEPCFGQEANE
FT                   PPYIQILTKTKKEIREVRKACREVISKHSEISG"
FT   gene            <75411..>76232
FT                   /locus_tag="Eint_080750"
FT   mRNA            <75411..>76232
FT                   /locus_tag="Eint_080750"
FT                   /product="hypothetical protein"
FT   CDS_pept        75411..76232
FT                   /codon_start=1
FT                   /gene_family="HOG000149905" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080750"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0790"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L5"
FT                   /protein_id="ADM12009.1"
FT                   /translation="MDSNVAEVVLKGRSRIVFGGEDSGLPLYTLDTEVVEAFTLERFKE
FT                   LIASNVKEGKDFVVGEVTTRDPPTGSIFKNYYAAVELNRILFCVEGRNNLLYRVIARNP
FT                   INNLEIEGKVLYYKITWKALSSAVEKRHSSKDEFLIKADYFANDEDLLFDPSVRRYFAK
FT                   NFADEEYFVHRLENMESPMVISEDPLEGYRDDKFGLKIILYTNIGTILVVFGMCILLGS
FT                   REAFFVAIAPLSMTLLFSILFLVLYALLFEAPEGLSSIFNFRKTRFRYESS"
FT   gene            complement(<76295..>76708)
FT                   /locus_tag="Eint_080760"
FT   mRNA            complement(<76295..>76708)
FT                   /locus_tag="Eint_080760"
FT                   /product="signal recognition particle Srp19"
FT   CDS_pept        complement(76295..76708)
FT                   /codon_start=1
FT                   /gene_family="HOG000154281" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080760"
FT                   /product="signal recognition particle Srp19"
FT                   /note="similar to ECU08_0800"
FT                   /db_xref="GOA:E0S8L6"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L6"
FT                   /protein_id="ADM12010.1"
FT                   /translation="MENKYFCLYPAYMDSSRALSEGRKYRKEICIEKPRYHEIKNALEK
FT                   LEIECVEEPLKKHPRDFFNNGRFRIKKEYGKLFVVEGVSQTIAEMRSSARSGGSVSSGK
FT                   QAHGKVVHGVVQKGVYVENKLNLVRKKKTKKKK"
FT   gene            <77039..>78130
FT                   /locus_tag="Eint_080770"
FT   mRNA            <77039..>78130
FT                   /locus_tag="Eint_080770"
FT                   /product="hypothetical protein"
FT   CDS_pept        77039..78130
FT                   /codon_start=1
FT                   /gene_family="HOG000149903" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080770"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0810"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L7"
FT                   /protein_id="ADM12011.1"
FT                   /translation="MILMVNLYRTFPIQVFASAISGTTQISIAISLALVLIFAKTNCFV
FT                   HHISFYKDVLFLEASHLLLLIMFSNTADTLTIPIMTLSVFFAFLFNTFSLPAYISQVPA
FT                   EAQDTVSSHPQAPHPSLGLYPIRFIFNTIFLDPDQLSSSSKKTSYTIMLSPAISLLVGM
FT                   VHFRIDIGRLEFLLSLICSFFAGLLLYMMIRKRIFSTISCLYTLAVSMLFFSIIMENLV
FT                   DLTVRISNATGLGIQLLSGTFLSLQSNLTEIVTCLKYKGNEMLTVSSCSILYTHIFNAL
FT                   LFFPTIRLLLTKDGILPHSQNISNAPFVYFSYVFILAEIKVIFVNYLLRHHKLTKDLGY
FT                   TLIAIYALFIIGFAIEGKEHLCK"
FT   gene            complement(<78188..>79195)
FT                   /locus_tag="Eint_080780"
FT   mRNA            complement(<78188..>79195)
FT                   /locus_tag="Eint_080780"
FT                   /product="60S ribosomal protein L4"
FT   CDS_pept        complement(78188..79195)
FT                   /codon_start=1
FT                   /gene_family="HOG000107331" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080780"
FT                   /product="60S ribosomal protein L4"
FT                   /note="similar to ECU08_0830"
FT                   /db_xref="GOA:E0S8L8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L8"
FT                   /protein_id="ADM12012.1"
FT                   /translation="MKQQINCYEVDGVTVKKTLDLPEVFSTPIRQDLVLKTYSIYRMKT
FT                   RQPYAVSKYAGMQHSAESWGTGRAIARVPRVKGGGTRRAGQGAFANFCRKGRMAHPTKT
FT                   HRRWARKVVENTKKIAEAMAVAASAQTSLVEARGHRVSNVKMLPIIVSDDISKAKKTKD
FT                   ALQILKDLNMKEELKRIEKSRGVRCGKGKMRNRRYTQRKGILIVHGESSELLGFRNIRG
FT                   VDQMSIDSLDLLELAPGGLPGRLIIWTESAFEKLDKIFGGVEREAELTPGFKLPDRIVA
FT                   HDDLEELFYSDAVQAILDEPLFVGRTELKLSDEEMKERLRFVKKLDPSAIRSTN"
FT   gene            <79365..>81743
FT                   /locus_tag="Eint_080790"
FT   mRNA            <79365..>81743
FT                   /locus_tag="Eint_080790"
FT                   /product="hypothetical protein"
FT   CDS_pept        79365..81743
FT                   /codon_start=1
FT                   /gene_family="HOG000149313" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080790"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0840"
FT                   /db_xref="GOA:E0S8L9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8L9"
FT                   /protein_id="ADM12013.1"
FT                   /translation="MTYVRWLNGEEEWLIRRSRKRSSSRGSQRTMKAKSLITVANNLYV
FT                   RNELGKCVEVLKETICLVPRNPHPYFTLGLIFEERGEIPKAYYCFFVAAHLQRNNYGLW
FT                   RKLYDYSRQLGYNRERIYFIEVLQRKGNKREMVVEKMGLYSGDKVKELSCKIELFEFDG
FT                   VDDGIFDAIRGAITHKARLARLAKRLLNHLTKDESSCSDYYVKQLVILKYEASDFIGMK
FT                   TMFDKYLFKRRVELCTKLRVIYIMACLQDGGGSGTEECIGLFLEDDRLWSEIGEIDLLK
FT                   HLADILIEHGKTDEVIKLLGRIRNKFNDQKEFVYWKLGRMLHDKENYDEALLYYRLVLE
FT                   INPINDDVKSRMHSIYTKQGNHEMAKKYETIAQLIGIVDERNKKGCAYSPEMCMSIRAL
FT                   YEEARTIGDDCRKFIESNGVLVDDFLKNRFIFEKRKKRPSGSIKLYRQRYIGNGISSEG
FT                   RGEDRIMKEGCREGFRFGDLHGLSVDEWFNVVLSQIVGLLSVSRNEEAMSLVFRSLEAY
FT                   IFRHRSDIICKLVFVGLKASLMFGDFGDFVTLVRSVICHTGNYSYAYLLFYFSNFFMCF
FT                   QRNNDFSYFQKYLQRVCRRRLRILPNLGEDLSSESCGDSSESRSINDEGHKEETCENAH
FT                   KEDATRRRAIGVSHFLFLNSHIPNLLQSKTVEMMSSLQMERNTSESIILASMFLIHSKS
FT                   RRVSDRNMFIRKGISILKSLKEKTQGEDGCVVSYNIGKAYQFFGFPGLAESFYMEALGT
FT                   SDVELRRLVQFNLYLIYKKNNTMELFKDILKSKEPSFAE"
FT   gene            <81770..>82558
FT                   /locus_tag="Eint_080800"
FT   mRNA            <81770..>82558
FT                   /locus_tag="Eint_080800"
FT                   /product="mRNA deadenylase subunit"
FT   CDS_pept        81770..82558
FT                   /codon_start=1
FT                   /gene_family="HOG000173077" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080800"
FT                   /product="mRNA deadenylase subunit"
FT                   /note="similar to ECU08_0850"
FT                   /db_xref="GOA:E0S8M0"
FT                   /db_xref="InterPro:IPR006941"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M0"
FT                   /protein_id="ADM12014.1"
FT                   /translation="MSEGQILNVWKDNLHGEMKKISQLISRYNYISMDTEFPGVVAKPV
FT                   GSFKSPSSFAYQQLRCNVDILNIIQLGISLSDGEGNRPCPISTWQFNFAFSLETDMYAQ
FT                   ESIDLLIQAKIDFKEHERRGIRVEEFGEVLMTSGLVMSSDVVWVSFHSAYDFGYLIKIL
FT                   TCNPLPEREEDFYRFLAALFPDFYDIKFLVQNSRYLKKGLQEISNDLGLVRDGIQHQAG
FT                   SDALLTSHAFFKTKEVLFNRSIGKDLMCKLFGIEVKDPLQ"
FT   gene            complement(<82582..>83097)
FT                   /locus_tag="Eint_080810"
FT   mRNA            complement(<82582..>83097)
FT                   /locus_tag="Eint_080810"
FT                   /product="ubiquitin-conjugating enzyme E2"
FT   CDS_pept        complement(82582..83097)
FT                   /codon_start=1
FT                   /gene_family="HOG000233452" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080810"
FT                   /product="ubiquitin-conjugating enzyme E2"
FT                   /note="similar to ECU08_0860"
FT                   /db_xref="GOA:E0S8M1"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015581"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M1"
FT                   /protein_id="ADM12015.1"
FT                   /translation="MVKLNPRVKNEIQKLYRANYEVRMLEGKHTQMEVLINGPEDSPYY
FT                   GAKYIVNILLPDNYPFKSPSIGFTTRIFHPNVDETSGSICLDVLNQIWSPIYDLLNIVD
FT                   ILLPQLLSYPNAADPLNCEAGSMYLNNREKYNEVVRSYVKKYAIPITKEKIDVETNNSL
FT                   SDEESLGF"
FT   gene            <83314..>84120
FT                   /locus_tag="Eint_080820"
FT   mRNA            <83314..>84120
FT                   /locus_tag="Eint_080820"
FT                   /product="40S ribosomal protein S4"
FT   CDS_pept        83314..84120
FT                   /codon_start=1
FT                   /gene_family="HOG000231325" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080820"
FT                   /product="40S ribosomal protein S4"
FT                   /note="similar to ECU08_0870"
FT                   /db_xref="GOA:E0S8M2"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M2"
FT                   /protein_id="ADM12016.1"
FT                   /translation="MPTGHRDHLKRKTAPKSWMLNKQGGTFAMMPASGPHRKTECIPLG
FT                   YLISRFLKYSSNSKELRIILDGKNVKVNGKVRTNSHFPVGLFDVVSIEKTGEHFRVLYN
FT                   VHKKFHLHRINSSEASYRLAKVTKKYESQNVPYVVSSCGLSIRFCDPAIDVGYTIKISN
FT                   ETSKVIEYIEPGVDKVVFVSSGKARGRIGVINTISIQGKEVVYGMTDFAGHTFSCTSKS
FT                   CILIGESEENILITLPKERGIRLSSLERINAQLGEMVDIGVVEVCE"
FT   gene            complement(<84160..>84876)
FT                   /locus_tag="Eint_080830"
FT   mRNA            complement(<84160..>84876)
FT                   /locus_tag="Eint_080830"
FT                   /product="endonuclease III"
FT   CDS_pept        complement(84160..84876)
FT                   /codon_start=1
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080830"
FT                   /product="endonuclease III"
FT                   /note="similar to ECU08_0880"
FT                   /db_xref="GOA:E0S8M3"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M3"
FT                   /protein_id="ADM12017.1"
FT                   /translation="MKDTSSKERKKESLELYLEIKKQRENIVSPVDTMGCFVTPSYKTE
FT                   EERRFHILVSLLLSSQTKDEITYEAMERLRTLLPEGGAADGRDCGLTMENVTSSSVGYI
FT                   DSCIKRVGFHTKKAENLKRITEILREKGLPEEMKDLVSLPGIGNKMAILYMNHACGSVV
FT                   GISVDTHVHRISNRIGLVKTKDAESTRRELEKIVPKREWETINRVLVGYGQTVCVARRP
FT                   KCEECCIRSKCPSSFF"
FT   gene            <84961..>86247
FT                   /locus_tag="Eint_080840"
FT   mRNA            <84961..>86247
FT                   /locus_tag="Eint_080840"
FT                   /product="kinesin-like protein"
FT   CDS_pept        84961..86247
FT                   /codon_start=1
FT                   /gene_family="HOG000149312" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080840"
FT                   /product="kinesin-like protein"
FT                   /note="similar to ECU08_0890"
FT                   /db_xref="GOA:E0S8M4"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M4"
FT                   /protein_id="ADM12018.1"
FT                   /translation="MLNNVRTYLRIKPQEIPEDIAVSKDSMVIDGSKFCFDRIFRGSTQ
FT                   QEIFQEISRSLLVECMQGYNCTLFAYGQTGSGKTYTIQGNEHNIGIVQRSLSLLHRNTD
FT                   LKISLSFVEIYNETMLDLFDPEANLSIREDPLYGVVVDNLTTVESDSYEKSMEMYTKGI
FT                   RIRRTSSTSMNKESSRSHSIFTVYLKSNGEVMKRSSRLCFVDLAGSERLRERGVEEMKM
FT                   KEAANINKSLLCLGKVINKLSNGEDGHIGYRESKLTFLLKDSLGGNCKLTVIGNVSLES
FT                   RGDSINTMNFLQRSKMIRNLAVVNSDVSGELEEVKNKLKILDCENQSLKARIALMDSQI
FT                   QEESGILPSYHYDIARVRSAVDEIMNTVLELEAIAKKIPGVEFGKNRNLLLGIHECFMA
FT                   LHGKEQKDTDTMKRKRMGEREQTNKEAMF"
FT   gene            <86318..>86839
FT                   /locus_tag="Eint_080850"
FT   mRNA            <86318..>86839
FT                   /locus_tag="Eint_080850"
FT                   /product="eukaryotic translation initiation factor 4E"
FT   CDS_pept        86318..86839
FT                   /codon_start=1
FT                   /gene_family="HOG000149311" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080850"
FT                   /product="eukaryotic translation initiation factor 4E"
FT                   /note="similar to ECU08_0900"
FT                   /db_xref="GOA:E0S8M5"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M5"
FT                   /protein_id="ADM12019.1"
FT                   /translation="MNLASQWVLWQNNNDESNAKSWGDDLMVVGEVSTIPEFLYLCDEI
FT                   SNVGVGKLCTMNLFKKGIKPMWEDEGNIEGGRIIMDVPVVGKDSIDELWKRTMAFCVSN
FT                   TVDNICGCVLSEKQSFYKVAIWFGKDYNQDSIKDMWQEALGGGKLSIYSFLHKKSLDSN
FT                   KGKKKWGGRR"
FT   gene            complement(<86900..>87778)
FT                   /locus_tag="Eint_080860"
FT   mRNA            complement(<86900..>87778)
FT                   /locus_tag="Eint_080860"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(86900..87778)
FT                   /codon_start=1
FT                   /gene_family="HOG000149902" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080860"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0910"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N7"
FT                   /protein_id="ADM12020.1"
FT                   /translation="MLPINFMEICSTKPNDFVFDKTICTKESRTPRILQEYSKEEKACV
FT                   LRRRILALASRKGGWPQKKALKRESESMWDVDLTRSDQGHFDQRGNFVLGAAPSLSFMW
FT                   LVRRGEDIQGPFTDREMREKINTQELKNTQVRRDIDKGFVSYDSLAADLGDFLSSEKLD
FT                   EYFESHAAVKKPLEKPQEFFEDLSSLSLKKHPKKDLDRSKILEACVKSKNFLHSRNPSV
FT                   TLGSMERRISGKSFSEAVKIISHASGLSKTECEEFLNLFLDESKLSILSDICPDGFVKV
FT                   TPVTRKGSRRK"
FT   gene            complement(<87859..>88296)
FT                   /locus_tag="Eint_080870"
FT   mRNA            complement(<87859..>88296)
FT                   /locus_tag="Eint_080870"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(87859..88296)
FT                   /codon_start=1
FT                   /gene_family="HOG000149901" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080870"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0920"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N8"
FT                   /protein_id="ADM12021.1"
FT                   /translation="MKPNKFLDTLKAKYNVERIPDGTYVVSNGDRRVKIHESELCDQLC
FT                   INRIFDLLGSPLAGFRNVGRDDLFPDTEEISVLRTVRKHPRGSLADPSIFRLPSGRPSE
FT                   DEDTDPLINIDPITPSRNRKDSFEPDPDHYKPDKNSRFPPY"
FT   gene            <88380..>89357
FT                   /locus_tag="Eint_080880"
FT   mRNA            <88380..>89357
FT                   /locus_tag="Eint_080880"
FT                   /product="cAMP-dependent protein kinase-like protein"
FT   CDS_pept        88380..89357
FT                   /codon_start=1
FT                   /gene_family="HOG000149310" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080880"
FT                   /product="cAMP-dependent protein kinase-like protein"
FT                   /note="similar to ECU08_0930"
FT                   /db_xref="GOA:E0S8N9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N9"
FT                   /protein_id="ADM12022.1"
FT                   /translation="MSRDEKLFEEIGNKIKDLKFRVNEDVVQTIYEMVVKEKGATDDLG
FT                   GFVKRLEEDGTLMNLQLNSKGRDKESLGGKWRALRRSGVYSERITPETFQLSYYPKDEE
FT                   TMKFLSSILVSDIPFGFLNPEQKIRLIESMEPVEIPCGTFVIREEDVGSQMYIVDHGEF
FT                   EVSKRGQFLRKLSRGNFFGEIALLHNIPRTASVKAVSDGKVWVVEQTSFSGIRMMDRIS
FT                   NKRIIMEGLKEHKVFPSFGDEDYEHILNSLSFEYYKKGSRVEVKDSEFLMSLFEGEIDD
FT                   GERRKIQAKEMIGKSFMAISEIQGAHICREYERPRCYDSGGSGR"
FT   gene            89437..89509
FT                   /locus_tag="Eint_080890"
FT   tRNA            89437..89509
FT                   /locus_tag="Eint_080890"
FT                   /product="tRNA-Val"
FT                   /note="tRNA Type: Val, Anti Codon: AAC, Cove Score: 53.27"
FT   gene            complement(89558..89641)
FT                   /locus_tag="Eint_080900"
FT   tRNA            complement(89558..89641)
FT                   /locus_tag="Eint_080900"
FT                   /product="tRNA-Tyr"
FT                   /note="tRNA Type: Tyr, Anti Codon: GTA, Cove Score: 51.94"
FT   gene            complement(<89743..>90117)
FT                   /locus_tag="Eint_080910"
FT   mRNA            complement(<89743..>90117)
FT                   /locus_tag="Eint_080910"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(89743..90117)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080910"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0940"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P0"
FT                   /protein_id="ADM12023.1"
FT                   /translation="MCNNKFCTLLRALNAVILQGLGIFPPKWTYWTIGGIPNMRCERPD
FT                   GAGFDNLPEKENYNPHIKEFTPTKVKQRKRYTALREITEKTKPPAQEMNRASQEDETEM
FT                   DLLFSSFPRSPFKSKNIREL"
FT   gene            complement(<90629..>91087)
FT                   /locus_tag="Eint_080920"
FT   mRNA            complement(<90629..>91087)
FT                   /locus_tag="Eint_080920"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(90629..91087)
FT                   /codon_start=1
FT                   /gene_family="HOG000149900" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080920"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0950"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P1"
FT                   /protein_id="ADM12024.1"
FT                   /translation="MDLLGKDELLNKGRKVSFMYLLLRILVIGIGFYRKNIIGKQMVII
FT                   RSMCLSICVTNVYMFIYLENAMSRKNLEQCKAYWVIILIASLEASVIVESVFKFTNHNL
FT                   GVVAFSLLYLGLCVGEFIRMYFVCKEYGDMFEWYYFKQGGVSSKLKGK"
FT   gene            complement(<91267..>91542)
FT                   /locus_tag="Eint_080930"
FT   mRNA            complement(<91267..>91542)
FT                   /locus_tag="Eint_080930"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(91267..91542)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080930"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0960"
FT                   /db_xref="GOA:E0S8P2"
FT                   /db_xref="InterPro:IPR006909"
FT                   /db_xref="InterPro:IPR023093"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P2"
FT                   /protein_id="ADM12025.1"
FT                   /translation="MLYAGMSSFDSVEKARNWSRHSSREDFSNSTSSEDMASILLSNGD
FT                   FDEYAGTSRRTRARTFYSILLMSSRGDIIPVQKKAYGQIVFTRNGF"
FT   gene            complement(<91699..>92151)
FT                   /locus_tag="Eint_080940"
FT   mRNA            complement(<91699..>92151)
FT                   /locus_tag="Eint_080940"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(91699..92151)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080940"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0960"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P3"
FT                   /protein_id="ADM12026.1"
FT                   /translation="MAFQNLLRNQEALTFLRILGKRGRKVRIGRKAVEKIWIPGVVKAV
FT                   VDIFPVYALRGASVFLQMLIRIYKAKVRIQLLEIRSLAGILDRRKKRRRTVERKKKNML
FT                   SIETGYVASVCSSELDGVDCMDSIMFSYSETFGVVDGPEHISRKRL"
FT   gene            complement(<92213..>93079)
FT                   /locus_tag="Eint_080950"
FT   mRNA            complement(<92213..>93079)
FT                   /locus_tag="Eint_080950"
FT                   /product="heat shock transcription factor"
FT   CDS_pept        complement(92213..93079)
FT                   /codon_start=1
FT                   /gene_family="HOG000149309" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080950"
FT                   /product="heat shock transcription factor"
FT                   /note="similar to ECU08_0970"
FT                   /db_xref="GOA:E0S8P4"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P4"
FT                   /protein_id="ADM12027.1"
FT                   /translation="MESMRLTMGSEFVVKLFQMLEEPENYPYISWSPDGRSFVISDIQG
FT                   FSEFVLERHFRHKNWSSFVRQLNKYDFYKVRRDGERAQWEYRNKYFQRGRPELLDKIRR
FT                   KKAPSECGVSGGSNPKQIESGIVYQSHVLNAIRSISKYLQTVVEDINEIKKYIYHERMR
FT                   IASKTNVLFVKKDVPGSEWIYSALKIPNYSLTIVEESTDMKNVMKWKYDVVVLYADAPE
FT                   CSKVVSRIRSEDEDVPIVLVVDEGFKSEYMSILGIRVTETLLMPLEPGDLVDVVNKHRS
FT                   RRGLEGG"
FT   gene            complement(<93202..>93918)
FT                   /locus_tag="Eint_080960"
FT   mRNA            complement(<93202..>93918)
FT                   /locus_tag="Eint_080960"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(93202..93918)
FT                   /codon_start=1
FT                   /gene_family="HOG000149899" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080960"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0980"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P5"
FT                   /protein_id="ADM12028.1"
FT                   /translation="MERPSDKPEGADCGMGGLNGGGALEKGELVGLESKGSSPVKKSLE
FT                   GQSMERTKGVRGPYRKTRGIDGGGYGHLYGNLYEQAQARRQKVLGFLQKDLFQIGRPDL
FT                   RRFMNLNHAYECLLPYHIFGFDLYEDMLFMNSKEVDGISMEIDEMMGLLKEITVLENRP
FT                   LATEDTLVCELLLYYQQRYINSVYGDGRKQRAQKRYRQQLSKRNTIFRLKIGLRPQKGN
FT                   DVDIRNGKLYFKKSRG"
FT   gene            <93973..>94242
FT                   /locus_tag="Eint_080970"
FT   mRNA            <93973..>94242
FT                   /locus_tag="Eint_080970"
FT                   /product="hypothetical protein"
FT   CDS_pept        93973..94242
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080970"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P6"
FT                   /protein_id="ADM12029.1"
FT                   /translation="MYLHMKLRCGKISTGNTAMMCDKCSGKCYACGLDTRESVEKVYIC
FT                   TPCFHSTYKDRCIVCKLKDPRNNAYYCRECKLQKNHDRCPVLAQ"
FT   gene            complement(<94277..>94750)
FT                   /locus_tag="Eint_080980"
FT   mRNA            complement(<94277..>94750)
FT                   /locus_tag="Eint_080980"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(94277..94750)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080980"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P7"
FT                   /protein_id="ADM12030.1"
FT                   /translation="MEKANESEYGKKGQESLLEKEISKPEMMPLHQADLDSLGVRGKET
FT                   ETGKRFNGGNLYKQAIDYQLLRSTGRVPQHIYRPKTKIPQVDENDAILDPDFVVPDFAK
FT                   DPAINFKVKMQDHRALEKYFSSGHEIDVEQLFPHVKNVSNNSPNKWPTNSGGG"
FT   gene            complement(<94783..>95385)
FT                   /locus_tag="Eint_080990"
FT   mRNA            complement(<94783..>95385)
FT                   /locus_tag="Eint_080990"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(94783..95385)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_080990"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_0990"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P8"
FT                   /protein_id="ADM12031.1"
FT                   /translation="MEFLKEFLEEWKNAIAGVKDRVMCEKMNVESGYEMKDLKNISNGG
FT                   KGRDGYERDKENEEFLYDGDFDGSAFDQESLIPGHIPVIKSKDGGLGKRTSEESERNGM
FT                   NGHPSVSCKKVSQGCKGGYKEISMRESPRIIDMDSREIYKGTRLKKPSVIGDFPSLLKK
FT                   REMGEAQCNDAELENGIGRRLLELQQRASGTLMQIPN"
FT   gene            complement(<95420..>97468)
FT                   /locus_tag="Eint_081000"
FT   mRNA            complement(<95420..>97468)
FT                   /locus_tag="Eint_081000"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(95420..97468)
FT                   /codon_start=1
FT                   /gene_family="HOG000149898" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081000"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1000"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8P9"
FT                   /protein_id="ADM12032.1"
FT                   /translation="MGKGRKLFDIRSLFEQNTASRYDGEEDEIYTAIEEKRKRKIKDPK
FT                   QRILSREEVEALGKMDIEEATSRHIPSWKGIEEVEMDGEQDQENNEWKTHVLRNLLKKN
FT                   RLNVDARIRLSRLVGRNEGSKILLEGRDIKDERLWREIISRYYASDMLDEALEVVDGDE
FT                   GFYEDLFRKDRDIKILRAGVSRHPRSFGLRKMMSENLEDILEKQMFLYESVVETHEERL
FT                   VDLFIGTKPNHGLVESLYRVLRDKGIYSEHLLSCLVEDGDNSMVVEDLLRLGLEGTLRI
FT                   LRRGKRRVELPSPILSKDTLLLYLQGERPEPMSALPSDLWSLFVSMSKHGLHDDETFIS
FT                   CYNVAKEYFLDSEFIERFFVMEPRRYFVDLMKAKEWWKLFVGSKEIGYFRRAEKILRSG
FT                   MRQYGREKKTFILARSKMYYMGGDFHSSYSVIPGKMRTIRKYVILSQISLERAFEELGK
FT                   DLFDYKHWLLYAELGERRGIDASGIYEECMSRYPENFKVGIGYLRYLKRKDMKKALEMS
FT                   DKLAKRFMSEEWMWFERFVIFRKLGKISLSVLYNSRRHVRSELIESEIKYYENKEISEE
FT                   SKYSGFYAYRRARIKECNIGGMCLDCVGRMKEYYREKIMKDQDNGDNYILYYCVGGGVD
FT                   GELVRMVEFFDPRGGSYWPRVRNRVDVGSKLEAGWRMMNFDFLDKTV"
FT   gene            <97502..>99325
FT                   /locus_tag="Eint_081010"
FT   mRNA            <97502..>99325
FT                   /locus_tag="Eint_081010"
FT                   /product="hypothetical protein"
FT   CDS_pept        97502..99325
FT                   /codon_start=1
FT                   /gene_family="HOG000149897" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081010"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1010"
FT                   /db_xref="InterPro:IPR013253"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q0"
FT                   /protein_id="ADM12033.1"
FT                   /translation="MWGIKTLEMGEEKDTKKKRVSFAPEPQVMYIYPEEENKSNKAVDS
FT                   GMMSEDEISVELTVDHLRGRKTEDGGDGEFLNAELKDLMEDSEVGYGAMGDNSGKEDEV
FT                   EKEKCKENYGVEEGEIKEVKDDEECKEGGAENSETGWREGPCRNEQEEFEDTLMSNETV
FT                   NVEEIINTQDLRKIIPQVRKEMVNVSELLVSKGIRFLDSLVVSNTRRDTMSKSRNEVHP
FT                   RQERFYESFLEPRTRFFLEFSSDLEDRMLRQEKVNEELEREFRIAGTVFESPDASSLLR
FT                   ALKTECRMKSKIEWYELRKEKEVEFNREVTDRRNRLAEEYNHLGGCLKETSEKVEESKR
FT                   RNEEMEEQIRRIKNRLGMDGDGRHQKISELRALMSKQEGTIESGRKEVKRLEEERTRKQ
FT                   AERRVLKEALEKMEMEIRDLEEVLKTQNITEGDVKEIRQEFRTLCAAFGMELMKVDTSE
FT                   VRLRILEYNLKINLGAGFVIESIEATPLCDRKDLGHLYHHFGKYFEGKGCSFFKGIRDA
FT                   MFMSAMVSGLCKELSGIKKRHSVECSGEDNEAIVRILALDVEKCTKHEISIKIKNGFEC
FT                   LIQWKDRSQMWDLKKDVGIISRSVEEALANR"
FT   gene            complement(<99411..>99773)
FT                   /locus_tag="Eint_081020"
FT   mRNA            complement(<99411..>99773)
FT                   /locus_tag="Eint_081020"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(99411..99773)
FT                   /codon_start=1
FT                   /gene_family="HOG000149896" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081020"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1020"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q1"
FT                   /protein_id="ADM12034.1"
FT                   /translation="MFRFVALPMDRENYLKLEKAIRKGEHLESLSVLRTILDRVVGDIS
FT                   ETCPKEDLELLSKSIQHQRLVYEKAVSLYEGMQVENMEEDVLIRCLEDFNRSLQEYYAL
FT                   PGNSKPQDSEEEKDKL"
FT   gene            <99912..>100409
FT                   /locus_tag="Eint_081030"
FT   mRNA            <99912..>100409
FT                   /locus_tag="Eint_081030"
FT                   /product="hypothetical protein"
FT   CDS_pept        99912..100409
FT                   /codon_start=1
FT                   /gene_family="HOG000149895" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081030"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1030"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q2"
FT                   /protein_id="ADM12035.1"
FT                   /translation="MEKNQAEPEKNISYTKLAFFFFVIRTVVIGLALLSGPYFALDDET
FT                   TTFKMFIIFLDITNILQFIFQWDIIQRKILFQYLLYIPVLAYSLTLTITLIVDAHNTNS
FT                   CNFKVEGKIKKLAIGYIYTYMGILLGEVALLPIIYRRLKSDFMWANFKKLGANTAINGK
FT                   WR"
FT   gene            complement(<100921..>101247)
FT                   /locus_tag="Eint_081040"
FT   mRNA            complement(<100921..>101247)
FT                   /locus_tag="Eint_081040"
FT                   /product="40S ribosomal protein S25-like protein"
FT   CDS_pept        complement(100921..101247)
FT                   /codon_start=1
FT                   /gene_family="HOG000154198" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081040"
FT                   /product="40S ribosomal protein S25-like protein"
FT                   /note="similar to ECU08_1040"
FT                   /db_xref="GOA:E0S8Q3"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q3"
FT                   /protein_id="ADM12036.1"
FT                   /translation="MAKKIQESKEKKALKAMSGTRKDKKKWSDGKKKEEVRRGVTVTEE
FT                   LLSKVRKDVCRASVVTRYGVGSKYNLNLGVAENVLRHLASEGVIEKVLGNSRMTVYAGS
FT                   PQEK"
FT   gene            <101366..>101812
FT                   /locus_tag="Eint_081050"
FT   mRNA            <101366..>101812
FT                   /locus_tag="Eint_081050"
FT                   /product="40S ribosomal protein S13"
FT   CDS_pept        101366..101812
FT                   /codon_start=1
FT                   /gene_family="HOG000180723" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081050"
FT                   /product="40S ribosomal protein S13"
FT                   /note="similar to ECU08_1060"
FT                   /db_xref="GOA:E0S8Q4"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q4"
FT                   /protein_id="ADM12037.1"
FT                   /translation="MAKMHSSGRGRSGSVKPYATVFPTWLTKTADEIKADVIQMGNKGI
FT                   PAPDIGKKLRDEYGVGNAKDVLGCEITKFLEENGASPKIPFDLESLVRRANTLRSHLNI
FT                   YRKDNSAKYRLILVSSRMYRVARYYKRKMRIPGNWKPKLVELIK"
FT   gene            <101931..>102626
FT                   /locus_tag="Eint_081060"
FT   mRNA            <101931..>102626
FT                   /locus_tag="Eint_081060"
FT                   /product="hypothetical protein"
FT   CDS_pept        101931..102626
FT                   /codon_start=1
FT                   /gene_family="HOG000149894" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081060"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8S1"
FT                   /protein_id="ADM12038.1"
FT                   /translation="MYEELLNFLLARKKRLLSEEEADRLMELITQSMEAREGREGKEDN
FT                   TALIRKILENVDMDQAYETDTESMENAMEDLLFDGYSSEIYSNDTIDLSESDNDTEPLS
FT                   ERKFQRGEFRAGVKASENEEEPKRRIGLKDKAKEGEWKDLSGGKDNDLQPPKDSTGVLS
FT                   EDGEGPKRREFKLPGFSKEKKERSFEMRDGGDFNLPGSVEFEFDLGELKKVNNTGPNVK
FT                   FFDEDGEEI"
FT   gene            <102774..>103100
FT                   /locus_tag="Eint_081070"
FT   mRNA            <102774..>103100
FT                   /locus_tag="Eint_081070"
FT                   /product="40S ribosomal protein S25-like protein"
FT   CDS_pept        102774..103100
FT                   /codon_start=1
FT                   /gene_family="HOG000154198" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081070"
FT                   /product="40S ribosomal protein S25-like protein"
FT                   /note="similar to ECU08_1070"
FT                   /db_xref="GOA:E0S8Q3"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q3"
FT                   /protein_id="ADM12039.1"
FT                   /translation="MAKKIQESKEKKALKAMSGTRKDKKKWSDGKKKEEVRRGVTVTEE
FT                   LLSKVRKDVCRASVVTRYGVGSKYNLNLGVAENVLRHLASEGVIEKVLGNSRMTVYAGS
FT                   PQEK"
FT   gene            <103193..>104674
FT                   /locus_tag="Eint_081080"
FT   mRNA            <103193..>104674
FT                   /locus_tag="Eint_081080"
FT                   /product="DEAD box RNA helicase-like protein"
FT   CDS_pept        103193..104674
FT                   /codon_start=1
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081080"
FT                   /product="DEAD box RNA helicase-like protein"
FT                   /note="similar to ECU08_1080"
FT                   /db_xref="GOA:E0S8S3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8S3"
FT                   /protein_id="ADM12040.1"
FT                   /translation="MTYRGYSGDRRGFRTSPRFDRGGRYPPRERREGQRYDPLPELPPV
FT                   EFQKNFYKEAESISRMSSRDVDSFRKTNEMTVKGMDIPHPISRFEEAGFPSRIVEELEG
FT                   KGFSGPTPIQAQGWPMALSGRDMVGIAQTGSGKTLSFILPGLVHAKDQQPLRRGDGPIA
FT                   LVLAPTRELVMQIKKVADEFCGMFGLRSTAVYGGASSQPQIKALHEGVEIVIATPGRLI
FT                   DLHEQGHAPLSRVTFLVLDEADRMLDMGFEPQLRKIIPKTNGNRQTLMWSATWPREVRG
FT                   LAESYMNDYIQVVVGNEELKTNSKIKQVIEVCSGREKEDKLLGVLDKFKGDKVIVFCNM
FT                   KRTCDDLEYVLNRSGYGAAALHGDKSQNIRDKVLDDFRSGRRPILIATEVAGRGLDVND
FT                   VKLVINFDFPGTCEDYVHRIGRTARGNTKEGISHTFFTINDKGNARELIRMLREANQTV
FT                   PSDLEDMVRVSNDRYGSRGVKHDYRGRPGRFPYRG"
FT   gene            complement(<104814..>106493)
FT                   /locus_tag="Eint_081090"
FT   mRNA            complement(<104814..>106493)
FT                   /locus_tag="Eint_081090"
FT                   /product="histone acetyltransferase"
FT   CDS_pept        complement(104814..106493)
FT                   /codon_start=1
FT                   /gene_family="HOG000227514" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081090"
FT                   /product="histone acetyltransferase"
FT                   /note="similar to ECU08_1090"
FT                   /db_xref="GOA:E0S8S4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR005910"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8S4"
FT                   /protein_id="ADM12041.1"
FT                   /translation="MSDFLKACNEISGEIIRLYKQEKKIDVNAIKSRVCKKYNLGATPR
FT                   VVDIISFIPPEYGHLIQQLRVKPVRTASGVAVVAVMCKPHRCPHIALTGNICVYCPGGP
FT                   DSDFEYSTQSYTGYEPTSMRAIRSRYDPFEQARERLKQLKSLGHNVDKVEYIIMGGTFM
FT                   SLPESYRDHFISRLHDALSGHTSASVEEAVRVGAEGRLKCVGITIETRPDFCVRPHLSK
FT                   MLSYGCTRIEIGVQSVYEDVALDTNRGHTVGSVCESFGLSKDAGFKIVAHMMPNLPNVP
FT                   MKRDLAQFREYFDNPRFRSDGLKIYPTLVIKGTGLFELWKNNKYKNYSPDELIDLLARI
FT                   LSFVPPWMRVYRVQRDIPMTLVSSGVEHGNIRELALARMKDYRTRCRDVRTREVGIKNI
FT                   HESVLPEEVELVRRDYVANKGWETFLSYEDVKQDILIGLLRLRKCSVDTFRKELKGLDP
FT                   PSETGGESPRGGKYHPAVVNGNASMIRELHVYGSAVAINKSDERKYQHRGYGTLLIAEA
FT                   ERIARDEHGSSKIAIISGVGTRNYYSKFGYVLEGPYMVKDLC"
FT   gene            <106620..>109079
FT                   /locus_tag="Eint_081100"
FT   mRNA            <106620..>109079
FT                   /locus_tag="Eint_081100"
FT                   /product="coatomer complex subunit beta"
FT   CDS_pept        106620..109079
FT                   /codon_start=1
FT                   /gene_family="HOG000149308" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081100"
FT                   /product="coatomer complex subunit beta"
FT                   /note="similar to ECU08_1100"
FT                   /db_xref="GOA:E0S8S5"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011710"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016460"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8S5"
FT                   /protein_id="ADM12042.1"
FT                   /translation="MQASLYLNTSTRMRKDEIMQKLGSNNEEDKAEGMKQIIAQMSQGE
FT                   DFGSLTHKVTKETLVVKSNELKRLFYYYLELLPKSRGSQSFEEILLLSNQVRKDLEHPN
FT                   EYVRGFVMRFVSTLDDQELVGNFYKLIKDNLNHPNAYVRRNAYFCLGEIFLKMDTYKEI
FT                   PDLLYHALLRDLDPNCLREAFVSLHQTDPDLALKYANEVDLSIPSELSTAIIEKTSDPG
FT                   LLERFLFSGDFQTALEAGISIHRISSDEELLKRSTDTILRCLADLPEFREYAVDELLLS
FT                   TYSFSGYAMSFLELIDPYDLSLCSKCLDLAFKIAETHEFLRISEFLGSKFIDTHDASSQ
FT                   NQNFKVLLLKKMAYFADVYSSYSEEMISESLKNIVSDNPEMSYGSLVFLSSCFEVMRKN
FT                   TMPGQRETIGYIGHLKTLVNKINAVKYGKILRCCFEVLRKYATKEIFLSTVEMLDCSFE
FT                   LSSKPLYLENTQTFLGAFMCIELAKMCKTFGEDQKDRVIGIMLKFVEYGKESKTIDVSS
FT                   HSTIISCIRSLMSCDEEVGIEFDRQVRCRENVLDPIVLPGVRPGDERNQNKLCEFLRKD
FT                   EGGSGEMRNVTQLTGLSDPIYVEATTSYTRHEVVMDMLLINQTSSYLQNILLDFVTSQG
FT                   FNATFINTPFSLSSRSVVTKRFTFRIIEGSNGFISGSITFRYPDECGEYANTVYTINLA
FT                   EVRTAVSEFLEPKKMDSDEFRETWKELEWENTYTLKFVTRRTLEEIFEEVSKVLNGEIL
FT                   DIEYDESYAVGNIACMTLQNVCVLINVCLRKGEYVHFESRIRSRREGIVKSVSAVVGDV
FT                   LKSLKNK"
FT   gene            <109124..>110128
FT                   /locus_tag="Eint_081110"
FT   mRNA            <109124..>110128
FT                   /locus_tag="Eint_081110"
FT                   /product="WD40 domain-containing putative guanine
FT                   nucleotide binding protein"
FT   CDS_pept        109124..110128
FT                   /codon_start=1
FT                   /gene_family="HOG000149307" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081110"
FT                   /product="WD40 domain-containing putative guanine
FT                   nucleotide binding protein"
FT                   /note="similar to ECU08_1110"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8S6"
FT                   /protein_id="ADM12043.1"
FT                   /translation="MSSAELEVLEYLNGHKDEVKGLKVVRVSGKEILYSSSKDKKVFSW
FT                   DLHSKIDSEFGKILKLYEGGHSKRINGIDVSKDGSMMVTVGSDGIGRIWDTEAKKSKPL
FT                   EGHSRDVLCVSINSNDTKIVSGSVDRTMNLYNTRGELIAKIGKETEKMHRGWINCVAFH
FT                   PIEENILASGSTDGTVKIWDLDAPEHMQTYLGGMYVDYEKAKEKKVSPADYDESKSVTA
FT                   MAFSKDGSILTYGEKSGKVYLVKLDSKECIQSLDTLIPVRSIAVGETEPVIALGTDESV
FT                   IIWETISSRIIANYNLKEIGNGVRCLSLAFSGNTLYCGLSSGTIVPLELRKSD"
FT   gene            <110175..>112034
FT                   /locus_tag="Eint_081120"
FT   mRNA            <110175..>112034
FT                   /locus_tag="Eint_081120"
FT                   /product="Rad3-like ATP dependent DNA binding helicase"
FT   CDS_pept        110175..112034
FT                   /codon_start=1
FT                   /gene_family="HOG000149306" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081120"
FT                   /product="Rad3-like ATP dependent DNA binding helicase"
FT                   /note="similar to ECU08_1120"
FT                   /db_xref="GOA:E0S8S7"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8S7"
FT                   /protein_id="ADM12044.1"
FT                   /translation="MDRIELYESQKLFIEDARRVIDGGSVGIFSSPTGTGKTISLLSAV
FT                   ADYMDIEETEMDCRNRMLEKILFQGSRKAVFYCTRTHTQLAQAINELKKLGVRCNSVVL
FT                   GSRKIYCLNEEIRKYKSSDEMNEACKEAVKEGKCMLHDGCEEFDGYGVIDVEDLLATGG
FT                   RERFCPYYTARSYSQQCDIVFLPYQLLFTREGRKSADIDVKGSIVVVDEAHNIYDSVIQ
FT                   MNTASISFGTVDRYVKAMELYKKRYGGRMKRDGQFERVMEVLKKIGSFRCVHCRDMEGD
FT                   EGVMGVSEFLLGAGIEDFNMLEIEDYIAVSGISRKLEGFEKDLNMKLPEISKFLSLLTM
FT                   SDKSGRILYSSKGIKFTPLDASMYFEDVLECRSLLLAGGTMEPIDQLVSALRKRSPKYF
FT                   SYGSVCKDFLPIVIRSGPSGKEIVVNYETRESPMSIKDVASSILNLSNAVRSGGMVCFL
FT                   PSKAYLKILKEACGDTIGSKKALYEDSVTFEEYVQEVRRSPCILFAVMGGSLSEGVNFN
FT                   DSLCRLLVVVGVPYPSQDLELKERAKFNGSGYTTAIAMKTVNQALGRALRHRDDYAVLV
FT                   LLDKRYVQLSRLTSPWIREKIIHCNFGDGLFKTNKFLNKDRCL"
FT   gene            complement(<112058..>112591)
FT                   /locus_tag="Eint_081130"
FT   mRNA            complement(<112058..>112591)
FT                   /locus_tag="Eint_081130"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(112058..112591)
FT                   /codon_start=1
FT                   /gene_family="HOG000149892" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081130"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1130"
FT                   /db_xref="GOA:E0S8S8"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8S8"
FT                   /protein_id="ADM12045.1"
FT                   /translation="MGFLNKLVITVKKPTKRSKQICMHIRRMLEPNVTAKLRDRNTTVK
FT                   SYLDVADALELSHFILVDARDIKIGVRPKGPTYVFNVVDYNPKYVRVEEEYYKSDPCIT
FT                   FTGESDLKGLFLSLSSQPEAFKRSLHFYFDGDLIHIRHYAILTKEEEDIKVGFNEIGPR
FT                   ITMKLVKKMDGFFE"
FT   gene            complement(<112634..>113578)
FT                   /locus_tag="Eint_081140"
FT   mRNA            complement(<112634..>113578)
FT                   /locus_tag="Eint_081140"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(112634..113578)
FT                   /codon_start=1
FT                   /gene_family="HOG000149891" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081140"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1140"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8S9"
FT                   /protein_id="ADM12046.1"
FT                   /translation="MDSAIAPLLLFAAVLVLGATAVNLIVLRANSSPEVSGTKYIEEIQ
FT                   STRAKGLMFLLLVLVLTSIYYFLCTQNYLEGSPPNFLKVIRMDSHSLKMLELCTRNIQK
FT                   SFMFYATALVIPLVSSRRFRVLGVDEKVSIAFVRYYSLFGSFLYPFIFHVSNGYDLGGY
FT                   LVEVLNIAENSLLLLLYFALLQKIWKMHDVLSYTQIITKFEIEEVLGRVSPKIVGIMAY
FT                   LCADMASGAFRMARMFFPVEYGLGIPTNSLAETAFFVGLCYYSIKFLVTPGNGICESIQ
FT                   KMEGIKKHVASGFLNLEHRSGDDMMDVSTIPNI"
FT   gene            <113750..>114640
FT                   /locus_tag="Eint_081150"
FT   mRNA            <113750..>114640
FT                   /locus_tag="Eint_081150"
FT                   /product="putative short chain dehydrogenase"
FT   CDS_pept        113750..114640
FT                   /codon_start=1
FT                   /gene_family="HOG000149302" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081150"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="similar to ECU08_1150"
FT                   /db_xref="GOA:E0S8T0"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T0"
FT                   /protein_id="ADM12047.1"
FT                   /translation="MVIQLIYLGVSYMMLKILPTIYQYIYSKCRNHQVWEGLKKKYVLI
FT                   NGATGKVGMGLARKFAEKGMKILLVGRSESRLTRLHAKIGRMTECHMHIVDYKRNPNLS
FT                   FIERYDIGILINCVSAIEDSPAYFVEQTVEDIMNANLVGVMSLTRHVLVNMMDSGYGYV
FT                   INIGSLMAEASTPLYSAFGCSKQALKTLSDSLYYELSGYNINIEYMGVGNVSCEDYGEK
FT                   SSFLRPSSDTLASSILGTFGSAKMSIPYFPHFIMYLLMLCIPSPLLSRLVLHKNRQEML
FT                   EMRNNESSFEERKVK"
FT   gene            complement(<114714..>115154)
FT                   /locus_tag="Eint_081160"
FT   mRNA            complement(<114714..>115154)
FT                   /locus_tag="Eint_081160"
FT                   /product="ribosomal protein L23"
FT   CDS_pept        complement(114714..115154)
FT                   /codon_start=1
FT                   /gene_family="HOG000183703" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081160"
FT                   /product="ribosomal protein L23"
FT                   /note="similar to ECU08_1160i"
FT                   /db_xref="GOA:E0S8T1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T1"
FT                   /protein_id="ADM12048.1"
FT                   /translation="MAAEKKTEVLEKKISIKPRNKITRGVQVETLMKCADNSGAKILRC
FT                   IGVKRYRGRLNRLPAAAPGDICVVSVKKGKPELRKKVHYAILIRQKKIWRRTDGSHIMF
FT                   EDNAAVLINNKGELRGAQIAGPVPREVADMWPKISSQASSIN"
FT   gene            <115537..>115911
FT                   /locus_tag="Eint_081170"
FT   mRNA            <115537..>115911
FT                   /locus_tag="Eint_081170"
FT                   /product="hypothetical protein"
FT   CDS_pept        115537..115911
FT                   /codon_start=1
FT                   /gene_family="HOG000149890" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081170"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1170"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T2"
FT                   /protein_id="ADM12049.1"
FT                   /translation="MKPFLLGLLKCKRCSFTSRLVPRCEKVKRSSIDGNAKIFNKHTFT
FT                   ENGGERLKLLVESLQGFFGNLLSEQEIGSFVEDPDDDERIKELLFGVDVVEGSLTCDEC
FT                   GLIYPIRDSIVETVDTLESK"
FT   gene            <115975..>118770
FT                   /locus_tag="Eint_081180"
FT   mRNA            <115975..>118770
FT                   /locus_tag="Eint_081180"
FT                   /product="hypothetical WD40 domain-containing protein"
FT   CDS_pept        115975..118770
FT                   /codon_start=1
FT                   /gene_family="HOG000149889" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081180"
FT                   /product="hypothetical WD40 domain-containing protein"
FT                   /note="similar to ECU08_1180"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T3"
FT                   /protein_id="ADM12050.1"
FT                   /translation="MSDIEAFVAFYEHLKSQGKGDSELRSEELERAMREMLRRAKITDF
FT                   KEYARSYKYKRRELSGFQEVLVWGKRNSIWNGMGDMFRSSMELLGHSGQVDRICFDQGN
FT                   RFFMSGGSDGMIKLWDIYSGLLVYSFIGHRNLVSDLCVSSDGKVLVSCDSHGLLSIWSL
FT                   ERFEMLLQLELECEIVFTEFFDTDDLSTYNLIVVLSKGVIKTYRFDERRIVSESENLCL
FT                   LDESIKGLCFTDGGRFLLCSGWWPFLVVFDTQNSDGCIVLETNGMPVNTICGSKKGLKI
FT                   AAACDSQIFQWTFFAEGNPGMGNFKRRTKDTSLEGHWKRSITKIDIGENESIERICYLR
FT                   DNFLVCICTDLKIRIFAGSELRCIIDIPEMGIAYPHPLENIFALCGSSLRIYSMDKLIY
FT                   EEMLSFAANDGQFSNDGEFFVFGDERGVVRVLSMSFLPKPPKEQFFESDLDHLNSTEWN
FT                   GVVECRRESTYESDRKRNEDWFQVEYAITKKSNDCVKVEDLGSKHFVKDFVGLEAFRKK
FT                   YMNIPLPGETQSVEQTMISEYSSSILEGDTSSGFYEESTDMTGDEEILFEDKGAPVRRS
FT                   LVISDESSEMVPVLRRNTRVSEDVENDLSPTGIVRRLRRFNRDQAVEDEENGIRILSLE
FT                   GGDGMDRRGAEHCAGPRSSINDSERSELAENSDDRYVIGLSGGIGHGEQELRQYVQSWL
FT                   SSPSMVPQPGDVVYLNSEGLREFQMFDGRKKFKGQEICSGYYEVRSLEAVRYSPPFLKV
FT                   GLGLRDESFSIRYYRYPGSSPVLLLREQMNAGAGDFISFVSNGIISRGRVSGVRGIHLV
FT                   VDSGGTSVLVERLDMLIPRALFPGDMKTEMLKVLRQRRMHRGLYVTLRRESNPSYYENA
FT                   TSTVNLGIIEEKILHDLYRTIGGLEFDLDMAVSNSLYLGPVLHEHCQQAVEGVRTIIRR
FT                   I"
FT   gene            <118809..>119525
FT                   /locus_tag="Eint_081190"
FT   mRNA            <118809..>119525
FT                   /locus_tag="Eint_081190"
FT                   /product="RNase P subunit p30-like protein"
FT   CDS_pept        118809..119525
FT                   /codon_start=1
FT                   /gene_family="HOG000149888" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081190"
FT                   /product="RNase P subunit p30-like protein"
FT                   /note="similar to ECU08_1190"
FT                   /db_xref="GOA:E0S8T4"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T4"
FT                   /protein_id="ADM12051.1"
FT                   /translation="MYYDVNISLDYPKQDIEELEKSEYEGFCVNKTMRPKDLERLSHGS
FT                   LEFPGAKRYYNRAEIVFGEGEQIGYDFRKAMRYDLFVVKLSGTEGMDKIIKHQPDMITF
FT                   DYGGKVLPFKPGLVKTAIREGIFFEIPMREGLRGGSLTIMWIRNVRRLLFITNGKNIVV
FT                   SSGAQCSMEIKKVRDVVKMLEMFGLGEKRALEVMLNSERLLKRCAMKRHCYRDSIVHSV
FT                   DEGALKRDFVLSLYKN"
FT   gene            <119590..>120243
FT                   /locus_tag="Eint_081200"
FT   mRNA            <119590..>120243
FT                   /locus_tag="Eint_081200"
FT                   /product="hypothetical protein"
FT   CDS_pept        119590..120243
FT                   /codon_start=1
FT                   /gene_family="HOG000149888" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081200"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1200"
FT                   /db_xref="GOA:E0S8T5"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T5"
FT                   /protein_id="ADM12052.1"
FT                   /translation="MFFDVNVSNRCPRGDLDVLKELGWDGICINTVVGLDNLEGWSSPL
FT                   LDVWKDEKAYERIEVRYKDNEKWSEVRKMVNPDVLSVRIEGVEDFKKALEVSPDVITFD
FT                   YSRSFCLGKDEVFEAVKRNIFLEIPLVCGMYGQRNKVVWMRNARKLVEITGGVNVVVGS
FT                   GASCCTEMRSSHDIIKILGGLGTSGDCGRKILQNSGRLIRSCRIRKGCVMKEEI"
FT   gene            <120328..>121674
FT                   /locus_tag="Eint_081210"
FT   mRNA            <120328..>121674
FT                   /locus_tag="Eint_081210"
FT                   /product="hypothetical protein"
FT   CDS_pept        120328..121674
FT                   /codon_start=1
FT                   /gene_family="HOG000149887" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081210"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1210"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T6"
FT                   /protein_id="ADM12053.1"
FT                   /translation="MGARKNRMRGRGRIQGAGRSIVIERSEVKKEEKAEGKFNVDFQEL
FT                   NEELSGIELKEENSKCSDVDEMVCERVCKDDKVEEVPEVSEINRENTVDEEVEAEKKEE
FT                   NIENRKEEGEDAVKASQALYPATPSVLTTVIPQTPMRRVLHEEGSHLFVKEESMALPGK
FT                   VIINRYPGHLFIHIDQVERFMTSRKEVESVSIKIESKGIFYETKKYPVQPDIGINEMLQ
FT                   VPINKAESNGTPLRFILLLYHRSGNIVKSCETVLVVDGSRIRSIHNNLLESRLAWDNYV
FT                   SRNLFKSIRSFFTSGAPDAWSLKIYLSFVSDDELRLIPAPLPQDLKSLSKWLVVKKFSY
FT                   NIWFRGFVNVRGDVEKACTNLWKRRYVRCYGYMIFIFNEHSRSLVGTINLVDASFDPST
FT                   SNKVYLENFLRINVGEKVVELHFDTKDKYNTCRSALTMMLPRTLFHKKG"
FT   gene            <121807..>122112
FT                   /locus_tag="Eint_081220"
FT   mRNA            <121807..>122112
FT                   /locus_tag="Eint_081220"
FT                   /product="hypothetical protein"
FT   CDS_pept        121807..122112
FT                   /codon_start=1
FT                   /gene_family="HOG000149886" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081220"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1220"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T7"
FT                   /protein_id="ADM12054.1"
FT                   /translation="MRPVLNETTNATKRLETKSKEGESDKGRVLHFLKGVYATTRDYSL
FT                   KYDLKKCMEIIEGKENQEVIDLKNALSEALIENETLFAEKCELAVTLECMKAERKE"
FT   gene            <122530..>123804
FT                   /locus_tag="Eint_081230"
FT   mRNA            <122530..>123804
FT                   /locus_tag="Eint_081230"
FT                   /product="hypothetical protein"
FT   CDS_pept        122530..123804
FT                   /codon_start=1
FT                   /gene_family="HOG000149885" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081230"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1230"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T8"
FT                   /protein_id="ADM12055.1"
FT                   /translation="MHRKTMTESLDGYREITEIRRDRRIVISSAVDVVTGEKVILEEAD
FT                   LSGISSYYQPLLMGFLLEHELNNSPYVMKVMRVFESSNRIYVVQRHMSLGPVDTTIGNQ
FT                   IFVSDDFVFYVFMQVVYAMKLNGEEGWFWDRMSPRYIWIDEDGKVRICWADVVLGNMKA
FT                   MVKQLDKWNGRMKSEEKTTGGDKVNSGCEGSVSFGNLRRIFVSLALGVSEVSKVMYSWN
FT                   GRIGRSGFLGHIQGLSPDLDGLASLLFEDGVGIKDLEEYTRRMIQEKRIASNPREIFKS
FT                   LGTVLEEMKRDENKTLEETRAWNGKSPRTEEPESGSGSEESGRNMSESGSRGDDERVGS
FT                   FGTREYRKGRFYVCDAIPLGEREKGLGMNDQMKRMGRIVNVQNRQISLLTGVMRKSGLL
FT                   DKETDAELGELEDLVNFLLFGVERQ"
FT   gene            <123868..>124758
FT                   /locus_tag="Eint_081240"
FT   mRNA            <123868..>124758
FT                   /locus_tag="Eint_081240"
FT                   /product="hypothetical protein"
FT   CDS_pept        123868..124758
FT                   /codon_start=1
FT                   /gene_family="HOG000149884" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081240"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1240"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8T9"
FT                   /protein_id="ADM12056.1"
FT                   /translation="MEEIVYLCDLSFYSSSVAGDSLIASDKMGGVHIIAPEISTVNIDH
FT                   FKKDVNFYPVDDLCFTTTDMFKGIRVWDRCRGDIVYSYKEDSIKMHTYSRTGCLAAVGE
FT                   GCVKLYDLRVRYNIDAVPLKMCKKAEWGNDRIYCINDECVVEYDTRNMSSMVCGEKNEA
FT                   YLKKKNIEGILDLISISKGEFCTVKRDGVPYLMRLSGVDVMEGTRRASIGWKMIKVKDT
FT                   SDDFVIGMVSENTVGFYGYKDTWTHEFDGISHVDWMCFSKRKIYMFADKKIYLIEREYE
FT                   GLKELMKEGPGSLEE"
FT   gene            <124821..>126986
FT                   /locus_tag="Eint_081250"
FT   mRNA            <124821..>126986
FT                   /locus_tag="Eint_081250"
FT                   /product="coatomer subunit beta prime"
FT   CDS_pept        124821..126986
FT                   /codon_start=1
FT                   /gene_family="HOG000149301" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081250"
FT                   /product="coatomer subunit beta prime"
FT                   /note="similar to ECU08_1250"
FT                   /db_xref="GOA:E0S8U0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U0"
FT                   /protein_id="ADM12057.1"
FT                   /translation="MKFKRTIQKTFGSSKIKSIQVHPTKPIGIMGLFSGDIQVWDIDKM
FT                   GMINSIHVCNEPIRTCAILSRMDWVLVGSDNGKVSIYELGKYRKIKMFHGHDDFIRKIE
FT                   VHPQEPMFLTASDDSTLKSWTYEEEIVQKMVYTGHKHFVMDVCFYPNDCSKFVSCSLDS
FT                   TIKVWHIGQPHCVKTFKGHASGVNSICFLSGDYLVSGADDLTLKVWDFQTTQCITTLAG
FT                   HTNNVNKVYPFSSFSLFASCGEDGSMRLWNSKTFKQEDLIMLQGGRVWDVKEKDGRIIV
FT                   GCDEELVFINAWQGSSLVRMSRNRIFYSASGSMFGTRSDNIGVVKELHNIGFYPDELEV
FT                   SPSGKTIAVGNEGEFKIFSSLGFRNKFGGEGRDFHFIEDDEFVVRNGEVVNFYKKAEVI
FT                   RSISIKGISKVFFLSPRLIGCNVCDQTRIYLSTGEFVSSVSHASDHLAMIGDFLIACGA
FT                   FISIYRVDHEVINGFIEQEIEIPEEGIKEALIHLGTEYYSVASWCAKEDVFYFVSNGKG
FT                   YYLILGDKPYVYHFSSIDGTIAGVENGVLFYLRDKSIECKRIDGEFLEFQRSVILGKEY
FT                   KVTEGIRSKAIAFFESLEMHENALDLCIDDNQRFEILLKLDRYDEAFSKANSIVKYDKL
FT                   GRYFLRAGELPKASECFLKSRNWVSLLLSDILSSKKNLSLAASECKKEGRLNHAFFAYL
FT                   KSGQYIECAKLLEKTPFSTLFAKNYLD"
FT   gene            <127055..>128122
FT                   /locus_tag="Eint_081260"
FT   mRNA            <127055..>128122
FT                   /locus_tag="Eint_081260"
FT                   /product="chromatin assembly factor 1 subunit P60"
FT   CDS_pept        127055..128122
FT                   /codon_start=1
FT                   /gene_family="HOG000149300" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081260"
FT                   /product="chromatin assembly factor 1 subunit P60"
FT                   /note="similar to ECU08_1260"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U1"
FT                   /protein_id="ADM12058.1"
FT                   /translation="MENLEKWYPIEVTTHNLHFHEEASIFTMHGNEEFIATGGGDKDIR
FT                   LWRVEKSASKNKDFCYTTAANSSIKIRYHTVLSGHHRSVNCVRFQGDLLASCSDGGEVI
FT                   LWSGEKPHVVRRIDGDDAYELVWGNGHLFVGFSSGNILVYQVTLNNESLRGDENHSNSR
FT                   ASKDEDEKKKDWSQEISTKLVQKVQCHGDIIQGLAFNHRFGVLTSLSKDRTGRTFVFTD
FT                   KLVAIEKMEYVDGERLFTAGRGFFRRFSYSPDGKLLYLACCKSNTVAVLHYPFRMEHMY
FT                   GTMGPFDSEPLRIMCDENKVFIATKKNLYVFADQKLEFCVENISFMTITDGWVFDGICF
FT                   LCSLDGFLSSLSMKR"
FT   gene            <128175..>129263
FT                   /locus_tag="Eint_081270"
FT   mRNA            <128175..>129263
FT                   /locus_tag="Eint_081270"
FT                   /product="developmentally regulated GTP binding protein"
FT   CDS_pept        128175..129263
FT                   /codon_start=1
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081270"
FT                   /product="developmentally regulated GTP binding protein"
FT                   /note="similar to ECU08_1270i"
FT                   /db_xref="GOA:E0S8U2"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U2"
FT                   /protein_id="ADM12059.1"
FT                   /translation="MGIQDKINEIEAEMARTQKNKKTEHHLGILKAKLARYRHELDAPK
FT                   TKSLKNDGFEVSKSGDARVVLIGFPSVGKSTLLSKITGTHSKAAEHEFTTLDCISGKMC
FT                   LNDTWIQVLDLPGIVSGAAQNRGRGRQVISVARTADLILMVLDPRRHEDRKILENELYE
FT                   MGIRLNKEKPDISLTYTANGGINIGVTLQLTKTTEDTIRAILREYKINNCQMFIREDVC
FT                   DDDVIDLISGSAVYIDCLYVYNKIDELSLEDFNKIAECPNSTPISCQKGWNIDALLEDI
FT                   WSKLKLTRVYTKKKGIPPALDNPVVIKEGGTVRDLCVQIHKDFLQGFKYALVWGTSAKH
FT                   SPQKVGLGHMLEDEDVVQIFLK"
FT   gene            complement(<129265..>130587)
FT                   /locus_tag="Eint_081280"
FT   mRNA            complement(<129265..>130587)
FT                   /locus_tag="Eint_081280"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(129265..130587)
FT                   /codon_start=1
FT                   /gene_family="HOG000149883" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081280"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1280"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U3"
FT                   /protein_id="ADM12060.1"
FT                   /translation="MALIKARIFKNVKDEWEDLCTGTILYIAKNCIFVEDDRSERCIEI
FT                   SLCQKHCGRSEKNVAIVYDDFEEYAICFEGEEIRDSFAEFMEKTFWSLEELDRERECTS
FT                   FGKEVNLFAELLGIGKYADNSVFEKMLESRDGVLELLKMESLHLFKMLLKNGEKVFELF
FT                   EVPSKSRVTPYGFYREIIEKNLGGSTARTFEDFLIIINRQELARSESKITEMSDEEIRD
FT                   LLKRCSGNGYKIGSVETYLERIHRPKENIYLFETFYYLCFIFREKMSEAVDFKYILSKI
FT                   KDLVSRKPLDDSLLYALEGLYILLDVCKSEKLDTFYTEVFNLLGIMEHHPDFQNLLLYL
FT                   LNNHGFRAREFLINTGLMKKIFLSDHRDGVNEVFVSKVLLHTVSCSSRFTHRYFIRNDL
FT                   FKNVARMYKKREKDAVYSIFLQAYSKADGDMKIYLDRYMQN"
FT   gene            complement(<130662..>131618)
FT                   /locus_tag="Eint_081290"
FT   mRNA            complement(<130662..>131618)
FT                   /locus_tag="Eint_081290"
FT                   /product="type II protein farnesyltransferase subunit beta"
FT   CDS_pept        complement(130662..131618)
FT                   /codon_start=1
FT                   /gene_family="HOG000180334" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081290"
FT                   /product="type II protein farnesyltransferase subunit beta"
FT                   /note="similar to ECU08_1290"
FT                   /db_xref="GOA:E0S8U4"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U4"
FT                   /protein_id="ADM12061.1"
FT                   /translation="MSLKVDEHCSFIQSMIDTKNFLYYLTEPYRLSTIYWSVNSLSMLG
FT                   REEMLRMKDRIIEYVMNCKNDDGGFGGCKGYPSNITSTFHALQILYIYRIAYRDRNTAL
FT                   FISGLLQPEGYFYNDRYGEIDTRISCCGVLGLQLLSLLERGDFDPESLSRPACKVFLSE
FT                   VGVDLKAIVQYIQKCYNLDGGFGAVEGAESHAAQVFCCLSTLRSLGALELVDKESISRF
FT                   IVKKQARSGGLSGRVSKKEDVCYSFWAYSSLVLIGKENCVNQERLENFILSCQGRSGGF
FT                   SDRPGDEVDLYHLMFSLAGLSLLGYKGLKKIDPGFGL"
FT   gene            <131787..>133466
FT                   /locus_tag="Eint_081300"
FT   mRNA            <131787..>133466
FT                   /locus_tag="Eint_081300"
FT                   /product="ATP/ADP translocase"
FT   CDS_pept        131787..133466
FT                   /codon_start=1
FT                   /gene_family="HOG000149299" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081300"
FT                   /product="ATP/ADP translocase"
FT                   /note="similar to ECU08_1300"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8U5"
FT                   /protein_id="ADM12062.1"
FT                   /translation="MNEVESNNHTPLHPDIPTEDQIEEEANSRRGILRYFRVAKVEYTK
FT                   FTVLGLMFGIIGFIYSFMRILKDMFVMVRQEPTTILFIKIFYILPVSMALVFLIQYMLG
FT                   TKTVSRIFSIFCGGFASLFFFCGVVFLIEEQVAPSKFLFRDMFVDGKMSTRGLNVFKSM
FT                   FLTLNEPLATIVFISAEMWGSLVLSYLFLSFLNESCTIKQFSRFIPPLIIITNVSLFLS
FT                   ATVAGAFFKLREKLAYQQNQFLLSGIFISQGLLVVLVIFLKIYLERVAMKKPLFIVSSG
FT                   SRRKKAKPNVSFSEGLEIMSQSKLLLAMSLIVLFFNISYNMIESTFKVGVKVAAEYFNE
FT                   EKGKYSGKFNRIDQYLTSTVVICLNLSPFSSYVETRGFLLVGVITPIVTLLAITLFLGS
FT                   SLYNTSMEESGIGIVNSLFPRGKPLYILENYSGIIFMSLLKITKYSAFDICKEKLGMRI
FT                   NPTYRARFKSVYDGIFGKLGKSIGSIYGLLMFEALDTEDLRKATPITVGIIFIFVVMWI
FT                   KAIIYLSRSYDSAVLHNRDVDIDMTEKAKKSMETSEPSKAVD"
FT   gene            complement(<133503..>133769)
FT                   /locus_tag="Eint_081310"
FT   mRNA            complement(<133503..>133769)
FT                   /locus_tag="Eint_081310"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(133503..133769)
FT                   /codon_start=1
FT                   /gene_family="HOG000149881" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081310"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1320"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C5"
FT                   /protein_id="ADM12063.1"
FT                   /translation="MQEAKSIPMARSLLLLMFISTCVTKMYTSISFLEYATLQCILACL
FT                   FILSVSVYGAFRIRNRDKENKSYMERIARYGFFNSSSKAEGHI"
FT   gene            complement(<133832..>134131)
FT                   /locus_tag="Eint_081320"
FT   mRNA            complement(<133832..>134131)
FT                   /locus_tag="Eint_081320"
FT                   /product="DNA-directed RNA polymerase I subunit M"
FT   CDS_pept        complement(133832..134131)
FT                   /codon_start=1
FT                   /gene_family="HOG000228133" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081320"
FT                   /product="DNA-directed RNA polymerase I subunit M"
FT                   /note="similar to ECU08_1330"
FT                   /db_xref="GOA:E0S8C6"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C6"
FT                   /protein_id="ADM12064.1"
FT                   /translation="MFCICGTLIYIKSNSSKVECLRCKRENSIEMIKPVFTEIEVQRDS
FT                   HIEVIEVEGAKIKHRCPGCGAEEMMYNTVQLRSTDEGQTVFYSCECGYRLTVES"
FT   gene            <134313..>135542
FT                   /locus_tag="Eint_081330"
FT   mRNA            <134313..>135542
FT                   /locus_tag="Eint_081330"
FT                   /product="hypothetical protein"
FT   CDS_pept        134313..135542
FT                   /codon_start=1
FT                   /gene_family="HOG000149880" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081330"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1340"
FT                   /db_xref="GOA:E0S8C7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C7"
FT                   /protein_id="ADM12065.1"
FT                   /translation="MGGVQIGGKIGRSMDGKMKEGDMKKSRNIHLDLEEVAMCSIEALK
FT                   ANPSNVEALYSLGKYHIENKNIDEVETIANKLFELEEESYEACVLSGHIGLQTSELDKS
FT                   YENFVKAYGKVEYKDKFLIYGISLFYEALGDYASERPWLVLLNKLGVEEYKSYEVLFRT
FT                   GVCLKKMNRLQDSINVFRVILYDPVSDTYDPYAQIQMAHLYEMQSKHDLAIEILSRIKK
FT                   EGKLNLMVSRLHAWIDFKVGNFRRVRKRHKEDSDTIDDPYLLYLAGRIKYMEKNYTDAL
FT                   RKYMKVIQTDSICGMVHNSIGCIYLRQGNLVSAKIAFINALEANPRFSEASMNLKHIEK
FT                   IIPKKTKETIEPLEDILYNPRELPPSIGRTRYLDSGGVFSDPVYNIHPRMFRILLPMKT
FT                   SKLELLPGRS"
FT   gene            <135701..>136564
FT                   /locus_tag="Eint_081340"
FT   mRNA            <135701..>136564
FT                   /locus_tag="Eint_081340"
FT                   /product="longevity assurance protein 1"
FT   CDS_pept        135701..136564
FT                   /codon_start=1
FT                   /gene_family="HOG000149298" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081340"
FT                   /product="longevity assurance protein 1"
FT                   /note="similar to ECU08_1350"
FT                   /db_xref="GOA:E0S8C8"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C8"
FT                   /protein_id="ADM12066.1"
FT                   /translation="MRFPTITVDRERDFNTHFAFPRDIYLLMALSLMIVMVKNLMILPM
FT                   ASTLIKRFGMEKSLEFERKKKFSISLWKALFYSFTSIYGYFVIRSEPEAYTMENLIGTW
FT                   GIHRTPSKVLFYYYLEFTYYFVELFYLFSEHMYKDFLQMVAHHIVTMLLLFLSYHKDLL
FT                   RPGVIIIAIHDISDPFLEISKLINYIRYKPLATNIFICFAGVFFVSRIGIYTPLITFPI
FT                   CITIWEHEFGRVLTFISVLLQGLVCMHVIWFWIILKMIKKIVRKEEFEDIRSVKPQGSS
FT                   IHIKCK"
FT   gene            <136612..>137358
FT                   /locus_tag="Eint_081350"
FT   mRNA            <136612..>137358
FT                   /locus_tag="Eint_081350"
FT                   /product="hypothetical protein"
FT   CDS_pept        136612..137358
FT                   /codon_start=1
FT                   /gene_family="HOG000149879" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081350"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1370"
FT                   /db_xref="GOA:E0S8C9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C9"
FT                   /protein_id="ADM12067.1"
FT                   /translation="MIMVLLVYQLVLAIETCRFVKYFCDEQGIKVPEQIMDDYNEAEGE
FT                   FGNDPESFDFIFHNGGEMDIFQYKIGVELVASVFLVRRTFYMIVDEEPVGRSVVLLYTM
FT                   YVSKKYRGKGYSKRILKDALDSLNSHYGMNGDFLVVLHLDPKDRDMALAFSLYYNLNFR
FT                   NGGFSMTGPGEKQYFLEEILEYRDPCDAVDKYNEKRDKGLHMIMFCEYSKLFTCKKIPY
FT                   ERLMEYGSRLKSILRSNKPVETQSMS"
FT   gene            <137460..>137843
FT                   /locus_tag="Eint_081360"
FT   mRNA            <137460..>137843
FT                   /locus_tag="Eint_081360"
FT                   /product="glutaredoxin-like protein"
FT   CDS_pept        137460..137843
FT                   /codon_start=1
FT                   /gene_family="HOG000149878" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081360"
FT                   /product="glutaredoxin-like protein"
FT                   /note="similar to ECU08_1380"
FT                   /db_xref="GOA:E0S8D0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D0"
FT                   /protein_id="ADM12068.1"
FT                   /translation="MLLIYGIQGIEIEWSISEKDTDYEKIIREEKCVLFIKKFCPFSIK
FT                   ARELLYNKGISCKIIPVDGRIKPYNFAKTYQSTFPVFFFNGTFIEGGYQKLKDLSIHKL
FT                   PPFDQSPLFTEGSYEASFRSKIK"
FT   gene            complement(<137850..>138356)
FT                   /locus_tag="Eint_081370"
FT   mRNA            complement(<137850..>138356)
FT                   /locus_tag="Eint_081370"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(137850..138356)
FT                   /codon_start=1
FT                   /gene_family="HOG000149877" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081370"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1390"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D1"
FT                   /protein_id="ADM12069.1"
FT                   /translation="MSYRFYCVLDIKTLYEKIYLTPISLLGKMKSLHFFHYIALVVSVG
FT                   VVYTKTMEVTGQKAVGFEAAKRTGGFETSTIGEKLKGPGIVAVLEQNCNQSRQLEDTLK
FT                   SLGVPYQPFYVEENLDLYSTAISKNGGEIPLLYEDGKKVENVVDFLKKYKEEHTKTENK
FT                   DANEK"
FT   gene            complement(<138469..>139158)
FT                   /locus_tag="Eint_081380"
FT   mRNA            complement(<138469..>139158)
FT                   /locus_tag="Eint_081380"
FT                   /product="GATA binding factor 1-like protein"
FT   CDS_pept        complement(138469..139158)
FT                   /codon_start=1
FT                   /gene_family="HOG000149876" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081380"
FT                   /product="GATA binding factor 1-like protein"
FT                   /note="similar to ECU08_1400"
FT                   /db_xref="GOA:E0S8D3"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D3"
FT                   /protein_id="ADM12070.1"
FT                   /translation="MLSKQGFCSNCNTTATPLWRRAEDGSYLCNACGLYYKIHGRKRPT
FT                   NFKADSGKSRVRCRRVVEETGNGHRATGWTLHEHRSGVQDQSNIYQEENQRNLGAKPSD
FT                   YQMKHDGFKRNREIISVDSDKDVFYDDFGGPRDERRTLSGSRGNYRHDTNTAATSLIRR
FT                   HFDKRPGKIPQFMIGSEGKEKVSNSEEREKDAIEMQTKERDEHEIDLEDFEVIAVNALL
FT                   DLSRERI"
FT   gene            complement(<139366..>140127)
FT                   /locus_tag="Eint_081390"
FT   mRNA            complement(<139366..>140127)
FT                   /locus_tag="Eint_081390"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(139366..140127)
FT                   /codon_start=1
FT                   /gene_family="HOG000149875" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081390"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1410"
FT                   /db_xref="GOA:E0S8D4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D4"
FT                   /protein_id="ADM12071.1"
FT                   /translation="MCLQMSVYRISAYVILQMFDVSVYMPLYAIDEGSCLGEKLTLKDV
FT                   KIETRAIPKLFGHLAKQEGEGKDYWMDSLEIYRIEDKENINSRTEEMSKNITFGTMSFD
FT                   FSMLKAILSQDSQRNLGHSPEIKIKSIEVKIPLAIQVFLHIPIVLVAAIVFYLFLSFGI
FT                   EEVEGLSSKEIEKILLCPYSSQEFINKGCIICLEDFEEGGYVRNLGCGHAFHKECVDKW
FT                   FLRNLACPICRSRISTGHSRERRERRRVHIL"
FT   gene            <140293..>141687
FT                   /locus_tag="Eint_081400"
FT   mRNA            <140293..>141687
FT                   /locus_tag="Eint_081400"
FT                   /product="phosphoinositide polyphosphatase"
FT   CDS_pept        140293..141687
FT                   /codon_start=1
FT                   /gene_family="HOG000149874" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081400"
FT                   /product="phosphoinositide polyphosphatase"
FT                   /note="similar to ECU08_1420"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D5"
FT                   /protein_id="ADM12072.1"
FT                   /translation="MARLVYSASSKRISWETESGVATLCCVGTTDKKPDSKQIEFQTIL
FT                   GILQVEKNEYCEEFLACVTKSTLTGLYDGIEIYKIDKIRFLNINEPDRADEIMSQVKGF
FT                   MQSHDFYYFSASLFIEDEFVWNKHMKDNLLKYFGPNPHRWILSHRPERQSLNLGISTLF
FT                   CGFFAAKAFKVSEDFYHMKLLSLVSSSRVGTRYLCRGIDNEGNASLFVKTHFLTKRNNI
FT                   TIFDFTIIRGSVPIFWNQMEYGISTKINIYGDEDGVRKAFAKHFKKLKREYGKVHVINL
FT                   LGEKKHEKQLTLHFNRLLDLEDIPHTTFDLNAHANNYDDLKFLLYFKLQSIDMKDTVFR
FT                   VNCLDCLDRTNVAQSLICMFYFEKVVRSEEVLKKMQECWADNGNSLSNLYTGSDAMKRE
FT                   LALKGRRSFIGYMDDFVISATRLINGRFTDRQKHSIINVLLEKKEDSEEIGALSLDMEI
FT                   INRPIS"
FT   gene            <142039..>142836
FT                   /locus_tag="Eint_081410"
FT   mRNA            <142039..>142836
FT                   /locus_tag="Eint_081410"
FT                   /product="DHHC-type zinc finger domain-containing protein"
FT   CDS_pept        142039..142836
FT                   /codon_start=1
FT                   /gene_family="HOG000149873" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081410"
FT                   /product="DHHC-type zinc finger domain-containing protein"
FT                   /note="similar to ECU08_1430"
FT                   /db_xref="GOA:E0S8D6"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D6"
FT                   /protein_id="ADM12073.1"
FT                   /translation="MSIKAHESCSDQLRTRFVMFLHIKMYIGTLMYCLLLVKTFYGSLC
FT                   LVLLVVANSLSFLKACLNDPGRVNKKTYHKYLPDVVAFEKNISTQICTNKNGDWIRAIR
FT                   INGTEYEEKYCLECNLFRIGGMSHCRECNRCILDMDHHCLWFGNCIGRNNIRHFHIYLY
FT                   TLVAVILVNAALLYSLIAIYPWRNTPPGLALKTFLFLLAVLYTLFFCVIFLFTAFNIYV
FT                   ALNSSTSKDFIKNGLKNKRFDLKRACRNLSRIRPEMSSSQPSV"
FT   gene            complement(<142905..>144911)
FT                   /locus_tag="Eint_081420"
FT   mRNA            complement(<142905..>144911)
FT                   /locus_tag="Eint_081420"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(142905..144911)
FT                   /codon_start=1
FT                   /gene_family="HOG000149872" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081420"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1440"
FT                   /db_xref="GOA:E0S8D7"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D7"
FT                   /protein_id="ADM12074.1"
FT                   /translation="MLLHHPPYSSAKLFHLSFDSFQLDLNWRKYVTHKRMRFSNTLRAN
FT                   QVDEWKDNYVSYETLKPLLSQDREEFKTRINGELRKINDFFFLLEKKAMLEKEEIFADA
FT                   GVSPEEKSPKDPGVRIRDSQKKAMCLSDDYGMGRDDQQDRLRVKSDMKMELDEEGDDED
FT                   SKGSSTSSEDRNSRFEYLIKKVRKGTDEKGIGEIFKISKRLERRRREKNIQEFLHAVIS
FT                   IKRFRELNYTGLMKLSKKYDKAYPQERFHEHFSRNVNESYFNKSSRIDDIYRSVKELYR
FT                   SVFAKDNPAKAKTVFKKLRVKTKADPLISYVSGALGGISLGMMGLINFGKSQMDKELFF
FT                   SMVLLQYGAFLFGTSLVIFKRFHINYKFIFNFDMCSSLTSDKYLFLVSLSIFANVVGTW
FT                   INISFLHLNPYYLLLGHLLIILIPFKVLHYESRFYLLLIVFRIIVFPMSFVRFRHFYFA
FT                   DVGQSFTPCFKKIFFCGRHLNWKVEGYANSFFAIIRFLQCIRRYRDTRLKFPHIANALK
FT                   YSFAILTGFSIPLYATKRTWELFVYKMMVITISSIYSATWDLFMDWGIIRSKMIYPRCT
FT                   YSCGIVFNVLCRFSWVFFYWFEIPVFWIVFLEITRRFVWTIFRVEFEHLNNCSEFKSKD
FT                   SMLLTSRELFYKRDYQADGRPNDTETENDSSVA"
FT   gene            <145054..>146346
FT                   /locus_tag="Eint_081430"
FT   mRNA            <145054..>146346
FT                   /locus_tag="Eint_081430"
FT                   /product="N2,N2-dimethylguanosine tRNA methyltransferase"
FT   CDS_pept        145054..146346
FT                   /codon_start=1
FT                   /gene_family="HOG000149297" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081430"
FT                   /product="N2,N2-dimethylguanosine tRNA methyltransferase"
FT                   /note="similar to ECU08_1450"
FT                   /db_xref="GOA:E0S8D8"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D8"
FT                   /protein_id="ADM12075.1"
FT                   /translation="MEDSGSKETIQEESTTIIKNERTFFNPAQKFNRDISVEIIRECFK
FT                   DSTSIRILDAMSATGLRGIRYLKEIENSRVYLNDISQSSVETIKANILLNGIEDVECFE
FT                   SVFQNIKTSKDVRATITKSDCNVLMASLPCFFDVIDIDPFGSCSEYIDSALRAIRHRGI
FT                   ICLTATDKGVLCSNERKCLIKYSTSIMKGVGTNEVPLRTIISLVSRQASKFDCSVEPVA
FT                   SLSIDFYVRIFLRIVRRNPRSVIEKNSLFWMCTCHNIFEVRNGEDISNKCDNCSRRMKL
FT                   CGPFWNGPLNDINVIQGVLNRAKEDNKRLIGVLRHLEQELPTMFYYEIPRLCSILGISS
FT                   VKQLRVMHALANMGYRVSYTHSELNAIKTDAPIGLINKVLLLSDGSNQEKAEVLGLKFE
FT                   GNKNIEALETIEFFKGLIKSGMGPLSLPKKH"
FT   gene            <146445..>146888
FT                   /locus_tag="Eint_081440"
FT   mRNA            <146445..>146888
FT                   /locus_tag="Eint_081440"
FT                   /product="hypothetical protein"
FT   CDS_pept        146445..146888
FT                   /codon_start=1
FT                   /gene_family="HOG000149870" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081440"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1470"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8D9"
FT                   /protein_id="ADM12076.1"
FT                   /translation="MSWKFLNVLKERTGVESITKEQVKGIKELVRKAHEWDEKKAREHM
FT                   NLVLKMPEEEYSKLWKIDLYSISDCDKEKLKNLDQKTVFNNIMWLSRNVEKIDSSMRKF
FT                   LGMHVWVVNYWIKTVGSSTVRKFLRENNYSGEFVYFLYKYFNL"
FT   gene            complement(<146878..>148311)
FT                   /locus_tag="Eint_081450"
FT   mRNA            complement(<146878..>148311)
FT                   /locus_tag="Eint_081450"
FT                   /product="serine/threonine protein kinase"
FT   CDS_pept        complement(146878..148311)
FT                   /codon_start=1
FT                   /gene_family="HOG000149296" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081450"
FT                   /product="serine/threonine protein kinase"
FT                   /note="similar to ECU08_1480"
FT                   /db_xref="GOA:E0S8E0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E0"
FT                   /protein_id="ADM12077.1"
FT                   /translation="MHLQRKFLNFDITGVLGSGSYGDVLSAVDKITGMDVAIKFAKKDV
FT                   DQWKNSFEPKIQLILDHENICKLYGCISTSRNLVLVLELVRGIDLHKYIRRNGRLSETH
FT                   ARSLFVQMLYGVDYLHSHSIVHRDLKLENIMISGESVKICDFGLSAFYDRSSVLKDYCG
FT                   TPQCAPPEIMRGIPYVGPEVDIWCLGVILYAMVHGRLPFEDADISLMGRNAILSKMKID
FT                   GSLSDELKDLIRRIIEPDRSMRIEIDQIMKHPWINVTREDHRKRIIFIDGKVIERLIEI
FT                   GFRKEDVLNNITDKNSREYSAYCLVNRKLLSGNLLLVPGEVCLCRPYSIVDLSFMVDEK
FT                   AAQTHQRRTWRHEILRGMKPIRGGCFLPFLWNRRKMYAVKRDINLSLEMSRILIERSLS
FT                   AFPKVTFRKKSGYTVHHSNGLLVKIELSEKIPFTTCTLTLAEGSKIEFIDFVVNFILFV
FT                   SQDGEKDAAINWKGQVFRD"
FT   gene            <148484..>149635
FT                   /locus_tag="Eint_081460"
FT   mRNA            <148484..>149635
FT                   /locus_tag="Eint_081460"
FT                   /product="hypothetical protein"
FT   CDS_pept        148484..149635
FT                   /codon_start=1
FT                   /gene_family="HOG000149869" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081460"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1490"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E1"
FT                   /protein_id="ADM12078.1"
FT                   /translation="MEDKVMLFIYLALTYAMEEMGYIFSEGKQRFLTRNGVNIVVGRSK
FT                   DKPLKFRMVEMDGKNSHNMLLFPVPKMGGNKVADLALNGSRKWHFYPKHGNWNQRTKFI
FT                   LLPGNALKIVVGSECIGVREDNQVVGETCRNNGEDLFQIFSWIPISQKKKVKAWFHRNR
FT                   YEQEEENQNFPEDDRDSGSEDKNYGPDNSPYDSETSSSDYWRGERQFYDFDYDGGLGGG
FT                   YGSFGLGMGSLGGRRRRYRRDEDHLKFTEDGEEDTYKSDGGKDYREERMFRRKRMGNYS
FT                   GHRKGRHHKGSKELDGGFLQGRDMMFGDLSSSEMMDYFGNLQEYDRKNRALRGNPPNGC
FT                   GNLDGIVFAEGSNNCNTGGPGENEICRINKTTTAFRKMVGIPI"
FT   gene            <149798..>150445
FT                   /locus_tag="Eint_081470"
FT   mRNA            <149798..>150445
FT                   /locus_tag="Eint_081470"
FT                   /product="DHHC-type zinc finger domain-containing protein"
FT   CDS_pept        149798..150445
FT                   /codon_start=1
FT                   /gene_family="HOG000149868" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081470"
FT                   /product="DHHC-type zinc finger domain-containing protein"
FT                   /note="similar to ECU08_1500"
FT                   /db_xref="GOA:E0S8E2"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E2"
FT                   /protein_id="ADM12079.1"
FT                   /translation="MEAWKMINKLVAYIELLIVTFVILLYLLGLYEAAIVSGVSFRIYL
FT                   LLTSFYYYVGCLAKSPGQLLDFGNANVKGICNRCNRIVGTKTVHCEICNKCYHKRDHHC
FT                   PIIGRCVASNNLKDLYLAVFFMSLHSLAAVLRGSTKFAYMMSIHKYLLAMSSAFTCWLT
FT                   LLILTGKTTKELTRAKGNITSEMKISRLKDMFRNGLMDTLVPYLKWKTHIVR"
FT   gene            complement(<150503..>150958)
FT                   /locus_tag="Eint_081480"
FT   mRNA            complement(<150503..>150958)
FT                   /locus_tag="Eint_081480"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(150503..150958)
FT                   /codon_start=1
FT                   /gene_family="HOG000149867" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081480"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1510"
FT                   /db_xref="GOA:E0S8E3"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E3"
FT                   /protein_id="ADM12080.1"
FT                   /translation="MNHLKFLTIVDSNAVRSSDLNQETSNLLKGIVKEIKTCQSARRGS
FT                   DLVFVLPEPRIVLPKQYLKEHVETRWERFARAKGIKRRKKGSLVYDEEIGEYIPRYGPH
FT                   SKKNRILKAAVKDGEITVSALRRQRKNNIEKNEANRLANIFRRRENS"
FT   gene            complement(<150991..>152028)
FT                   /locus_tag="Eint_081490"
FT   mRNA            complement(<150991..>152028)
FT                   /locus_tag="Eint_081490"
FT                   /product="vacuolar-type H+-ATPase subunit C"
FT   CDS_pept        complement(150991..152028)
FT                   /codon_start=1
FT                   /gene_family="HOG000149295" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081490"
FT                   /product="vacuolar-type H+-ATPase subunit C"
FT                   /note="similar to ECU08_1520"
FT                   /db_xref="GOA:E0S8E4"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8E4"
FT                   /protein_id="ADM12081.1"
FT                   /translation="MNRQIPYLFWHISPLMEKQFNHVEKYGYIISEINGKKEEMLKEED
FT                   YNALKRCESLEEVAIKLSRTYRGLSEGIAYTKPELKKKLLEALKSDFNYYHDAEDKGIR
FT                   TILDYYMDFHKIQNFFYLLQCKLQDPNLEKSFEKIEIGDFSALRTIKFSNDMDDVQRYC
FT                   IENSFLRKFERKVKFKKEFSANNFQILQTLFFKFHIEETFRNLNDDMDHMREILKLEGD
FT                   RQIIEITVNTLNSKDVVGKKRMRLFPDVHSMSLKTRELLSHVESLDDIKSILSETYDFD
FT                   SDISNVLIKAELQKYQESFRMYGDLSCVYSYFKMKEQEIKNILWVAECIVQNRRDAMDH
FT                   LFVVR"
FT   gene            <152048..>152983
FT                   /locus_tag="Eint_081500"
FT   mRNA            <152048..>152983
FT                   /locus_tag="Eint_081500"
FT                   /product="putative pseudouridylate synthase"
FT   CDS_pept        152048..152983
FT                   /codon_start=1
FT                   /gene_family="HOG000149866" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081500"
FT                   /product="putative pseudouridylate synthase"
FT                   /note="similar to ECU08_1530"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M6"
FT                   /protein_id="ADM12082.1"
FT                   /translation="MNEEHVLCMVESMVGANQGEMYENKVYSVSDGSKGKIDKAALKNR
FT                   LPQGDWNSPYTEIMVRVEDDVKISVQNSPIYIYGEYTKMDRNMTQSPLVVEGRLKCNRS
FT                   VSDFKSQVKEFFLADDVIFTPAGREDFDVRMVEGRPFLLSVKNPRRNLSFERLNLALYK
FT                   EVEIRNLSVVRKECKSVIFGGENQSNKTYSIFLCCKKELALQNYYIVEQRTPLRVLHRR
FT                   ANLARIKKAWILESEKREVEGWIYYRIVLEASAGMYIKEFVNGDFGRTVPSLGSKENYC
FT                   DLLELDVLRVEKKSIEDFLVRNIELDVTRC"
FT   gene            <153027..>153605
FT                   /locus_tag="Eint_081510"
FT   mRNA            <153027..>153605
FT                   /locus_tag="Eint_081510"
FT                   /product="hypothetical protein"
FT   CDS_pept        153027..153605
FT                   /codon_start=1
FT                   /gene_family="HOG000149865" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081510"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1540"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M7"
FT                   /protein_id="ADM12083.1"
FT                   /translation="MSELNGLEENKLDGSLKEKDVGNDNSESGKTYKSTKKRILSMRDE
FT                   SKENPKQVRMSSYYEKKAEESGIRGGDEKGGKNGILKQAIWRRDLSYISEFLLRKDRGL
FT                   MLKTLSYEDKEVLGEILLEFVDQPLRIEALETMREIVSSIKNVGLFIRKLKERAIDFSK
FT                   LIYLKGKIDYLRFTAGNQEEKEPEITVKG"
FT   gene            <153760..>154083
FT                   /locus_tag="Eint_081520"
FT   mRNA            <153760..>154083
FT                   /locus_tag="Eint_081520"
FT                   /product="hypothetical protein"
FT   CDS_pept        153760..154083
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081520"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1550"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M8"
FT                   /protein_id="ADM12084.1"
FT                   /translation="MADSANENNTSGDSGNNKAKRNTIIGIIVCVVVITIILAIGAKRG
FT                   WFGGSNGGAGGSPKGGKVGDLSESSKSKLSESNKKNSAKSSGKEDEENSTSGGMGQSSN
FT                   LYG"
FT   gene            <154355..>154963
FT                   /locus_tag="Eint_081530"
FT   mRNA            <154355..>154963
FT                   /locus_tag="Eint_081530"
FT                   /product="transcriptional activator Spt7"
FT   CDS_pept        154355..154963
FT                   /codon_start=1
FT                   /gene_family="HOG000149864" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081530"
FT                   /product="transcriptional activator Spt7"
FT                   /note="similar to ECU08_1560"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8M9"
FT                   /protein_id="ADM12085.1"
FT                   /translation="MAAKKMWNMFLLGLISTNEKKRKFLDRMLFLPGRLTRILTAIKSF
FT                   DQSKIFLRRVLKKDAPNYYEVIKKPMDLSIVQKKIGKYRSFEEFKADLNLIWDNCLKFN
FT                   QEKYYRDCAFKMREVVSTFEIEVVPVKMDSEFAMGSNVWEGEENQGPAIKWMIRRMIGR
FT                   VLLLSGYGFVSKTALWVFCDVFQHKILEIVKEECKENGK"
FT   gene            <155039..>155698
FT                   /locus_tag="Eint_081540"
FT   mRNA            <155039..>155698
FT                   /locus_tag="Eint_081540"
FT                   /product="60S ribosomal protein L10"
FT   CDS_pept        155039..155698
FT                   /codon_start=1
FT                   /gene_family="HOG000223754" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081540"
FT                   /product="60S ribosomal protein L10"
FT                   /note="similar to ECU08_1570"
FT                   /db_xref="GOA:E0S8N0"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N0"
FT                   /protein_id="ADM12086.1"
FT                   /translation="MGRRPGRCYRYLSKKAYPKSRFNRGVPDSKIQIFDLGRRKAGVLE
FT                   FPLLVNCISNERENLSAEALEAARICANKYMVKHAGKDNFHLRVRVYPFHVLRINKMLS
FT                   CAGADRLQTGMRGSFGKPYGRAARVVFNQPILSIRTKDTFKDVAIEALRRAKNKFPGHQ
FT                   KIQVSSKFGFTNMLRDEFTSLNENGKIILRGGSFSVVKEKGSIDNFKKNLEQVANN"
FT   gene            <155776..>156477
FT                   /locus_tag="Eint_081550"
FT   mRNA            <155776..>156477
FT                   /locus_tag="Eint_081550"
FT                   /product="proteasome subunit alpha type-2-A"
FT   CDS_pept        155776..156477
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081550"
FT                   /product="proteasome subunit alpha type-2-A"
FT                   /note="similar to ECU08_1580"
FT                   /db_xref="GOA:E0S8N1"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N1"
FT                   /protein_id="ADM12087.1"
FT                   /translation="MDFSREKPVTLFSNEGNLGQCDNALRAAINGSLSIGASAGDGAVL
FT                   ISFKDVPPLAIKEEVKKVFKICDTIGCTYSGLQPDCRIQVNMGCRIAEEYYDVYGRYPD
FT                   VDVFTAHFSSVVQEYTQKSGYRPFGTLMIFAGPVKGVPRLYQVDPSGSYQTADVCSSGM
FT                   GYSEAKKFVKRRLESLDDNMVNCVSSVREFAGKEVGPEDIDIGVYYKDKNVFKTFTLDE
FT                   VKEVFDSLGKN"
FT   gene            <156558..>157724
FT                   /locus_tag="Eint_081560"
FT   mRNA            <156558..>157724
FT                   /locus_tag="Eint_081560"
FT                   /product="hypothetical protein"
FT   CDS_pept        156558..157724
FT                   /codon_start=1
FT                   /gene_family="HOG000149863" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081560"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1590"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N2"
FT                   /protein_id="ADM12088.1"
FT                   /translation="MERVEKEISRKIDLCLYGEALQLIHSFPLSYESGISIYPYKGYVL
FT                   YLQRRYEESVTFLKDLLKRFPSNIKAKRFLYLGLLTLGDFGSSFRIAKECWIDGDYRRS
FT                   TLIRILAHSFVLKDFDFLGRLDMHCDEPLLLSMGYIYSGELERAVELMRKINDSHGSEI
FT                   YLDSLISAKTRSVYMLDYVRYLDEEIFIKAIESLENKLKVFEGVEGEGCDYVDSKVLRI
FT                   AKKVLSRGEYEVVEKNIYHGKKMKHCCQKECVIGKLRARAEEDMLLPKKGFRKPKGRYS
FT                   ELEGIFEEIRNGNIEHGLESLKRTYGKETIGDLEKHLKDGQNILVLNEVKESYLRYRKK
FT                   EKALHYAKLEKEAQSLRVRDTIECLEKLMDESMVREIIEFLELDLFDK"
FT   gene            complement(<157768..>159336)
FT                   /locus_tag="Eint_081570"
FT   mRNA            complement(<157768..>159336)
FT                   /locus_tag="Eint_081570"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(157768..159336)
FT                   /codon_start=1
FT                   /gene_family="HOG000149862" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081570"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1600"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N3"
FT                   /protein_id="ADM12089.1"
FT                   /translation="MGNSSMYPDVDQKRFHNILQRSLTQFKLKKPMITNYMIYHLDYLV
FT                   FNFCYFRDIALVSECLCTENSRFNFAFYQKMSVFIRIIDFGSNGSGGDEGNRGDLSIED
FT                   ASSRSLGCSSECVYPMTKEEWIRRSKDALFGSVGEFRENTSDTEDSDDRTKTREILRNF
FT                   EISEYFGDEEDLEYFVFNSTSKVLAYFFEVLAFHFRIHPHYMTEALDGRFVNSFLGLLW
FT                   FEPALNLFSILLGLKGLNMQKLAMLLKDSRPVSVLIERKCYVALKMLLLADWIGDDSGS
FT                   MSSDEEDFFHDEIVSGGEKLISMFLKEESYSEFKQIYDIIEILNCSRRCPKLEVPEFKR
FT                   VDSKLVLYIRLMVGQLDLLMDEIFQKEVYFTLIDLFFGNPDHIPLLISLTIFLSSAIKD
FT                   QSKFSMLIDAGFLDRFHDACIKLISIDKGPRPAIESIFSCLVYIYPLVTFYLAKLNKEL
FT                   LDTDKWVYLSSMMGPYCKIEKLSYSNDEGIELFLNDCADESFARYICHLIVDGMPVPSV
FT                   FLEKK"
FT   gene            complement(<159382..>160053)
FT                   /locus_tag="Eint_081580"
FT   mRNA            complement(<159382..>160053)
FT                   /locus_tag="Eint_081580"
FT                   /product="putative exosome subunit"
FT   CDS_pept        complement(159382..160053)
FT                   /codon_start=1
FT                   /gene_family="HOG000149861" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081580"
FT                   /product="putative exosome subunit"
FT                   /note="similar to ECU08_1610"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N4"
FT                   /protein_id="ADM12090.1"
FT                   /translation="MFTPLNQKKLVNVSVIALRKFGRKYELGVYPNKLYEYRNGMATPL
FT                   SEILLTDTIYRSVSKGEIAKQADLDLFNKTHEEIVLEILNSGHEQKSEVTRAYEQEKTE
FT                   REIIEFLRNKVTRGGRHLNEASLREAINKVHNIYIGNSKKQSQEILSKLEKIGFERVGI
FT                   RVSVGGNDKIMEFARRNGEVHDGYVIIRSECFPKFKEICEEEKVRYLILRREEPEDEEI
FT                   C"
FT   gene            complement(<160142..>161233)
FT                   /locus_tag="Eint_081590"
FT   mRNA            complement(<160142..>161233)
FT                   /locus_tag="Eint_081590"
FT                   /product="Ser/Thr protein kinase"
FT   CDS_pept        complement(160142..161233)
FT                   /codon_start=1
FT                   /gene_family="HOG000149294" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081590"
FT                   /product="Ser/Thr protein kinase"
FT                   /note="similar to ECU08_1620"
FT                   /db_xref="GOA:E0S8N5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N5"
FT                   /protein_id="ADM12091.1"
FT                   /translation="MTYLKKIYMLKREREEAMFSSPKTPSKRIPYKDMFIPSMPFVTDV
FT                   QDSSLTTDDPASCDVFGCTDKDTGSDTGKESTCNFICKTGEGAFYEVFVNQRDGRGEAN
FT                   HHLEEPVMLYKSRKLCVYDTDYTIVKKSKKRISGELDRKNRMREIEMLKGIESEYVVKY
FT                   YDFWESRGYLFIELEYCNIGTLRDYIHEVYFLRKSKFSPGITKKMMYELASGLEVIHSC
FT                   GIVHLDLKPENILMKSVISREKCPERCQCMFPTDPGSFVFKISDFNISRYEGEDIDDDG
FT                   DKRYMAPEVLQDVCTKASDIYSLGLIYLEVIAEIILPKSGDNWMRLRRNDFRGVKLDRV
FT                   CKLMLDMNYKKRLNAKEVIDMFT"
FT   gene            complement(<161361..>162287)
FT                   /locus_tag="Eint_081600"
FT   mRNA            complement(<161361..>162287)
FT                   /locus_tag="Eint_081600"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(161361..162287)
FT                   /codon_start=1
FT                   /gene_family="HOG000149859" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081600"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1630"
FT                   /db_xref="GOA:E0S8N6"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8N6"
FT                   /protein_id="ADM12092.1"
FT                   /translation="MKNVCRFFIEGKCKFGSKCKYDHVRYTSLVDPPQWIYSSYRGLDL
FT                   MEISPEEVRFALMCGDMKEVLDNFWIGNYMTLCAEMDFLESDARIESVSNRYVDPRENP
FT                   DVFMSPFDVSRVLNTIRQMREQGAGSLQKDSRRGDGNWTGVSSGSPRQYSTGDRGYRDK
FT                   GHGWGSGEPNTRAGWAQGSKAGDRGSYGGHKGGYGERDPRGFVREPPYPKGKDSEYRQK
FT                   NEWGYGKNINRKYSKPEDEFDIQDSPSSFTGAYGRTVQKTGDGAWIHSSEALGDRQIGG
FT                   RGSGDEEFIEEDFEYGKVPYSYRKPNR"
FT   gene            complement(<162443..>163558)
FT                   /locus_tag="Eint_081610"
FT   mRNA            complement(<162443..>163558)
FT                   /locus_tag="Eint_081610"
FT                   /product="putative bromodomain-containing transcription
FT                   factor"
FT   CDS_pept        complement(162443..163558)
FT                   /codon_start=1
FT                   /gene_family="HOG000149293" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081610"
FT                   /product="putative bromodomain-containing transcription
FT                   factor"
FT                   /note="similar to ECU08_1640"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q5"
FT                   /protein_id="ADM12093.1"
FT                   /translation="MEEDEVNSGNILIEYQLKYCSQILTRLKRNSNAPPFLEPVDPVKL
FT                   GIPDYPEKIKHPMDLSTIRKKLDHKEYEGVEGFDGDMKLMFNNCYTYNPPGTVVHDMGK
FT                   ALETVYNGLMEGMPQEVPKKRKKTETPVSGRPKQPKRSVKPVDGGMKTEDYEFCSEVLA
FT                   DLMRPKHKAYNWPFLEPVDAELVPGYYSIIKEPMDMQTIRIKLEQRKYQSTDEFERDLE
FT                   LIVENCKKFNAPGTEVYECGQEFEKAVKAHMQKSPPGDIKGRISELKRKIMSYTREIRM
FT                   LESKLAEQTGETSASRAYSLSERVSIGNAILNMSKDQTESVAKIVLKNGAGEFVENDEI
FT                   EVDMRTIPDHVVEEIDMYIKSINVGEDVRDE"
FT   gene            complement(<163757..>164713)
FT                   /locus_tag="Eint_081620"
FT   mRNA            complement(<163757..>164713)
FT                   /locus_tag="Eint_081620"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(163757..164713)
FT                   /codon_start=1
FT                   /gene_family="HOG000149858" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081620"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1650"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q6"
FT                   /protein_id="ADM12094.1"
FT                   /translation="MDIEKKISSMIKLAGKKLEDFRYMASIALNFLECFLYSFVGIICL
FT                   IHSYDPIKSELFKYVSCILIAMGVVDGLHKIPTTYLIKTRKKASESRIIRWLERFRRAL
FT                   IGNKINEVIDFFGIFLMIFAISVMISSIWINITSLPSDNQDFGAIAKSLFCSSGLYSLL
FT                   SLLYSLYNLFRQGYEYIVGFQRRETYSNSAGVVIIFEDSGKELHGADKEPFSKMPVITL
FT                   PEVVFMLIFIIWGFIRGGSSYMKKTLTPTFVILRVSTTILQYMVPFFRYSGNKNLTLFP
FT                   IIFISLLSFSSYISGPNKDEIKKLLTSTSSSATTTTS"
FT   gene            <164817..>165167
FT                   /locus_tag="Eint_081630"
FT   mRNA            <164817..>165167
FT                   /locus_tag="Eint_081630"
FT                   /product="transcription elongation factor Spt4"
FT   CDS_pept        164817..165167
FT                   /codon_start=1
FT                   /gene_family="HOG000172685" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081630"
FT                   /product="transcription elongation factor Spt4"
FT                   /note="similar to ECU08_1660"
FT                   /db_xref="GOA:E0S8Q7"
FT                   /db_xref="InterPro:IPR009287"
FT                   /db_xref="InterPro:IPR016046"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q7"
FT                   /protein_id="ADM12095.1"
FT                   /translation="MEEKFKGTLSGKLRACLGCSQIKTLNGFRKDGCENCPMLEMKGNL
FT                   SNVNECTTSNFRGVVALLQPSNSWVGKWQRIGEFKKGLYAMVVEGVLSEDFVKDIEQDG
FT                   RIYYERTESFKL"
FT   gene            <165218..>165610
FT                   /locus_tag="Eint_081640"
FT   mRNA            <165218..>165610
FT                   /locus_tag="Eint_081640"
FT                   /product="hypothetical protein"
FT   CDS_pept        165218..165610
FT                   /codon_start=1
FT                   /gene_family="HOG000149857" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081640"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1670"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q8"
FT                   /protein_id="ADM12096.1"
FT                   /translation="MEKIDLENADDAILREKLFVKVATKHLRTLEFKMVEEGYDGELMR
FT                   SRKEIEEGEKDRQRKAEKMIKRHSEMRLKKKSRDRELDSDDIEGEEFIAPMLSRKETRR
FT                   KNKGKHFGKKSFKRKQMKKRQKRHRH"
FT   gene            <165809..>166411
FT                   /locus_tag="Eint_081650"
FT   mRNA            <165809..>166411
FT                   /locus_tag="Eint_081650"
FT                   /product="hypothetical protein"
FT   CDS_pept        165809..166411
FT                   /codon_start=1
FT                   /gene_family="HOG000149856" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081650"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1680"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8Q9"
FT                   /protein_id="ADM12097.1"
FT                   /translation="MSMDYREHMPMNDTTLSRFRQFLGTSIHDGYTRHRICKSLKKSHT
FT                   NLYTILTAKSLFDKMKRDLPNHIERMNKRSSWDVNKFASNRRGRELEKMLGNEYLLFIG
FT                   CIIISSKIYMDLSYTNFSWIEICHHGIDQINATEKLILQVLDYDVSLQWIELKKMYDEF
FT                   GTMPGEILSGQIEMKQRKGFFKWAFGSLFRLISCVDT"
FT   gene            complement(<166498..>167223)
FT                   /locus_tag="Eint_081660"
FT   mRNA            complement(<166498..>167223)
FT                   /locus_tag="Eint_081660"
FT                   /product="putative ARF GTPase activating protein"
FT   CDS_pept        complement(166498..167223)
FT                   /codon_start=1
FT                   /gene_family="HOG000149855" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081660"
FT                   /product="putative ARF GTPase activating protein"
FT                   /note="similar to ECU08_1690"
FT                   /db_xref="GOA:E0S8R0"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R0"
FT                   /protein_id="ADM12098.1"
FT                   /translation="MSGDEVLDKSLVNKFFKYARMQSNNKRCADCSNSSPIWVTVTYGF
FT                   FICTECAAKHRELGVGITKVKSTILDTWSLSELRRVYVSGNSNAPKLGKDTDLRAKYTK
FT                   AKWYSDAVSELSEKNKEDEPGISFIENLTKRSERALEPRKVEEKKMPKFSDSNAKYVEE
FT                   KNTMSEKQPDLPREPRDKINKPVAIRKNSFPSLQTSQTEGFNVEDRGSDVRKLGFGALK
FT                   VQKRSEDNFSSEQGDVSKM"
FT   gene            complement(<167344..>168048)
FT                   /locus_tag="Eint_081670"
FT   mRNA            complement(<167344..>168048)
FT                   /locus_tag="Eint_081670"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(167344..168048)
FT                   /codon_start=1
FT                   /gene_family="HOG000149854" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081670"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1710"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R1"
FT                   /protein_id="ADM12099.1"
FT                   /translation="MKSIFVVFQLVKVISGFTIFTKDGQRKHLVKGGIWRSPDYNLDYQ
FT                   LAAMSASGTPVEFKTENLSSGIKVIKVSGSNDVLDLHNPRSGQSKLIFHGRNNGSTQKF
FT                   SIEGSEGTGFTIKNGTKCLEYDASGNIYGTTCSSSAQQTFDIVYSPDDPEYKPPSPVAE
FT                   VKASSAEDIIAELNAGNPNPQAPQIFIFNEKSEKKRKNSHSSDSDSNSDFSPRRRHHHH
FT                   HYSLHESPYFTY"
FT   gene            complement(<168166..>168768)
FT                   /locus_tag="Eint_081680"
FT   mRNA            complement(<168166..>168768)
FT                   /locus_tag="Eint_081680"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(168166..168768)
FT                   /codon_start=1
FT                   /gene_family="HOG000149854" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081680"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1730"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR008997"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R2"
FT                   /protein_id="ADM12100.1"
FT                   /translation="MKVISFGCIISTAFAFMITSENDEKKFVSNSSGKAVMTTTGKPAE
FT                   FTSTEVSPGVDIITDKSTGKVLDMQGGGSNVIFWGKHGGANQRFSIVKNNEGGYYIKSE
FT                   NKCLEYDASGKMYRTTCSNKSEQRFSIIYTPGEPQYKPPVEVPVEVPVPVENPAPPQPQ
FT                   ILIFNTGKPSSSKSHDNHHRSQSSEDSSLLYDSGLIG"
FT   gene            <168989..>169510
FT                   /locus_tag="Eint_081690"
FT   mRNA            <168989..>169510
FT                   /locus_tag="Eint_081690"
FT                   /product="RAS-related protein Rab5"
FT   CDS_pept        168989..169510
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081690"
FT                   /product="RAS-related protein Rab5"
FT                   /note="similar to ECU08_1740"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R3"
FT                   /protein_id="ADM12101.1"
FT                   /translation="MTKARDEKSEVFEEVSEVGGKVESRRPRKETFYRKRTKIDFESMC
FT                   SDDVERLIGNVDILKDEDADDRYTALNRSFLISCMALKDHEASLSPLFSQYKKFLAFIK
FT                   RSDDSTGDPKGEGVGMFSFSLYDFGPFEEERVPGDRNNSQHKCSQGEIYKFLTRYFGVE
FT                   CPNAGTTTSS"
FT   gene            <169534..>170058
FT                   /locus_tag="Eint_081700"
FT   mRNA            <169534..>170058
FT                   /locus_tag="Eint_081700"
FT                   /product="hypothetical protein"
FT   CDS_pept        169534..170058
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081700"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1740"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R4"
FT                   /protein_id="ADM12102.1"
FT                   /translation="MEKMAEFPFSKPLKFRKGPGMSFSMSRREDIGNHNRKVFEAITAL
FT                   RKDPNALTYVKNPDFFEDSSEEEERSENRYVVRETIKCKYYDDGKYNFFGNLVLRGFSR
FT                   SGLNYINMREGGNIIFKDLEKSQMKLAYSKGEDSIYMLMEKTMMIYKIVCRHPMIASSI
FT                   YKHLMGDESDS"
FT   gene            <170124..>170588
FT                   /locus_tag="Eint_081710"
FT   mRNA            <170124..>170588
FT                   /locus_tag="Eint_081710"
FT                   /product="hypothetical protein"
FT   CDS_pept        170124..170588
FT                   /codon_start=1
FT                   /gene_family="HOG000149853" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081710"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1750"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R5"
FT                   /protein_id="ADM12103.1"
FT                   /translation="MKTRFGLKPFIFLSVFSSSNMMFAAKLGLAMLGIVYPCMYGLITL
FT                   ICLVLIQKNTVYKLIGIGLIVLYLKMLLGPSFGLEESLKECISAPDSKANSQDVDEYSS
FT                   SSEDFIEGDGKIDSHGCTRENEQTSQTLDSLSNILNNHNARCRFCSGVTF"
FT   gene            <170771..>172201
FT                   /locus_tag="Eint_081720"
FT   mRNA            <170771..>172201
FT                   /locus_tag="Eint_081720"
FT                   /product="hypothetical protein"
FT   CDS_pept        170771..172201
FT                   /codon_start=1
FT                   /gene_family="HOG000149852" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081720"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1760"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R6"
FT                   /protein_id="ADM12104.1"
FT                   /translation="MKDKGSYNQGLESQSTEMLLSILEHYDTNFIEERIIDEYAGMDSS
FT                   KKMAQSPWGSEDPGKCNPFQEKEEESEYLESQMICNFLNSYGMDVPEDSYGREEGKSVA
FT                   QELGKENEGLDGPSQGILQGSTVDLSELRNLTDPISLEKALEFERLSIHKEELVRNAES
FT                   QKKIIEAFRSIPGLAIKENLLNDIKINKVYVESRIHIRKENGKDIREKRNIIKGERERE
FT                   GGKETIVFNDYVSSGWESGSESSSDIAAKEKAFKVIKEAERRATGKDLLCNADMQLRKF
FT                   VVDQEERYLRIEKVMKLNDLKYKNLMGKIYKKGKNGKYQYNWFTLKKNFFTCYNGKGTK
FT                   TTSEDFPYEKEWDFKNPEDEDFFFKRKYTIDLLNAGVYLVKHPVCIGCVKWGCGTDEDL
FT                   IDISEDTKIMRITPAKSHFLISLKKNLVKTEIKMTTLDFALKANGETYFYRMKDLDGFL
FT                   GWLVAFAFRQGKIKCNIG"
FT   gene            <172315..>173331
FT                   /locus_tag="Eint_081730"
FT   mRNA            <172315..>173331
FT                   /locus_tag="Eint_081730"
FT                   /product="RNA polymerase III transcription factor IIIC
FT                   subunit"
FT   CDS_pept        172315..173331
FT                   /codon_start=1
FT                   /gene_family="HOG000149851" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081730"
FT                   /product="RNA polymerase III transcription factor IIIC
FT                   subunit"
FT                   /note="similar to ECU08_1770"
FT                   /db_xref="InterPro:IPR019136"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R7"
FT                   /protein_id="ADM12105.1"
FT                   /translation="MIKDFDMVECPFKAERCVLPLVKTEAGYEMRICDRPDAKKVVATK
FT                   DKSPKGYFHLEISGDKCNIIGYTENIYSFTTPADFYLPVPKQTKEFYSEIYSKMVYGDM
FT                   SQCMEIAEMFDKSYGDNEIPMYPVPIISTVESFENYNFKDFKGGKDKTGDTVHVGYEDE
FT                   VPLCPAPGLLERLKKLHGVDAMRLQEDLFNRLFSLHPILRISNIIKMFRADERVAEMGF
FT                   SDWKIKKFLPLHAYFIDSGPWRGCWAKFGFDPKEDQSNFRYQIYDSRKSGRTFQVFEAE
FT                   NVVHEVERNKSWYLVGKPSFRMGFHTKALLNLLRFRYELDFHPNEEDEDELEFEVFD"
FT   gene            <173482..>173949
FT                   /locus_tag="Eint_081740"
FT   mRNA            <173482..>173949
FT                   /locus_tag="Eint_081740"
FT                   /product="60S ribosomal protein L6"
FT   CDS_pept        173482..173949
FT                   /codon_start=1
FT                   /gene_family="HOG000207317" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081740"
FT                   /product="60S ribosomal protein L6"
FT                   /note="similar to ECU08_1780"
FT                   /db_xref="GOA:E0S8R8"
FT                   /db_xref="InterPro:IPR000915"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R8"
FT                   /protein_id="ADM12106.1"
FT                   /translation="MPDDIPQFVEKYKAKTARKPRARRSDLSKGMVVVVLEGVFASRRV
FT                   VYLKALEDNLALCAGPKSVSGVPFFKIDERYLLATSTILSIGVDVNVDEKNIILSERDV
FT                   YDVPMDVEMTDAEKKIDEEIAKAVKEIKYMRTYLSEPFEIDTTRNFYSLKY"
FT   gene            complement(<174027..>174956)
FT                   /locus_tag="Eint_081750"
FT   mRNA            complement(<174027..>174956)
FT                   /locus_tag="Eint_081750"
FT                   /product="cyclin-dependent protein kinase"
FT   CDS_pept        complement(174027..174956)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081750"
FT                   /product="cyclin-dependent protein kinase"
FT                   /note="similar to ECU08_1790"
FT                   /db_xref="GOA:E0S8R9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8R9"
FT                   /protein_id="ADM12107.1"
FT                   /translation="MEKYENIKQVGEGAFGQVYKSRRIADGTVFAIKKMPVDRETGFPF
FT                   TAIREIKLCKSVINKHIIRLNEIVFEEGFIFVVLEYMPYDLTGLLASGTKLSNEHTRSI
FT                   ISQLIEAVSSMHELGLVHRDIKPSNILIDHHGMLKLTDFGLTREISGMMTNRVCTLWYR
FT                   APELLLGETSYNFKIDAWSVGCIMLEMRLGRPPYRGNDEVSQIKLIFEELGAPQDRYKW
FT                   SDLLDVEIYSKTKDAQVIIGEKYGNLFDEEELKVLSGFLCLTSRKRLSVANSRHFPIIS
FT                   SYKNTYIPLNLEESHELYTKERKEMKRP"
FT   gene            complement(<175060..>175716)
FT                   /locus_tag="Eint_081760"
FT   mRNA            complement(<175060..>175716)
FT                   /locus_tag="Eint_081760"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(175060..175716)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081760"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8S0"
FT                   /protein_id="ADM12108.1"
FT                   /translation="MKKLILVSGLLMAKALKRIHGIGHHGSNLTNLRRHRLRQSSLSSS
FT                   NVKDGNGDDKDGKKDGKDEKDGNKDDKNGKKDEKDGKKDGKDEKDGKKGDKDGKKDGKG
FT                   GKDGNSSSLTHRSKLWSGNNSSSMEEPKEDDGKKGKDGKDGKDSKDKNSGASEKPKDQD
FT                   KGDGKGNKGGDEGGNPEEKKGGKPSDKKEKKKSNLIDSELVDSEGSEDNISSARD"
FT   gene            complement(<175906..>176709)
FT                   /locus_tag="Eint_081770"
FT   mRNA            complement(<175906..>176709)
FT                   /locus_tag="Eint_081770"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(175906..176709)
FT                   /codon_start=1
FT                   /gene_family="HOG000149850" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081770"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1820"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A3"
FT                   /protein_id="ADM12109.1"
FT                   /translation="MKLPEKHPRAMNGGELSPDEGGVRNDYLDLLQKIRLQREDLLEDK
FT                   SRLEELINTSNMLFRKIKTSSELKLDAKMNALWTKLAWTRMEKDIDLEDITSSTFVELF
FT                   RKSLLDDFYRYAMKCNAGMKFLNCFSLVFSEEAPSRKRSQVQRSRQHLPAAEIPVLITR
FT                   EKDSTEESGILMQIRRLVSERDRIEYFRLVINPESFSKTIENIFYLSLSLRSGFVSMEY
FT                   DDGILYAISKTSEEGEIGHLAVEMTYDEYLEIIENTGISKPLIKS"
FT   gene            complement(<176709..>177308)
FT                   /locus_tag="Eint_081780"
FT   mRNA            complement(<176709..>177308)
FT                   /locus_tag="Eint_081780"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(176709..177308)
FT                   /codon_start=1
FT                   /gene_family="HOG000149848" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081780"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1830"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A4"
FT                   /protein_id="ADM12110.1"
FT                   /translation="MEEDAVKKIKEGDFEGARKIILEMEDGIRIEPSLYGRRVLLEKVA
FT                   RLKKIYNDHNRAEIGTIPFRSLTSFERRENKVDGIKDKRYIKGSRDELVTIEDCVEVVI
FT                   EDCTNAVFEHFCCEKSVVLNNVKDCKVSCSAHQIRMNGCRNVELEAYTLTGVFLQNSTG
FT                   IVVRRYGGRKDNRFKNVNDFSSPFESINYTVLPDGL"
FT   gene            complement(<177374..>178117)
FT                   /locus_tag="Eint_081790"
FT   mRNA            complement(<177374..>178117)
FT                   /locus_tag="Eint_081790"
FT                   /product="putative PP-loop ATPase"
FT   CDS_pept        complement(177374..178117)
FT                   /codon_start=1
FT                   /gene_family="HOG000229449" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081790"
FT                   /product="putative PP-loop ATPase"
FT                   /note="similar to ECU08_1840"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A5"
FT                   /protein_id="ADM12111.1"
FT                   /translation="MKYLALASGGKDSLYAMHVLQREGHQVVGLLHMRCGDGYQDSFMY
FT                   QTVGSEVADLLGECLGIPIFIYETKCKSINQNLQYKKEEGDEVEDLYEAIASAKEKIYF
FT                   EGVSSGAILSKYQKNRVEDVCKRLSLRCLSPLWEMDQKKLLGEMISNGMEGRIVKVASS
FT                   LLGRECINMGLDEIYDRLEAVQGLEVNFCGEGGEYESIILDCPMFKKRISIDKYEVTPH
FT                   PEEIGREGIVFYMRILKTSLVEKDI"
FT   gene            complement(<178175..>179479)
FT                   /locus_tag="Eint_081800"
FT   mRNA            complement(<178175..>179479)
FT                   /locus_tag="Eint_081800"
FT                   /product="glucose-6-phosphate-1-dehydrogenase"
FT   CDS_pept        complement(178175..179479)
FT                   /codon_start=1
FT                   /gene_family="HOG000149291" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081800"
FT                   /product="glucose-6-phosphate-1-dehydrogenase"
FT                   /note="similar to ECU08_1850"
FT                   /db_xref="GOA:E0S8A6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A6"
FT                   /protein_id="ADM12112.1"
FT                   /translation="MKVVIFGSSGDLAKRKLFPALSRINLKDVEVVGYARTKYDVEYSE
FT                   VLQEVGNYSPEFLSKVQYVRGSYDDLSRLKDIADPETVLYFSVPPSVYTSILKEASKLK
FT                   YKVICIEKPYGESIESFAQMKKFDLSKVQFIDHYLLKPLVIAMPGIIRGSSAMKETMNN
FT                   RHVKSVEIISKEVLGGEGRNYFDKNGIVKDIVQNHMAELLGVVASDVTEPSRTMEALER
FT                   AKIFDACTIDAEKCIYGQYDDYSKEIHKDSSTETFCIVPINVNTPRWSKVPFIIVAGKG
FT                   MNEKRTEISIEFKRDVFSKCIELFCEEKKLSNKTVHINEIDVVRLVFNIYPECEVFLEV
FT                   LVGGDSVKHVLHDKKRINDLMHESYGGYRDYEIIFDSLIRNKSLNSVNLDEVELLWKVF
FT                   DPILSTDKEETLFYYSKGIDMPEEAEEMIRKIKDH"
FT   gene            complement(<179593..>180225)
FT                   /locus_tag="Eint_081810"
FT   mRNA            complement(<179593..>180225)
FT                   /locus_tag="Eint_081810"
FT                   /product="putative methyltransferase"
FT   CDS_pept        complement(179593..180225)
FT                   /codon_start=1
FT                   /gene_family="HOG000222792" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081810"
FT                   /product="putative methyltransferase"
FT                   /note="similar to ECU08_1860"
FT                   /db_xref="GOA:E0S8A7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A7"
FT                   /protein_id="ADM12113.1"
FT                   /translation="MKVKKLKMELSKVEDFSKMSVGLEQYMTPPDIAASMISIIHSTYD
FT                   DIEGKSILDLCCGTGMLSFACSYFSPSYILGVDLCPLALSVFKQNNLKFKANVDLLRCS
FT                   IDDLTFINEKFDTAVINPPFGTKIKHADIKAVDKALELCDVVYSLHKTSTREYIVARYP
FT                   SAEVLAKIKYELPRRHDFHKKDKKIVEVDFVRILKRKETDSASSVIY"
FT   gene            complement(180279..180351)
FT                   /locus_tag="Eint_081820"
FT   tRNA            complement(180279..180351)
FT                   /locus_tag="Eint_081820"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA Type: Thr, Anti Codon: TGT, Cove Score: 71.02"
FT   gene            complement(<180451..>181140)
FT                   /locus_tag="Eint_081830"
FT   mRNA            complement(<180451..>181140)
FT                   /locus_tag="Eint_081830"
FT                   /product="proteasome subunit beta type-5"
FT   CDS_pept        complement(180451..181140)
FT                   /codon_start=1
FT                   /gene_family="HOG000091082" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081830"
FT                   /product="proteasome subunit beta type-5"
FT                   /note="similar to ECU08_1870"
FT                   /db_xref="GOA:E0S8A8"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A8"
FT                   /protein_id="ADM12114.1"
FT                   /translation="MEETLKRDIRRIDTTCIDQQLIKSFIKPYYGTTTLAFVFKEGMVI
FT                   AVDSRATSGPYIASQTVKKVIEINKNLLGTMAGGAADCFYWEKLVGLYAKNYELTNGRR
FT                   ITVSAASMYLSNCVYKYKGYGLSMGTMLCGYDGSEPCIFYVDDAGKRIKGNLFSVGSGS
FT                   TIAYGILSSCYRFDMSKEEALNLGKEAIFHAAHRDAFSGGFINLYYMNEEGWTKVGSYD
FT                   VNDFNKE"
FT   gene            <181156..>183549
FT                   /locus_tag="Eint_081840"
FT   mRNA            <181156..>183549
FT                   /locus_tag="Eint_081840"
FT                   /product="hypothetical protein"
FT   CDS_pept        181156..183549
FT                   /codon_start=1
FT                   /gene_family="HOG000149847" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081840"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1880"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8A9"
FT                   /protein_id="ADM12115.1"
FT                   /translation="MREGDSMVNYKESPERMEDLKEKIFQFGIYGAKLEKLSKDEVEIA
FT                   IGEPWVEILKVETIENLKRNFITDCLRTETNGYMVDNFHWDKLYVRMGTLAWKDYLTAG
FT                   TFNFTSKEYFLIMSLLIETKKYVDNVELRKLRLDPKKTHYCIKRLVRKGFIEYRTSEET
FT                   EKKNFIYKIKAILDERGFITRKVAQPLTDSGRIDVVGRRRLFEYRIEIGLYDNVREMIL
FT                   SSEGGIITKDLKDKLGVSSKIGYKLLNKIYNEEKGIFKRIEEFQGRIRRYRYHAACKEL
FT                   SYQVPEEAGTVEYITSEERVRAIKKLMSMSSVLQLDKQTYEKLQEITGWKYEFDRRTII
FT                   RSAILAGFKIYKQKKGREGKCSRYMIIRNEVSESDIEALDVPSNVIQEDMSEFQRKIYN
FT                   IFVNSPKLVEMDNGYIPQREERLQLFYRFLVEYMAFQGVKSLRFDWEVVKEMEFSLLLS
FT                   IVPFGRIGFRESLCQFIDSGETDSNAFRAKECILSGKAEPSNITSLAGKRVSDVVDMKL
FT                   PQSIRKLIRLKIGVGNFVSLLKQMKDLQVLDIEISSKKIMIKENSMDLSSGIRAFERVK
FT                   RSKSSGKYVSLEKRLEFYKKIRNVEEKRFYDEAYRTIYTEFKGDEFEAMFDRLKMFGDE
FT                   GIDDIKQTSLERLYIEFKKNIIELGWIGALDFNSYSVSEAKKVLKALSRDKIIANYKGI
FT                   KKVEFVTPHESFLRVINKKYDVFKFKGYNQYKGTGYFSHYFDLVYYTLATSGSLEVTEL
FT                   ISRVRFIADFEMEMFLSEYKKVFKVSNVNNTRIISLGIFMDPFE"
FT   gene            <184094..>184495
FT                   /locus_tag="Eint_081850"
FT   mRNA            <184094..>184495
FT                   /locus_tag="Eint_081850"
FT                   /product="hypothetical protein"
FT   CDS_pept        184094..184495
FT                   /codon_start=1
FT                   /gene_family="HOG000149846" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081850"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1890"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B0"
FT                   /protein_id="ADM12116.1"
FT                   /translation="MFLTIFVFWIIVGSSNADEELKEFIKKSIKEEVTKEMYEIVEKTT
FT                   KDMKEDMEKKIDEFMSEKIPEHEEKVVLEEEKVVLEEGQDLEEEEESSAMTILKKAGEA
FT                   LAIVVICILIVFLVSKILEYYRRLKDCSE"
FT   gene            <184586..>193042
FT                   /locus_tag="Eint_081860"
FT   mRNA            <184586..>193042
FT                   /locus_tag="Eint_081860"
FT                   /product="Willebrand factor type A domain-containing AAA
FT                   ATPase"
FT   CDS_pept        184586..193042
FT                   /codon_start=1
FT                   /gene_family="HOG000149845" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081860"
FT                   /product="Willebrand factor type A domain-containing AAA
FT                   ATPase"
FT                   /note="similar to ECU08_1900"
FT                   /db_xref="GOA:E0S8B1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B1"
FT                   /protein_id="ADM12117.1"
FT                   /translation="MKHKKQKTGEARVGSLEKFERLAREAVDLKVPVGVYGEVGRSSLV
FT                   SRLHSGIYSKGGRLVEIDSREITDARTLGGFYAVKEGDVEYMKGLLIESMERGDWVLFK
FT                   RIDKNHGLMQYLFTVVKYRRLLGNDGREVLAHEDFRIFFTSNDILDMDDIVFVGPLGFM
FT                   FEEAMMMFEIACVRQLLMKVFEVISTHWKGCSKEKGEECQRSCLKIACKNNGWCLFKES
FT                   TVCGAHFRSLQRIKKRLEGSNGTKTEERVKVYQSVCNVLLRHDSDSLRYLLALTDIPDI
FT                   SLHGLDFAKTSSVEWGIFNLLWNIKNRDHTLLIGDTGVGKTSMIQYLSSKSHFFLGVAT
FT                   KLRVVNMSADFDGTDLIGGYGTLDINKAIERICNQERLSTPVCYGNKEKLEYLREKLSL
FT                   RKEDGLKHEGAIKKIDDLLKLLEKKVHFVYKKGILTECMENGEWLLLDEINLSSEETLD
FT                   LIDGVLGKKEILLYESGDLRPLEIHPGFMLFGCMNPGGDFGKKKYEGVEFNSVHIHDFS
FT                   TSLKDINLVIHSVLKYEISEERKSKIGEFFLELKNKVRKGELGNIVEPLISGRSLVRVL
FT                   NFIRRRAEKGFEQSVWEGFDLFVFTQLDFVSRSIAISLLSKYFATQSLSVERTKVKDGF
FT                   VLTHRIQTYLRIMELGVLSNCPLLLQGDTSTGKTSMVLFLSKEMNKRVIRINNHEHTEA
FT                   SDYIGSFTCTSRGVEFQEGVLVTAMRRGYWVILDELNLASSDVLEVLNRLLDDNKQIYI
FT                   PEIDEVVVPHENFRVFATQNIGYGGRKGLSKAFRNRFVEMFFNEGGEEEILEILHGGSG
FT                   LPKSFCKKMVEVYSGLRSKRSVNALVTLRDLFKWSGRVPRSLSEVCFLGMSIIYERQRE
FT                   EKDRRWVFQVFSESFGEVEVERYGRIITGKEDKEEIVIGKKGTNLKDLSLAAEELYGKK
FT                   LVFTDTFRKMISLTVLAWESKEPILIVGETGIGKTKICDVVSSLFKTKLITLSMHRGIE
FT                   SSDFIGNFVFENSKVVWKDGPLVRAMKNGEAFLIDEINLAEDSVLERLNSVLEPQRTLY
FT                   ITETGKEVVAHEGFRILATMNPGGDFGKRELSPALRNRFSEMYFEVSSDEIPLVFDHLI
FT                   DKRLEEVGMPKESRDMFKSLARSLDTSIRKLELVVDFIYRRYTGRFEEVVCMEMFDAIS
FT                   AWREALEIIEANSSEIETRYIENEKMFGAFPYLVGYKNPSSFDFESKTPTLNLRRVLRA
FT                   MGLGRGIMLEGDPGIGKTSIVQEIARKMGKKCIRVNLSEQTELCDLIGSYLPIDGEIRF
FT                   VESELLHSLRNGGWIILDEINLCTQSVIEGLNSVLDYRRKLFIPEVTVDVHRDTRIFAT
FT                   LNPCSSINGRKMLPKSFLDRFVRIKMDGYTADDIAQILHKMFPRPVIVSSASLRENIRA
FT                   NQMGSLESKNINYFIDESIVRIGSAHIQRKGGNLDFVLVHSQLQQMEMIMKCVEMNIPL
FT                   VISRGVGRDSLLRFVSSVFGQEMMLFNCHKDTDVCDLLGQYQKMENGMFEWRDSAIVQG
FT                   IKRGMIVVFTGVEFVEKSVFDRLNPLFESERILNIYERGIDTNVVVNPSTRLILLVKEP
FT                   SMLSPALLDRCMHVELSDRLDYIDLWKLFVRQSNSSSVFHEDFYGLSMDRSQIDFGLDL
FT                   KRLRLLEVWPSFLGRHLCGVWNALEESRIDEMFQFQRKNIENYEIDFEILHFYNKIRLY
FT                   VETPDDDVSKINLLKSISTMSSEDRKAVAFIKSADLSIFSRFHDQGGCSLNFPKSSRDL
FT                   KVKAIRCLRDKKFSDYKKLRMIVEQLPDVEWLLHSDFDMFFFEFIERCLNDPLEMVRKG
FT                   LIAEMNEFENKSLSEIYGTMKNMYKYGKGSIEKMVDRYEKGIQEYKAKIQEIEGRMNRD
FT                   YLKFRNSLRGLDFCSYMCGDKALYSEFDDILDYYLIYLFYRWSNGEGCSGMCKIKRIGV
FT                   DCTKYGDRNSVEEESGDYASYGILCLNLIDRGLEILPLLGKIDCKSLGHEFSRYLNSLY
FT                   YSRSVDRHSLILEGIIFDRRIHVKEADWIDHLLEFKEKDLNRCLMLVFKVKGRAQIIER
FT                   ETTRLEIEEKLVDLMDQEMLELPIFTSIGYLMEYGRKKVDSEDYEALLQKDISNADSDS
FT                   DKILESTIVISGHRDKRNSSADKEFGLHSIMEALERFYKDTSVCDIERNYKYFLYLITT
FT                   PFDFEMAERYFLDCSVYEFVDRIRHAREMAVKNEDPVFYNVTLKYVSFEVESAYEDRIR
FT                   DAKSKLRKEPKLFRKTLEDLKKFLILPVTNVLNLKFPQPYPLCQGYHPNVCASLLRERS
FT                   DCECEDWIEFSKKFDRKEVERIFENNKVKKKDVLGRFLNRMPEKMFSNSEVCLGKIVNQ
FT                   MTEDRAIMGLTLACIENPYIPLMYFTFIFGRREEEVSEEETGMKSGTGNVNVSDQIKHE
FT                   DEIDDEYGEREKVSESDGIDFDNDGSVSTVSESEEEEYESGVDGYNEEESEKDENENEE
FT                   ELKNEQDTEMDVEDEGFGSEKSEDGGEEQLGPDVSEEDTDASNVLDSTESESEGEAKSQ
FT                   NEEDSNFHNEPKTSEYQFKEGILNKNQTCEVADNYDRYVAGNNQEDRALCQGEGNEKIS
FT                   GDEDSGSGDAFESTVRIRIEEEDCTKLTNMLKIIMESRKGSKYKGDFKSGKKLNMKRLV
FT                   PYIASGFRRDRIWMRRQRNDKKDYILRLFIDNSKSMYNQEMIDTLLSLYSKINKSFSLL
FT                   GIPVEVYRFGELLERSTVEEMRFSDSQTMIDWIDEFDDGINIILTDGLFQNVGHHHPNF
FT                   LVLLIDKCNVKRMSKVTVSEGSVFVQRYLDTFPLKYCIISSVDELESTFVMALSELISS
FT                   "
FT   gene            complement(<193164..>193430)
FT                   /locus_tag="Eint_081870"
FT   mRNA            complement(<193164..>193430)
FT                   /locus_tag="Eint_081870"
FT                   /product="60S ribosomal protein L23A"
FT   CDS_pept        complement(193164..193430)
FT                   /codon_start=1
FT                   /gene_family="HOG000231364" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081870"
FT                   /product="60S ribosomal protein L23A"
FT                   /note="similar to ECU08_1910"
FT                   /db_xref="GOA:E0S8B2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B2"
FT                   /protein_id="ADM12118.1"
FT                   /translation="MPRNTPHDIILYALTTEKAARCMEQFNILVFYVEKTSTKPEIRDA
FT                   VTQLYGCKVKKVNTLINKHGKKAYVRFDKEGDAIQIASKIGAI"
FT   gene            193562..193634
FT                   /locus_tag="Eint_081880"
FT   tRNA            193562..193634
FT                   /locus_tag="Eint_081880"
FT                   /product="tRNA-Asn"
FT                   /note="tRNA Type: Asn, Anti Codon: GTT, Cove Score: 75.19"
FT   gene            <193717..>194607
FT                   /locus_tag="Eint_081890"
FT   mRNA            <193717..>194607
FT                   /locus_tag="Eint_081890"
FT                   /product="cyclin-dependent protein kinase"
FT   CDS_pept        193717..194607
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081890"
FT                   /product="cyclin-dependent protein kinase"
FT                   /note="similar to ECU08_1920"
FT                   /db_xref="GOA:E0S8B3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B3"
FT                   /protein_id="ADM12119.1"
FT                   /translation="MTESFQKLEKIGEGTYGVVYKARERNTNRIVALKKIRLENENEGI
FT                   PATTIREILLLKNLKHSTIVELSDVIYNNNKMYLVFEYVELDLRRYLDKMNDEGRPVDK
FT                   NFVRKMSFQLLTAMEYCHSRNIFHRDLKPQNILIDPQENIKLADFGLGRAAGVPLRTYT
FT                   TEVVTLWYRPPELLLGCKYYDASVDVWSAACIISEVVLMKPFFPGDSEIDQLFRIFKVL
FT                   GTPNNSRWSNVENFPNYKVEFPIWNPVDLKTIFKADPDFIDLISNMLEYDPRMRMTAKS
FT                   GLSHRYFKNMVPILG"
FT   gene            complement(<194698..>195321)
FT                   /locus_tag="Eint_081900"
FT   mRNA            complement(<194698..>195321)
FT                   /locus_tag="Eint_081900"
FT                   /product="Sar1 GTPase"
FT   CDS_pept        complement(194698..195321)
FT                   /codon_start=1
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081900"
FT                   /product="Sar1 GTPase"
FT                   /note="similar to ECU08_1930"
FT                   /db_xref="GOA:E0S8B4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B4"
FT                   /protein_id="ADM12120.1"
FT                   /translation="MGAVISKVNNILYTRLRAIFSGQSERSITMIGLDGAGKTTLLLYL
FT                   QTGEVHQTVPTLGFNCENVSLGSMKFQVWDIGGQNSFMRFWHQYINEGCGIIYMVDCAD
FT                   PQRFGKSSEELWRILNILNSPRPLLVLANKIDLVKEHERSEVMRSIKNEFGLEKYSGPS
FT                   LVVPISVLQAGSMTSANDENGREIIDAFRWLNKELEKMPRTEVL"
FT   gene            <195488..>196603
FT                   /locus_tag="Eint_081910"
FT   mRNA            <195488..>196603
FT                   /locus_tag="Eint_081910"
FT                   /product="hypothetical protein"
FT   CDS_pept        195488..196603
FT                   /codon_start=1
FT                   /gene_family="HOG000149840" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081910"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_1950"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B5"
FT                   /protein_id="ADM12121.1"
FT                   /translation="MRRTLGAVLIFALKMACDVIRLVPTCDAECMRGRLLASYYSSPAG
FT                   VNLLQTAAKNAPAKNLVGGKVTVVGLSSRSASKPPAPRTPGGGQITVTATVVKTVPMEI
FT                   PRSVQPPVVVLQPRYLVQPMPIPVNAMSVATVPKRNAKPLPARHVVEEKPHGENEMINR
FT                   IGRKVNLIYTMLSTLGQRYLQMPPQTPRVVLVAPVSTRTVFKTVSSPAPARSSAPASTQ
FT                   SASVITLTKCIFLPPQTEKKPQAQTSSTSTSTSPVSSAKETLGGNKTVGPRRIPKKPRN
FT                   IDFGESSSSESSMSEQREEKPLYMLKSTGPGRKKRRRGDPFIDCYLKGDPSTRCTSDSS
FT                   EGRPDIGDAVIYRSDLDSGDEIIYLSELLQG"
FT   gene            complement(<196642..>197697)
FT                   /locus_tag="Eint_081920"
FT   mRNA            complement(<196642..>197697)
FT                   /locus_tag="Eint_081920"
FT                   /product="Cdc7-like cell cycle protein kinase"
FT   CDS_pept        complement(196642..197697)
FT                   /codon_start=1
FT                   /gene_family="HOG000193450" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081920"
FT                   /product="Cdc7-like cell cycle protein kinase"
FT                   /note="similar to ECU08_1960"
FT                   /db_xref="GOA:E0S8B6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B6"
FT                   /protein_id="ADM12122.1"
FT                   /translation="MEEEKIPESDLKHLSFIIPKYTPIEKIGEGSFSVVYKALDAEAGR
FT                   HVALKVITRTSSPARVLEELTFLKALEGKRNCMGLLGVFRNEDQVIAVFPYFKPIDFRE
FT                   FISNAGLNDIKQYLYNLLEAIDHVHGNGIIHRDLKPGNFLYNKETGRGMLIDFGLAQYE
FT                   DRREEHLPKDSSKPQTPLLFFNSIVSKTKPPGYYERDSRPQMKAPRAGTRGFRAPEVLF
FT                   RYPHQTRAIDMWFVGVIFLTILTAQYPFFYSSEDIDAIVEIATIFGHAEMRKAAKFYGR
FT                   LWRSNIDTIPEERIPFETIIESLNPWAEVGSEGYDLLYRMLDLCSSTRITAPDALNHPF
FT                   FDGLKTHRDPA"
FT   gene            <197806..>198969
FT                   /locus_tag="Eint_081930"
FT   mRNA            <197806..>198969
FT                   /locus_tag="Eint_081930"
FT                   /product="ATP-dependent 26S proteasome regulatory subunit
FT                   6"
FT   CDS_pept        197806..198969
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081930"
FT                   /product="ATP-dependent 26S proteasome regulatory subunit
FT                   6"
FT                   /note="similar to ECU08_1970"
FT                   /db_xref="GOA:E0S8B7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B7"
FT                   /protein_id="ADM12123.1"
FT                   /translation="MCGGLKADLFVRYKQMERKLKLLEIREAYVRKEVETLRREERHSK
FT                   EELDRVKSVPLIMRQFLEPIDNSTAIVGSTAGSNFVVRILSTVDRELLKPNTTVALHRH
FT                   SSAIVDVLPPEVDSTIPVMGESERPEVTYADVGGLDVQKQEIRETVELPLLQSELYRQI
FT                   GIDPPQGVLLYGPPGTGKTMLVKAVANHTKATFIKVNGSEFVQKYLGEGPRMVRDVFRL
FT                   AREKAPSIVFIDEVDSIATKRFDASTSADREVQRVLIELLNQMDGFDQTANVKVIMATN
FT                   RADTIDPALLRPGRLDRKIEFPLPDRRQKRLVFNAITSKMSLKDEVDIESLVCRPERIS
FT                   CADINSICQEAGMLAVRASRYMVTQKDFEEAYSKVVERSDTRPAFYN"
FT   gene            complement(<199093..>199716)
FT                   /locus_tag="Eint_081940"
FT   mRNA            complement(<199093..>199716)
FT                   /locus_tag="Eint_081940"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(199093..199716)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081940"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B8"
FT                   /protein_id="ADM12124.1"
FT                   /translation="MKYRSIVVLQLVLTAVLCSNLPKEGNEEKVKLLRKLLIKKETDLL
FT                   PLEDKEKDISSVGEKEEEESKDTVEDKQEEQGESEDAAEEKEDEEEDVAEEKPEEQGES
FT                   EDAVEEKQEEEEDVAEEKQEEQGESEDAAEEKEDEEGEDEYIIQEEDASTTKEGGKKEI
FT                   SKARKIASSLEGKLRLLVKKKIRGKLLIFKNKNKLPQRKVNPIV"
FT   gene            <200741..>201256
FT                   /locus_tag="Eint_081950"
FT   mRNA            <200741..>201256
FT                   /locus_tag="Eint_081950"
FT                   /product="hypothetical protein"
FT   CDS_pept        200741..201256
FT                   /codon_start=1
FT                   /gene_family="HOG000149844" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081950"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_2000"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8B9"
FT                   /protein_id="ADM12125.1"
FT                   /translation="MDDLKEKLDSLTREARSLNKELEKGYEEIKKLRAKVRELKEEIIE
FT                   KDGKLEELTSCISRLRKKIEEKSKEVGNREKAIMNECRRKELLNGRILGSSRSQENYYI
FT                   SLEMKMLNERIEVMRRFILAIAERFGFDFEVFDDLTKISESLEDPVISALLDSISPRKR
FT                   ELSNKEKE"
FT   gene            <201362..>201862
FT                   /locus_tag="Eint_081960"
FT   mRNA            <201362..>201862
FT                   /locus_tag="Eint_081960"
FT                   /product="60S ribosomal protein L12"
FT   CDS_pept        201362..201862
FT                   /codon_start=1
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081960"
FT                   /product="60S ribosomal protein L12"
FT                   /note="similar to ECU08_2010"
FT                   /db_xref="GOA:E0S8C0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C0"
FT                   /protein_id="ADM12126.1"
FT                   /translation="MAEQKVVDPDTKYIKLQVVGGEVPGATLAQRVGPLGLSSKVVGED
FT                   IKKATADYKSLKVHVELAIKDRKATVEVQPSIATLIIKSLKEPPRDRKKEKNILHNGSL
FT                   RMTEVVEIARIARSTRSYSKSLSGTVKEVLGTCKSIGCKIDGKCPKEVTQEINAGEIRL
FT                   PEE"
FT   gene            <202028..>202813
FT                   /locus_tag="Eint_081970"
FT   mRNA            <202028..>202813
FT                   /locus_tag="Eint_081970"
FT                   /product="hypothetical protein"
FT   CDS_pept        202028..202813
FT                   /codon_start=1
FT                   /gene_family="HOG000149843" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081970"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_2020"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C1"
FT                   /protein_id="ADM12127.1"
FT                   /translation="MRLLVFCMTSLVMGSRMVRITPRTHPDFVVAIVPPKLGGKGTIKV
FT                   ISTREDRKVEESGKATFKISKGMTEISQGGSKICKNEKNDSIEVCTGEDELYSKWKLVS
FT                   EDGGVRFRTENDVCLEAVEEKGKADPVRLIGKECKLNTKSQLFDLTFVDEENQDSDEVE
FT                   FNKSSQKDLPLEDLLPYLLYGKEPIANQRIILYDGEGKKKASFKGSVSPLLIASLSSGI
FT                   LPHSNKVTSPYSSYRPLSGSKLEEEVAITPNYADYGKLY"
FT   gene            <202960..>203436
FT                   /locus_tag="Eint_081980"
FT   mRNA            <202960..>203436
FT                   /locus_tag="Eint_081980"
FT                   /product="hypothetical protein"
FT   CDS_pept        202960..203436
FT                   /codon_start=1
FT                   /gene_family="HOG000149842" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081980"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_2030"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C2"
FT                   /protein_id="ADM12128.1"
FT                   /translation="MKLTIVLMISFAFCISDPIKVKIVSKVDPKKYLSLFSGEVRLATK
FT                   KKIKDNKGCSKFIVDEVRTEILQGNRRLCRKFGFSKVMSCNHESKNSIWEVIISKGSRF
FT                   VSFKMEGENQCLTANGPESADLLGDILSMGECDDGLDTQKFWIKLIVDRKAKAT"
FT   gene            <203496..>203807
FT                   /locus_tag="Eint_081990"
FT   mRNA            <203496..>203807
FT                   /locus_tag="Eint_081990"
FT                   /product="hypothetical protein"
FT   CDS_pept        203496..203807
FT                   /codon_start=1
FT                   /gene_family="HOG000149841" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_081990"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_2040"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C3"
FT                   /protein_id="ADM12129.1"
FT                   /translation="MEEEVVYFNNGRKEFNKIADENPGYKRIYLNIKNKERITEITLSK
FT                   ERGDILYILSSIEKKKYTDYFKRKAKNEVVSAAKGKKEDKDQPPKRTKQTTLFDFIKK"
FT   gene            complement(<203953..>204723)
FT                   /locus_tag="Eint_082000"
FT   mRNA            complement(<203953..>204723)
FT                   /locus_tag="Eint_082000"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(203953..204642)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="Eint_082000"
FT                   /product="hypothetical protein"
FT                   /note="similar to ECU08_2080"
FT                   /db_xref="InterPro:IPR019081"
FT                   /db_xref="UniProtKB/TrEMBL:E0S8C4"
FT                   /protein_id="ADM12130.1"
FT                   /translation="MGLLACLAIVLPAILYYLREKNELDKDYPLLKLGAMFPPFLYSAM
FT                   EHFTLLWDNWKSSWKSLSLLEAVFYLLLCILFASISLVSVLSAIIFGFTEWDNFWYDDF
FT                   KSYSIFTPSSFVAFAYLLSTSCTFTPELISFTDSGITIFFDLAILLCSIANLIMLLKDE
FT                   LKCCSYFSIVSCTLILVRSLREYFFPSAECKDPSTSWRVFILLSILLLEISIYGLIGLN
FT                   IRSKIIN"
XX
SQ   Sequence 204910 BP; 60472 A; 41315 C; 44663 G; 58460 T; 0 other;
     tggttttatc aatatgatct tcaataaata attttaatgt ctaattggaa ttagtcgata        60
     tttaccagta cccgatcctt tagtataatg aatctctgac gatactcgat agtagaaaac       120
     ttactttttg gcttaagtgc agatattttc tttttcaatt cggagtcggg aatcttagag       180
     agaattctgt ctctattgtc taataaaagc tgtggtaaat atctgaagag aaaacatcca       240
     aacttctcgt aattaactcc gcaaagaatg gacgcaagaa agtaatctat aagagtggaa       300
     tgtgtggaag cgctattttt aagatgaatt aaccttttta gtactgaata gaacagatca       360
     tcaacaggat cgaaggttac tactatctct agtactttct ccagcacaag aagaacattt       420
     ctctccaact ccgattcgtc caggccaatg atttttctgt atcctatttt tctttttgag       480
     gaaacatcga gacaccaaaa tatcttttct atttccgagc gttcttttaa atggcttttt       540
     atttcttgag tctttcttat ttttggtttt tctttagact tttttctttc gttggctttt       600
     tctatccgga atttcttgaa cagcttcccc atcgaaacag acagggagat gagtttaaat       660
     tattagccca aaattttatt aattaactgt tatttcatct agcttcatat ctaaactttt       720
     gacactcatc gtcaacctca catttggact aaactttaaa acaaagaata gtgtggataa       780
     tatcaacacc gataaaaacg aaaacagggc caaaataacc agaaatccat cggaaaggta       840
     acatctatta agaaatgtga tggtatagtt gagggtattt ttcaaaggaa tgtcttcctg       900
     acttgtttga actccattga tttgattcag aaatgaaatg aagcctagtg atatagagct       960
     ccttcctcca agtgtaacgt agaaaaacgc atccaagagt agaaaagggc agagaaatag      1020
     accataggat actggataca gatatttcat aaaactgtat ctgttgctga gttcttcgag      1080
     ctctatactc agatagaggg gtctgaggaa ggttgaaagt acaaatgcag ccactctggt      1140
     gatattcaat gggtaactcc ctgaggaaaa agccttaacc attgtcatga agataaccat      1200
     gccaagaggc gtaagaacaa acattgaaat tgcccttcct gtcagaattt ccttgagctg      1260
     ggttaagctt aggagaaaac agaagtagag cgatctgatt attgagaata tacattcata      1320
     tatcaagacc gaaatcaaaa gagatattgg gctatagtca catctaaatg attctttctg      1380
     aagaagtgct ctatggtcta ggaagcttga gtcattaaat atggaaaagc atgtaacaaa      1440
     cggaatcatg ttataagcaa aaaagtctag aacatcgctg tacaatatgt tgagatcttc      1500
     gtagtttttt tggagaaaat tccttagatc gttgagatac atttcgcctg cggctaagta      1560
     tctaggacac attctattaa taaatagaaa aacagaatat ctcatcttat cgcatagaaa      1620
     aaagaaaagc actgttgcca cagccatttt gaatagaaat acattcctca tgactccgct      1680
     tctgtaatcg atcttgaact gccgaataag tagatgccaa atatgcttcc aagaaaccgc      1740
     agagacaaca aatctttggc tgttcctttc aaggagactt tcgttacagt attttacctc      1800
     ttgatgttga tcggaggaga gccaaaggcc ttgctgtttc cgaatatcca tctctaactc      1860
     aaataaatat tctgcaacag aaatgttaaa cggtctttgc attccaatgg aaagaagaaa      1920
     accatctatt ccagagatag gccctgcata aattatcttt cccttgtcca agaatattat      1980
     gtcgtcgaat aaggtaaaca tcgaatttcc tggctggtgc acagtcatta aaactatctt      2040
     gttctttgtc tctgcatatt ttttgagtat tcgaacagtt tccaatgcta aacgcgaatc      2100
     caagccactt gttggctcat caaggaatat tatgtcaggt tctacaacaa gctcaatggc      2160
     taacataact ctccttctct ctcctccaga gatagatgag attagtgatc ctctcaatct      2220
     attcagcccc agatccctga ttatgtcatc cactatcgac ggaattgtgg agtcctttat      2280
     ctctcggccc ctaaagataa ttgagtatct tatggactct tccaccgtaa gccccgaagt      2340
     aaaggtatca aactgttcca agtaagaagt gctttcaagc catttgtata cctttctctg      2400
     ttctccgtta agggtgataa ttccagacgt tagcacatta ctgttaacct tccccattag      2460
     aagattgagg aaagaggttt tactgcttcc acttcctccc atcacagcag ttagctttcc      2520
     cgatgctact tctccagaaa tcccagaaat gagatcaata tactctccct tgagatcctt      2580
     gttgttgtta ggtgctttca aaaatacatc ctcgaatctt agtatcctct ttttcatacc      2640
     ctttcatagt cctctccctt gaaaagatac aagcaaccaa ccactaagca ggagaacttg      2700
     ttccttatta ttttgcaaga agaacaaata gagtctcctt cttgtaaata taagatctcc      2760
     tttactgaag tgctttaatt agatactttt ggattgaggc tcaaaggaga agacctatga      2820
     gacctccatg accaaattca aaaggtagaa ggaactactt acttttcccg tgcgaattaa      2880
     cgttgattcc tcttgtctca acatagagtt gggtgctctt ttccattctt ggggaatatc      2940
     cttttcttgt gatgtagttt tcctcgtctt taagagtaag atggcccttc aatgatattt      3000
     cagcaggctt aaaaacttct ccggccgtac tttcggtcaa tgattccctc tgtattgtaa      3060
     cgctcttgaa agtcctaaga agctgcgaag gttcgaggcc agaagggtat tccctcatcc      3120
     tttcaagctc tgccaatctg ctaagataag agatgtaatg ggtgtttata acctggaatt      3180
     ccttcttttc aaatgcatgc aattcattca tggcatttct atattcactt tcaattttat      3240
     ctctcaggct actaatattg ttttggaaat cctcaacatt ctttttgaac tcatttatgc      3300
     tttctttgag ttttctctct tcctcgacta gtcggacttc tcctaccttc aaaatctcct      3360
     ggagcctatc acaggcttct acgtaattca gaaggctatg tgatccgttc gggagttccg      3420
     aatggtttcc gcttattttg catttagtac agacaggaat aaagcattct tcacagaagt      3480
     agtccaccat tgtatccatg tggcttgcac agtaaataaa tttcttcttc cccacttcgt      3540
     taaagtaata tctcacatgt cttttaagga aatggtcgct gtgaacctcc tcatcacatt      3600
     ccccgcagaa gctagctctt tccgcaggac agaaagatat cgactggttt acacgacatc      3660
     tatcacacac aaagcttccc ttcgatctca tctccaattc agaatcatat tcaaaggtta      3720
     tgtcgaaaag aggtagaatc ctgcttggat ccttaatggc ataccaatag tttttcacgt      3780
     ctgcttgtga atccgacaag aaccccacct gatatcctat atcacttgta atgaaggaat      3840
     tgtaatgtcc tggaggattc atctgcttga cgtactcctt agatacatag attgattctc      3900
     caacagcaac cgagcagagc ttaaccttat gggtgatgga gtcccgggaa agcggaaccc      3960
     caaacacagg aaaataggtt acaggaccaa tctccatgca gaatgccttg attctctttg      4020
     tgtccccaaa tttcttttca aatgctgcag cctgctgcaa gcttgtgatg tcttctagct      4080
     tttctattct caaggttgtg ctatccagca gatacttcag caaatattca atgtcatgca      4140
     taaggggaac aaaaaacaac aaatcaaatc cgttcctgaa aaatagacaa aggacctgga      4200
     atccaaacaa agataattta ttcactttcc tccagtgctt gtggtcttca tgtgttgaga      4260
     atacttattt gaattacaat ggtgaagttg tctcccaatg agtatgccag tatatgcgaa      4320
     tccaaaaaag aaaagatgac atctccttta agctcctcca gaatgcgtag atccctaccc      4380
     cttaccttta cagtcaccga atcgaccgta gactcgggaa cgcggagtcc ggaatacttt      4440
     gatcttgttc taactactcc aaaggattcc atcacaaaat ttccatcttt tcctgctttt      4500
     atttcaatct cctcagaact caaaaccttg agcccattta ttgcaatgct aagtaatgga      4560
     acacctccgg caatctgata ctcttcttca tatcttttaa ttcttctttc tacattaaca      4620
     aggcttcctt ccatgcttgc ctcgtagcta tatcttaatt ccttctcttc tactgtaaat      4680
     tcctgtgttt gcttcaacat tgctatgaag tccttgactc tgactgtaaa gctgcaatca      4740
     cagaacttcg gcatttcaac aaaaatagat ctagaacata tgcttgtgtt tgttacagtt      4800
     atcttggagg caaacttcct cacaaacaca agaatgttgt gaagtagtgg cgataagtca      4860
     atcttcccca ttctaatcgg aaggcatgca aaattactct tcaataagaa attggtttat      4920
     tcacagcaaa gcccattcta tagagagaat cagataatat caaaacatgc aattgtccct      4980
     ccgtttatta gaacctcacc gatgtaggtc tccgactctc catctatctg aagataactt      5040
     tccttgagat gtgtatttac atgcatatca aaattctcta gcacccctcg atatgttttg      5100
     ctgctaagag tgataatcct gacacattta tttctattct tcttcagaat ctccagggca      5160
     ggcaattcca ttctaagggt catttcagcc acaaattatc cgctattttt ttgtgtcctc      5220
     ttcttctgtt ttattatgac tgtttctctg cctaagctat cactattctt taagactgtt      5280
     tctcctctat aaacttcctg tttgctcaca gatatccctg ttttatcgta aacaaacttc      5340
     ttaagcattc taacattgtt gcagttgaat tccaaacttt catactctgt tctaattcct      5400
     ttgtcaaaga taacagttac tctgccccct tcgtcggatt ctagctccct attgcatgtc      5460
     tttgctctca gatggttgtt tatctcctcc gaagcaatgt tctcgttgca gaaagggcat      5520
     ctctggtatc tagtggtctg tcctatttct ttgtacctac catcttcaaa taagtaggat      5580
     cgactgccat ctttcagtat tgcaaccact ttgaatctat tgaactctga caaagaatga      5640
     atttttcttt tgaatcgtct cctttgagaa taaaaatcat acacttcccc cttctctatc      5700
     tgcttcacaa ctctggcata gttccttttc accatgatat aattcttgta gtcctctgaa      5760
     tcttttgata aagaactcat atcatcttct tccaaattcc ctctgactac agacttcaat      5820
     gcagccttct ttatttcttt ccacttttct ccctctggat acaaaagtgt aaaatgcatg      5880
     ggctatagtc ttaatgattc cattgtttct caagccagtc tctttggcat atgggcttta      5940
     agaaaggaac tagttacata gttggtatcg agataaattc cagcttatga atataatata      6000
     ggctttaaca aatgcttatt ctatatgtgc ttggaatgcc ttataaacaa ccttgcataa      6060
     accctgaatg gggaaaatgg aaaaaaattc ttcagaccaa gaaaaaccta aggtgtttga      6120
     ttcgcctgta acaaagaaga aagtaatgac accaataaaa tcagctttgc gtagctctaa      6180
     tggaaagatc ggccaattcc tcaagaaaat acgagagtta agtgaagaaa acaaggaaaa      6240
     tttataaaaa taataagcaa aagattaaat tcaatcagaa ttcattccat ttagagaatt      6300
     tttctttgta ttgatctatt ttatatagta tgcatacttc attacttcaa atggatcatt      6360
     ttcgatacac ttgccgttta ctatgtagtt gtctaggatt aaatgtgttt ctttgaagtt      6420
     gtatataaaa tgaagctcgc aaaccttggt gaagaatctg tcgtagattg acataaggtt      6480
     gtttatcaag gaaagcacat acatttcgtt ttcattctcc acaacaaagg caataaacat      6540
     gtttccaaat ttgttaaaga cgacagtctc tctgccgttg gcaatgttcc tttctttctg      6600
     ggctagcacc attgatctta tttcctcgtc agaaagagag ggctcgtatg ttcttttgag      6660
     cctagtttca ccgtctaagc tgaatgcata gacctttttt atcatgaaac gataaacatc      6720
     actttttttc tagtccatgt gaaacattga tgacaaggat gttccttcca ccctcaatgg      6780
     gatctttgag tagcacaatg ctgtgcgagg aggaaataga ggagttgaag aacactacgg      6840
     tttttgatga gagagagatc gaacatttat acgaaaggtt tcaatttcta gacagggagt      6900
     cccggggata tctaacatat aatgagttga acaacatccc tgagttccag tcgaatccct      6960
     tcagtcatct tataatgaaa agcattgaaa agatgactga ctatgaaaaa atgacatttc      7020
     cacacttcct cgaatttttg ggaatctttt ccgagaagaa caatagaaaa aacaggataa      7080
     gatatctgtt cgacatcttt gacttaaatg gagacggcaa gctatgcaga aatgtacttg      7140
     tcagaattaa caagatgatg ggccaagatg gaaagatgga ggaagtcgaa aatcttttaa      7200
     acatttacga tgaagggggt aagggatact tagatacatc ggactttgct aagttttatg      7260
     aaagcgaccc tctaatcgat aggaatatga taatcgattt ctcgaagaat ctgaagcgac      7320
     ccaggcaagt ggggtttatg caagtgttgt ggccatcaac ctataaggat gaagaataaa      7380
     aagagtgacg tagctctaga tttggaaata aaattcatag tatcgcctac atttggcctg      7440
     tcgacggtaa tctagggact tgtaaccata aataaagaat ttgaaagccc acatcaaaat      7500
     gtttttcaag aaacatgaag aacccaaggc tcttggagca ggagagagac taaaccttct      7560
     ttccaaccga ctaactgggt cgatatacta tgaagataga gcagatgcac tcgaaaagat      7620
     cttggaaatg tcgaaggtct atccagttga ggtaggtgtc catgcacttg aggatgtaat      7680
     ctgctcgatg gaaaggatgg atgacgtgtc tattcatttg aaaatactca gtaacgttct      7740
     tcgatgtatc catcgactag agtttatcga cattattgtc aagaactccg aaagcctgag      7800
     aatattatgt gactgcattg gaaatggaaa gagcggaaaa gaagtgtatg atttactctg      7860
     tgtgctaagt gtttccgaat tcttttctcc taaggctgta ggaattccaa gcatggctca      7920
     ctactgcgtt caaatggtta aggaaaaaag gatgggacta atacctaggc ttgccttggg      7980
     agatctgaac ttcagaaggg agcttacgtt catgggcata tttgaaaatc ttctgaagga      8040
     gcttcaagat gaattttcca gagacgcaat gtccacacta gcattattgc ttaaagacag      8100
     cccattcaac cagaattact ttaatgagct aaggtgggat tttcttctaa aatacataga      8160
     caaacatccc aatgaggtgt ttgatgtttt atctgccttg atagatctta agaacattga      8220
     attccaaaag cttcagtctt ctgtctatag gaggattgac cttgtagttc ttcttgaatt      8280
     tagaagatgg gacttgttgt atctcattgt aaaagataat caaccataca cagaaaaact      8340
     tcttgagaca tcggtattcg acaaaattga ggaatggctt cccaaggaga cccttacaac      8400
     aaaacagaat gaactctact tgctggttga ttaccttttg ttttggagta atcctgacgt      8460
     ctcaaagatg aactcgtaca agatatatac aatgaagagc ctaagagagc aggacatctc      8520
     tacaaacgat cttatggaag gagccttcaa aataattggt cagctcgata gtagagaaga      8580
     gactgtagta tttgatgcat tgatatttat tattttcaac ttcgaaaaga gtagggctga      8640
     aaaaatgatc tctgtacttt cagagatatt ctgtgattat actaagccta agctccacag      8700
     gtttctctgt cttattattc tcctcatgct ggagacaccg gtagacaggg ttaacatcaa      8760
     ccattatact gcataccatc tgttaagaga ggcaagattc cttttatgtt ctatcgacct      8820
     gaattcccca ctctatctca caaatgaaat ggtggacatt cttgtaaata acattggaga      8880
     ccttgtccgt atcagatgat gaaatttcta gaactaaacc accttaagga aaataataga      8940
     gggcttcctg gaaaaacctg tatgtttcct attctatttt attatctctt tgatctcttc      9000
     ggaaaagaac cttaaaaaca tttcaacatc ttcaacacgt gacagaacat gtgtcccttc      9060
     cggtatcttc tcaactctcg aatttctcac caatttcagt ttagattcaa tgtttcttac      9120
     agaatactcg tcctttccag ataccacaaa aagaagtctt gtgcctccct tgtttaactc      9180
     catataaaac ttatcctcca gatagctaga aaacatgtct tccttcccat atctagaaaa      9240
     gatgtccaaa attctttttg gtgttaggta taaaccactt tgatgcttga ttgctacgtc      9300
     ctcctttttc ctctcaattg tttcctttgc ccatctcaac agatctggaa ggtttttgtt      9360
     ttcatgttcc tcaaactcga catcacttac agcccctaaa agcacagcaa gcttaatctt      9420
     tctatctttt gtattattta aataataaac aatgtcttga catcctgtcg agtttccaac      9480
     caaaatcaca tctccgttcg tctgagacag caagcatccc aaatcttcta tgtcatcatc      9540
     tattgtaaag agtccgtact cgggatggga tcttagctgt ggaattataa attcatagcc      9600
     attctcaata caatactgat ttaacataat tgtgggaaga caaatcggga agcgagatgt      9660
     taggccacca atatatacaa ctttggtatt actttcgact cgattggaat atgcaaccaa      9720
     attatttttt gaatcgtacg taaatatctt tccttccaac tcttctccaa acatggggga      9780
     gaaaagctct cagactataa gggggcctag tttggttact caaggatgtt cttaaaatcc      9840
     atcttcatgc tctaaatagt gaaaaaagat accaatggat ggtgaagttt tccaggagca      9900
     cattcaatag ctctcggaag tgattcctag gtcatctaaa aacctttgtt attttcattt      9960
     gattgaaaga aagagaattg aggtttctag aataaaactc atcaccttct ttaacatcgc     10020
     acaatatata gcataacccc ctgcataatc cttttgtaaa acaaaatcct cctctgatta     10080
     cacgcccaat cacagtgtca ttctcatcga aaatgaacgc acaccgatcg gcacggccct     10140
     tctcaagttc aaaagatgca aacacgactg gatcgctagt atatatgtac atcaagtcca     10200
     tattgagtgc cattttcttt gacctaggtg ttctctcata tttacttttt ataggctccg     10260
     tatacgattg ttcaaagtct ttgtagagtc tagtcgttga gtaatcaaat ggataaacca     10320
     tgtaatcatt ttcgagtgca agcctctgga gctcttcaat acatatcgga attattccca     10380
     catttacaat atcctgccaa aagctcataa ccatattcct tttgagaagt accttcccag     10440
     actcggcttg cgagagactt ctaacaaata tagccatgct ggatctgtcg gataaagccc     10500
     tatcaatttt tcccttctcc ttatgagaca agatccgagt aagtcttccg gtctcatcgt     10560
     ttacctcatc gagaaataat tcatctactt gaatcaacga taagcagcat tctattctac     10620
     catattcttc caggatcatc ccaaactcta tctcctcgag atcagaagta atgattatta     10680
     gaaacctttc actaacaatt gcttcaaaaa ctatattctt ctgttggatc ctttgaacta     10740
     catccccaag actaaaatct attcctgaaa tctctacatc cggcctctta tacaccacaa     10800
     tgtctttgta ggattcatca aacacaaatc ctcttttctt ttgtgatttg tagataaact     10860
     tactactctt catccgtctc ctcaagggaa tagatgtatt ccaaaccttc aacatctcaa     10920
     acctcttcgc ataccataca tgtgtcctta atccatgtct atcctttttt ctcatccggt     10980
     tcttcttcct tgtgcgtttc tcatggctcc tgagtctccg tcttagataa aaaggcagcc     11040
     tttggaacat catcgacttt tttctatttg tttcgatagc tgcttcaatg gattgaatct     11100
     ccttcgacct ttcctctaca aagtcaattg gacttatctc cctttcaacc attactagag     11160
     agtttttcca gggtctgaat tttcagaaca ataccccgca tggatggtta tttctaacaa     11220
     aggacgccat tccaatgata aatccttgtg gccgtccctt cccatggact gtatgatatc     11280
     accccaaaat gcatttacaa tcgaccggat attacaagct gttagaacat ccacaatcct     11340
     gatagacaca accaaggaaa taacatttca actggtttct tccgacaaga ctcttgttct     11400
     gaatctcgat ctgaaggaga cctttttcga aaccctaagc tcgaagaaca ggctcgccct     11460
     gattccaagg cagaaattct atataaagaa gatgaagcta ttgaaaataa ctaccaagga     11520
     atatataata acatttgaat atgtatttga caagtatatt ttaagaagaa gagtattcta     11580
     caatccatca tcattttttt cggttgggtt taagacagac tactctggag aagtcagtcc     11640
     aagcattatg aggctggccc taaaggagat cagtgatcag ctggttacat tgaaaataga     11700
     taatggtcgt ggagaaatct ataatgaaga aactaaaatg ggatttccac tagagttctc     11760
     tggagagttt tctgtggatc ttgttggagg taacctgaga agtatgctcg aagtttctga     11820
     cttgttcgcc cgaacgatcg taaactacgg agcatccaat ccatctatta actttatctt     11880
     ccttgggaat gaaatcaggg cttctttctt tgcagctata aaccataatc caatcaaaaa     11940
     agaaaaccta agctccggag gggcttttgg acgatagatt atttcttaga atccctgttg     12000
     atcacgtatg catcccaaaa ctctggagaa tatggcgttc ctactaaact gtctttagat     12060
     tcagtaggca ttaaattgta tcatggtagt ccaaaccttt ttatgtaaaa tatgtttgga     12120
     gaacccctaa atgaaattca acaaaagatg tctgacggtg ttttccgatg agaagccatt     12180
     tatggccatg gggacgaaga gcaagctatt tgatacatcg ttttctctaa catccgagct     12240
     gtttttgtat gattatagcc taggggttca atatcctccc ttacaaacag acaacaagtt     12300
     ttataagctc aagtggtgtg gctggggaga tggggagatc ctagccactg gaaacgagga     12360
     tgggaaggtg acgctttata cgcctgcacc agaaaaaaat atctctttcg agcttctatc     12420
     cagctgctgt gttcttgaag gagatgtgct tggactggac ttcaatccgt ctaaaggagt     12480
     tcttgcagca gggtcttcca atggaaagat tatattctgg aacctgaaca gacttgacag     12540
     tcaatataca agtgacatcc cacttacttc aaatataact tgcctttcgt ggaacaaaaa     12600
     agtatctaga atattatgtg caggcacgga tgatgggaag atactcatcc tcgatataag     12660
     ggccaagaat gtagccatga cccttggagg agatgacata acaatggtat ctgatgtgat     12720
     gtggcatccc aatggatcaa catctatttt ggccgcgacc aaccagaaga gacttcaatg     12780
     ctttaatctc agctccgata gtacatctca aataggagag catgaaagtg gaattataag     12840
     actatccctg attgataaag gctatatggc agcttcttct aaggaacagg tggatataat     12900
     cgaagtgagc agcaacaaag ttattgatac aattccagta gatggaatat tcgaagtaag     12960
     cttttccaag agagatccat tgatggcttt atcgtatgta gggggaacta ctgagattct     13020
     tcctcgagta actaccgatg ttctacccac caatccagga tgcatagttg gatgcaatat     13080
     tgttggaaaa gatttatacg aaattgaaga caagaagatg aaggatgtag aagaagatgc     13140
     atttgtcgga aagattaaaa agctccttta tcccgacgga aactatagca ttgacagaaa     13200
     aggattaggt gagcttttgc ttggagaagc cataggaaga aacaacaaga agaatcttga     13260
     ggtggacgaa gagttaaaca aaaaggtatc tggaatgagt cttgaactga agctggatct     13320
     cgaagatcct ttgaccttgg ccttgataaa gggagacctt gaggaagctt actcggaatc     13380
     tgtggaaagt aacaaaacag ttcccttttc acaattcctt gcactggcca agggaagtga     13440
     atctttgtcc tttgattccg atgatcccct gattcttctg gcaacggcac aaattacagc     13500
     taggttttca gatctgcttg aaaagatatc tacctcccaa tggctagccc tactttccat     13560
     aataagcttt tctccactat cggattcgga tttcttttcc aatgctttgg agctagcaaa     13620
     taagctgggg aatgaagaaa aattgcttgt gtatgctata gtcaacagat tagatgatta     13680
     ctttgaacta aaggaatcta tgtatagaat gccaaaaagc atctatgagg ttagagactt     13740
     tttccaaagg tacaaagaga tagtgtctga tttggaatcg atgggaggcc tttacaaaag     13800
     cccaatgatt tcggaatact tttggtatgc atcaacacat ggagaaacac caactcgaat     13860
     caaatatgaa gacttgggaa tcaacatcta tctcggaaga gcaactagca gtatctcctc     13920
     ccctaagtcc tcctctccaa gcatcggaga ttcatatgga agacagaatg tgtttaagag     13980
     atctccatct ttagaacctc aaacccgcca agattctggt gctacagtga aatatggaat     14040
     ggcatccatt aaacccaata cccctatgac tggtccttca ttgctttcca gccatagtgg     14100
     aatgagtact acgactacca gttccttagg aagaccaatt attcccgggg caagcatcag     14160
     ttctgcacac aaaaacatcg ttcaatcacc accatctccg gtaatttctc agcaaagaat     14220
     gaaggtaccc agcccccctc tgggaccaaa caaatccccc tattcttctg ttggcctgtc     14280
     tgcagcacag aagatgtata ttcctagacc tggatacaaa actatgccta gcacgcctac     14340
     atataactcg gcatccaaag gaatctccca gaagacatac agctccatgc cagacatttc     14400
     tagtctttcc agtagctctc agccggtgtc tacatatggg acgatgtctc gcgggccttc     14460
     ttctcaagaa cactcatctc agtcaaatgt gtcgaagcca tacattccta agccgggaat     14520
     tccttctagc ccttctctct ctccccagaa taatctccaa aggcccaata ttccaatccc     14580
     acagcctcag ggaagagatc tagagccatc ggcccaaagc caagctagta gcccacagaa     14640
     gtctacagac aatctaaatt ccgaggagat acttaaaaca tttgaaagca tcaccgaggg     14700
     cttaatagaa aaggcatcga gcaaggctaa cctgatagtt agaaataagc ttaaggaagt     14760
     taccaagaga ctttctatat acggcagtgt tgcaaaagac actttcagtc ctttgattct     14820
     gggagggatc gataggataa acaaagaaat caaaaacaac gaaaataccg acacaatgaa     14880
     gcagaaagtc agagagatta ttctcgaatg caccgagtct ggggaaaaca gagcagattt     14940
     gtggatgccc agtatctaca ccctccttca gattgtctat cactagtgat taaacgagat     15000
     tattggatct atacatgtcc aaatccattt catttttgaa actaaaaagc atattcctcg     15060
     tccgggaatc gaacccgagc ctgctgcgtg agaggcagct atcctaacca ctggaccaac     15120
     aaggatgttg tggatcttga gaaaagccat cactgtttct tcaaagccgg tgcttttgat     15180
     caagattcct gttgtggcct gaaacgtcag tgaaaacttt ctctatccaa agcctataaa     15240
     cagaaatgac aagatacatc ttaggcggaa taatcggatc gggaacatat ggtgaggtgt     15300
     acgaggcaat agacacagaa acgaaggaaa aggttgcctt gaagagaata aagctcaatg     15360
     agaaggaagg aatgccaggg actgccctta gggaaatatc aatactcaag aaacttaacc     15420
     acaaaaacat cataagcttg gtgtctataa tacataccga tgcactcttg acaatggtgt     15480
     ttccgttcat agactatgag ttgaaaaagt atattgggat gaacacaggg aaaaacataa     15540
     tggagcttgt taaccagttg atatgtggag tacactattt acatcaaatg aatgtagtgc     15600
     acagggatct taagcctcag aacatccttg tcacgagtga tggagtattg aagatagccg     15660
     atttcggact gtcgagaagc ctggagataa gagtgccacc ctattctagt gaagttgtta     15720
     ctttgtggta caggtcgcct gagcttctta tggggagcac tagttacaga ttttatgtgg     15780
     acatatggag tctaggatgc ataatctacg agatgataac gctagaacct ctctttcctg     15840
     gagagagcaa ggaaaatcag ctaacactca tccgaagaaa ggcaggaaca aggagatctc     15900
     tcaagcatgc aatagagaaa aagttaacag ctccaaagtt tgtggtcgat attatactca     15960
     gatgcctcga cttcaactac gatcaaagaa taacagcaga cgagatagtg gagattcttg     16020
     aaaacgagta cggaactcgc ggagggattt cttagaaatg gccacaatct ctggaattgc     16080
     cttaagatac aaagagccgt tttccaatcc ccagagataa tgaaaacgga atggggaaga     16140
     ctaattattg agaaaagatt tggagctaag cctaagatca agccaaaagt acaaagatgc     16200
     tcagctacgg agtatggggg gatagagaag ctctctgagc agctaacggt aaagaacaga     16260
     aagatatccg caggaaggcc tgctaattcc gtggaagaat ttgaagaaca aagcgaggtg     16320
     gatgttattg tggagaggct ttcccaatcg tttgagtttt cgaggacaat tcccccacgt     16380
     gttccataca agggaattga aaaagagctc tttaaggagg ttgaaggaaa ggtttttgat     16440
     cggtggaaag gcctgcaaag atgtacagtg tttgagagaa atatagagat atggagacag     16500
     ctgtggatta cttgcgagag aagtgacgtc atagtgcaaa tagtcgatgc aagaaatccg     16560
     gaattctttc tcaacgatga catccgtaag ctttatccaa agaaagaaca tgttgtttta     16620
     atcaacaagt cagacctatc ttcgaatagg acagagatca aaggatatag atgttttcac     16680
     tactctgcat tggaaggaaa aagcctcttg aagtttgttc tggggtataa aggaaagatg     16740
     gttggatttg tggggtatcc aaatgttggg aaaagcagca caatcaactc aataatgaac     16800
     agtaaacgag tcaaagttag tcaaacaccc ggtaagacta gacacataca gacaatatac     16860
     atcgaggacg ggccatgcct gcttgactgt cctgggttgg ttttcccaag acacaggaaa     16920
     cttgatctta tacttcatgg aatactaaat gttgatcagc tactagatct gaatagtagt     16980
     gttgattaca ttatagagct cattgggatt ggaaagctct gtagatttta ttctctaaaa     17040
     ggattttata atgactcaag atattctaaa ggaactaact acataaacct gatgtcaatg     17100
     tcaaagggat gggagacgag taggtgttta aagacaatag tcaaggactt tgtctcagga     17160
     aaaatcccgt acgagaagat agatgaaaat tgtctggagg ctatgtttga ctggtatgag     17220
     aaggagattc ctcaaaagag ctttatgtag atgccttatc aaatctttat cttaaaacaa     17280
     agcattaaaa tcctcatctt atatatgttt tattaaaatc tcctatcgag accgctcctg     17340
     gcctaggttc tttaaagagt aggcttcttt atccatcagc tccactccga ggatatgcat     17400
     gtatataatg cctgtattgc atggaatctt atgtcatcgt tttcactgtt gattaggttg     17460
     aaaagtattt cttttacttg atacttgttc aagaccgtgt tgatttctgg ggataccttc     17520
     actagctgga agatgtcact gcatgcaaga cacacccaag agggattatt ggacttcaga     17580
     tacttcttaa gaaccttaac tatttcaacc ttgtttttca tcagcatgtc aagattggtg     17640
     ctccagaaat cctccttgtg atgatactca gagtcttcaa accttccaga aaacaactca     17700
     ttgaggtagt tccgtatgca aaactgcttt gtactctgca ttatcttggc tctaaccttt     17760
     tccagatctg ccattagctc ctcatcacta tatcctcctt ccaaaagaat ctcagtgcat     17820
     tttgagatgt cgttgagctt ccctggtgaa aatatatacc cactatcaag gatgttggta     17880
     attattccat aacataccct caagatcttc tctcgtgctc tttccttcac tataataaca     17940
     acatcgtcga tcaaagtgtt cattttgtca atacactctt tgctatagga gaatataaga     18000
     atgatcatta gcgtattgta ttggatctcc ttaacaaaca cagatgtgtg gagtatttca     18060
     ataaacattt tgttggatgc gagctccatt ttcctcttct caacgtcgaa ttccgagttg     18120
     gatttgcagg atagaaggtc tactagcaaa gatagtagat agttgctctc ttcataagat     18180
     gtgttttcct ttaacatctg tttgaagaaa gaaatgtact cctttctgtg gttcttgtcc     18240
     ccatagattc ttgtcagtat ctctgcgctt atgtatctcg aatagatatc tggacaaaaa     18300
     agtaggtcta tcaggtcatc ttcccctagc aattcggggc agctcagaag aatcgaggct     18360
     cctacatttt cttccctaag aagcatagac acttcctttc tgtccccatg tttgcttgcc     18420
     tctctgaatc tctccacact ttcagatact acttcgggag atagagaatc tcttgttttg     18480
     gcttccaact ttttcaaaaa cattaggctc tgttcgggat tatctttaat ttcttaaatc     18540
     tggtaactag caagcagctc ggagtcccgt gctcggaact aattcttggc tctaccagct     18600
     tgagatttgt gtttacttca tggattttgc attctgtaag aagtcttgcc aaatcctcct     18660
     gccactagac ttccatccat gtgaaataca aaagtggatc cctggatttt caggatggtg     18720
     gccttgttca ggaaatcaga gcctctgagg aatgtaacaa acaagattgt aaagagagca     18780
     gagaagacgc agtttccgct cagcaaagtg gaagaggttg tttacaggca gcagaagatt     18840
     atggatgcct ctcaaatagt aatggcggat aaatattcgg atgacatttt cgaatatttc     18900
     tcggctattg ataaaccatt cgtgtatgtc aatgatggag tatcatggaa gatgagaagt     18960
     ctattagtcg actggatcat tgacatccac gataagctgg ggctctgcca tgacaccctc     19020
     tttcttgcaa tcaatctcgt tgacagattt ctttctatgc gatctattcc aagctcgaag     19080
     cttcagcttg ttggaatctc tgccttgatg atagcatgca aatacgaaga agttgtgtgc     19140
     ccagctctcc agacatttgt tcttctaaca gagaagacat tgacaggaga tgacgtgaga     19200
     aaagcagaaa agtacatgct ccacacctta aactacgatc tccaatatgt ctctccacta     19260
     aactttctca ggaaatgctc caaagccaac aactacgaaa tcaacagcag agcagtgggg     19320
     aagtatttat tagagctcat gactctctat gaagagttct taaaatttaa gggatctgta     19380
     agagcagcgg ctgcaatgta tctttcgaga aaaatgacat ctcaggatca atgcaagaac     19440
     ctctttacca tgtattctgg acatactaaa gatgacataa aggaatgctt caatgcccta     19500
     gtccgtgtca taagtgaaag cattccattt gaaaacatac aaaacaaata caacactccg     19560
     aagtttcttc atgtgtcatc ctttgttaga gagtatgcag agaaaaactt caagtagctt     19620
     cgcccttatc tgaataaata cttccgttta attcaccatt ctagtggcta caagcttgct     19680
     accactcccc gatttccata tattcatcat gccaaaggac cctagcatgg ctaacaagcg     19740
     agtaacatac ggattaagtg taatttattt cctggctttg atcaggatcg gaatgggcaa     19800
     atccaacaga gtgctcgaat taatcgtcca ctttcctctt ctattcctga atttcatact     19860
     cattatgctt ttgatatcgg ctggacaaca actctaccaa aagaatctct aaaagggctc     19920
     cgaatctatc actgtgtaaa taaacaagag caaatgattt caccatatga aatcctttct     19980
     cagactatag agaatgctct ccattaaagt tttctaacaa tttgaagtct acaattttaa     20040
     acagaaccaa cttctccaga actatccggg aaaaagactc aagcccctca aatgtcttaa     20100
     agaatataga gagaaacaac ttctgctcct cttcattgag cacgagctgt tccttgtaga     20160
     tttccaggta tgtaaggaaa tgagatacac ttggggatcc aagaagacag aaattcctga     20220
     agaacgcgtt tttgtcctca aaattggttt tttcaaattc ctctcggctc atccttggaa     20280
     cttttttagc ttctagattt tctttcttat tcagaaaagc ttccacctta tttgatccag     20340
     aaattctctt catgtttctt actgtggtct cggtaataag gcgcctaaat ggatctatat     20400
     cctccgaagt cccaagaggt atataggaac tgcttatata gacgctgttg ctctcatcac     20460
     taggtccgta gaagtactca aaaacaagcg gcagaaggat gtcccgaaac tcttgatcaa     20520
     acaaaggaag gtcttcaagc aggatcttta gaaacccttg cttctttgca agttcaagaa     20580
     tcaatgcaga taaatacagg ctattctcct ccttatgaag aattcgaagc ccatccacca     20640
     aggtcttttg ctttgaaata tatcctaact gcccaaggca ttcatgaaca gagaatcgaa     20700
     agctccttat aatctgcact acgcaaaata cctcttcaaa gcttttttca ttagaaatcc     20760
     caagcattct ttctacttct ttcttgcatc ggtccagaga agccggaggc atttcgaagc     20820
     ttgtggatcc aagcaaggaa tttgttgtag gtatttcttt aacccaaaag agaccctctg     20880
     tcccttctac ccctagtctt ttgaaggtaa aagacgcaga tatcaatccg taagtatctt     20940
     cggccattga gatgtcatta gccatgctta ctatcttatc tttaaattcg ggattgtctt     21000
     ctgccaggtc gtttataaga ttacttatga tggacgacct gtgcggcata agtagtataa     21060
     cactctttat ttcggaaata accttttctc tatcttcaga tagtcttgcc tcagctagta     21120
     tacgcttgta gtttgtacta ttgattcttg gaattggaag ttgcatatga gggaaaaatt     21180
     ttcacttgct tttaatagct ttcaaaaggg agaacccagt accaccgcag ccctcgtggc     21240
     atattatgca tctctccatt tgtatttatt caggtatact aagacatcca tttgtaattt     21300
     ttgttgtctt taccctgtga tatggactcg tcaataggaa taagaggaaa caattttgta     21360
     atagtggctg ccgacacaaa gatctctact tcctttcttg ttgtcaaaga agactacgag     21420
     aagttccaga cagtcggaaa cagaattgtg atgtcgatga ttggagacca aggcgatgca     21480
     ttcagaacta tgctctatgt gtccgaaagt gcatattatg aagagatcca gaatggaata     21540
     gagctcagtc caagtgttct ggcacatatg atccaaaaca aagttcacaa ggctctccga     21600
     aagaggcaac ttgacatgtc atcgatagta gggggaaagg gcccggaagg atacgatctg     21660
     tggtctgtcg acagatatgg agccatttct tccgtaccct tttgtgccaa tggatatgca     21720
     gcgtactttg tgtacggaat ttttgatcga gagtacactg aagatattac tattgatgct     21780
     gctctaaaca tcatccaaaa atgtattaat ctattgaagg aaaggcttat gatcaatctc     21840
     gaaggattta tggtgaaaat agttactgac gatggaatct caaccagaac cttaaccccg     21900
     gaaataaaaa gctagtggtt tttgatgaaa agagtatctt ctagtttgga caataagttc     21960
     aagacagctc taccttcaat tcagtaggta tattcttcca ttttcaaaca ggattaagtc     22020
     tttttctgct aatcccgaga ggatggcttc cacttctggc tctgtaacgc tcacgtctac     22080
     tccaagatat tccataaagt ccttgatatc cagcactcta gggttttttg gatctgcact     22140
     ataatcatat agtgcgtggc ttacaaagtc gactttgtcc tcatcaatca tagcctcttc     22200
     taggcgttgt ttcagtgtac ccttttcatc aaccaggtca aactcatctt gcggctctgc     22260
     tcccccaact ttgatccttt tggatgtctt gatcaccttc tggaatagag agtccttaat     22320
     tagattcact gcacattccg catcgtcgta ctcaactaca tcgctcagcc ttagctttgc     22380
     atttgcagtg gcaagacgaa tcattgtctc cagcattctc ggagtgatag aaacaatctg     22440
     ttgtttccta tccttactct gtctcagcag agtatactct tccactataa gtctggacgc     22500
     ctctcggctg agaaccggtt tttttcttct gcagtgttga atatatgctc gaaatacctc     22560
     ttgcttgatt cctatccctt cttcctcata tccctgtcca agcatatgca ttcttagcac     22620
     atgttctgag atcagctggt cagtgtctgc attggacttg tcaagagtta caaatatgag     22680
     atcaaaccgt gttaggagac tttcgggaag tcttacgttg tcttggggag gtcttgattc     22740
     tttgtattgg ccccagatag gatttgctgc tgctaacacc gagcatctag cattcaacgt     22800
     cgtgtgaatc cctgcttttg ctatcgtaac tgtctgctgt tccattactt cgtgaattgc     22860
     aacccggtct ccatcactca ttttgtcaaa ttcatcaata cagaccactc ctctgtctgc     22920
     taacaccatt gctccggctt ccaacctttt ttctcctgtg tctttgtcca gaaccaccgc     22980
     tgcagtcagc cctaccccac tggatccctt cccagtagtt ggaacggata gctgcgccgc     23040
     attgagcaca tatctaagaa gctggctctt tgctgttgaa ggatctccaa ccagtaggat     23100
     atttatatcc cctcttatct tgctaccatt cttcatcaca acttcatttc ccccaaccag     23160
     aagtaaggct atggatttct tgatgatgtc atgtccaaat atgctgggcg caatcgaatt     23220
     atggatgttt ttcatcttcg atagtacttc aaattccatc tccatctccg gctctgtttc     23280
     tccttcttct tcttgtattt tttcaatgtt atttgcgact ataactgttc gaaatcttga     23340
     gggaaattgc tggtttccaa agcaaagact cttataaatt ccatagatct ttgttctatc     23400
     tccaggcttg agttggtcaa ccaagtcaaa agacaatatc acctccacag acctgggaag     23460
     ttgtccagga ggtgctttct ctggcatctc ctgtaaaaca atggtttggt ggtcaaaata     23520
     ctctgaaagc ccaaactccg ttgttaacag agtcccgtcc atgtctcggg taggatacac     23580
     tgtatttgta acagggagtt ttgttaccat tgtggcatct ctatactcct tggaataaaa     23640
     tacatttttc aatcgattgt agtgcacact tctcatgatc ttgggcctgc atatagaaca     23700
     agacgtaact attccctcca cagagaccat ctttcctata tatacactcg tcaaggttct     23760
     aggattgaga agatgatctc caaacgatcc cttgactcca aggaatatct ttctcccacc     23820
     catatcgctt agctcatctt cggcgaatgg aactagagtc cccggttcct ccagaatccc     23880
     cttggcgagt gttttatcaa acgcacgcat atcgtttata ttcaaaataa ttctctggta     23940
     gtcctcgtat ggaagcttgg aaatcacctc tccaatatcc ttgtcctgtg gtgtgcgata     24000
     agactcgaca aagcccttga acagttcaat aaactcagat tccatttccc gtagggttca     24060
     aaaatttcta ctacatcaag ccttggtata tccatacctt agaaaaacca gtatccttag     24120
     aatatcattt attcagttta caatggtgaa gtcgttgtac gacataaagt ttgaaaaaag     24180
     cacatagaga tatctgaacc acaccatctg ggacctatga agaagcatca ttttggtaga     24240
     actcatgtac atgctaaaag gaatagtact ggagactcta gaaaagctga tatcaatcac     24300
     atattttcgg agcaagtctt tggactttag aaatgcccct ttcacattgt gtaacttcaa     24360
     aaatagccta gctcccttgt agcatgaaat atgatttttg tgtccagata ccccaaactc     24420
     atcaaacgtc atcagaacgt cgaatggtct cgttatgtat atccataaaa gtttcaaata     24480
     aactgccaat ggatcccaat cttctccgtc tgcaaagagt gctgtcataa tcacttttgt     24540
     ccctgcatag gaccctactt tcctgagctc tttttccctc tctttccctt ttccttcttt     24600
     gttaccattt gacaggcaaa gaatatccat tctttctctc agactcaata gggatggagc     24660
     aaagaacata gactcatcat ctggatgtgc aatcagcagt agatgcctgc ccgggagtaa     24720
     tgacgatctc ctcaatctcc ttacatttct tagcataatt actatcagta taaccgaaaa     24780
     gaatgtctta aaccttgaaa accttttaaa cattttagga tgtagtttaa atgccggggt     24840
     gtgtttgtaa atcctttatt taattcaatc aacttgatct ccgaatactt tgcaccattg     24900
     tggaatctct cctaggtcct ccgatatcat ctcacttatc tctccattat caagacctat     24960
     aaaaacgacc ccaccatcgc atgtaaggca gttcatctcg gaactactta gatattctcc     25020
     aaccattcca gttctgctgc agcatcgcaa cgcacctcgg tccaagctga tcagtatttt     25080
     tccattaaat gtaaccttct tgattctttg gtcgtgtttt acactgaaca gctcctttcg     25140
     ggctctcaag tcatgaaagt aaacagtccc ttcatttgtt ccaactccaa agtctattcc     25200
     attttccgcg aaggttatac tggatggaga ctcattatat tcaaccgact ttactatctc     25260
     tttacacctc tggtcaatga actgcactcc tccagctcct ccaaccccaa taaggccatt     25320
     gcactcattc atttcgattg aatatatctc atctatcgtt acagcataac ttctcagaaa     25380
     cctcccttga tccagattga atcgatagac agcagacccc ttccccccgc tcatcaactc     25440
     ggcccggaac ttgttaagac agatatcaaa acacactgtt ggtgtcctta ttccttcgtg     25500
     atgcccatac ttggcatgga actcaattgt tctgtctcct ctcaaaatac aaatctttga     25560
     ggcatctggt acaagagaca acactcttgc cggttctgac tctagatgcc tctccacctt     25620
     ttgggcaaga ttctcaaagt catagatctt tacacaaggc ttgtaaacac ccacagatag     25680
     aagatatcgt ctgttttcag atattgctaa gtctatggac gatgcagggt gcccgagact     25740
     ctttatcttg gacatcttct ccaacttcat ctgagcttcc gacgggtcgt tatttctttg     25800
     gtttttagct gcgggcaaat aaaaggcccc tgatggatag cgaggacgtc cggctttcaa     25860
     gcgaatactc tacagaggaa aacaacacag agattgtcag catgtccaat gccgaagtga     25920
     gaatctcaag ttcagatcgt aaaacccttc ccagaatgac caaatatgag aaggcgcacg     25980
     taatcggagt acgtgcatct cagctcagtg caggagctcc tccatttgta gacataggaa     26040
     atgaaagtaa tccactcgcc attgccaaca tggagctaaa tgaaaaaaag attccattta     26100
     tcatacggag aagacttcca gataacagct tcgaagattg ggcaatcgac gagctgatga     26160
     tacctggagt tgactttcaa tagcaaaatc ttacacctga agaaaggcag aaataaatga     26220
     agtaaagcac actttagtta tttaaatgcc ttctagaccc aaagggataa acaaatccgg     26280
     cttttcgatt tccttagcta ctccgggcca acaaatggct ttatttgcga catgtacaca     26340
     caggcccatg caatgtatcc aaatgctaaa gcgccgatca gaccgattct cacttcgtcc     26400
     ttgtttctgg tggatttccc tcttgtcaac accactatgg cggtagacac cataagtatg     26460
     aaagcaatag agcacagaag aatagaagcg tctgccatct atgtgtcaag ggctagtttt     26520
     gaaacaataa atgctttact agaatcacat attgaagtct aaatatatca aaggcttttc     26580
     taggcttaag gccaagagga tctgtatttc aactcagagg tttgtggttc tttgggaatt     26640
     caaatcctag ttgaagtatg atggggaata ggatgttttt cttggcttga attcttttgt     26700
     gaagaaccag aagaagaata tggatgataa ttcgatgtat tcctagagct tgttccaagg     26760
     atatcagaca gacaaaactc cagggaagga taaagtttga gattatctcc cccggaatgg     26820
     ggattaaaaa aaaacgacaa agtaagaggc tgaccacaag gaagagggaa agcatgctga     26880
     agaaatcaag gatagatgag agaaagaaaa gaagaatgaa cagaaagatg caagcgaaaa     26940
     tggagaaggt tcctccatcg gttcttagaa cagatgaaga aaatatccaa tatgcagaga     27000
     taaaaagaat ggaaaagctc aggaagatgg agtatgaaga aaccttaaag aactcggaaa     27060
     agaaagaacc gtatctcaat gaaatggtga gtctggtgtc taaaagtgat gtggtgattg     27120
     aagttgttga tgcaagagac cccgatggca gcaggaatgg tgaagctgag aagatagttt     27180
     ccttacacgg aaaaaaactg attattattc tgaactatac acactacgtt ccgagggaaa     27240
     tagttagtga gtggaaggtg cacttgagaa agaatggggc caattgtatt gaattggggg     27300
     aagaagatat aagctggata ggagaagaag caaggatagg gatatttgga aatccaggat     27360
     ctgggaagaa ttttgttctc cagagtattt ctagggttct aggaaggaag ccgaagtcgt     27420
     ctattgtctc agtacctccg agtggagtta ctccatcaag tattcttaga ggatgtaatg     27480
     gacttattgg aataccattc aaaagttata ttgatgcaat tattgaaaga atcgacaaga     27540
     aagaggttgc tatcctccat agaatacctg agtttggcag ctcagaagaa cttttggaga     27600
     gtatctgcga ggagtaccaa atagatggag ataacaaaca cattcgatat atgaaggcta     27660
     gcgagaagtt tctggagagt ttccttctgc ataagatcct tttttggagg agggttgatg     27720
     aagatggact atcgtttgcc tttccttcgt aaaggcgatg aataaacact taagaattgg     27780
     atgaaatgct tttgccaaga cacttcggtc tatgtttttg aagggttgtt atgccgggat     27840
     aattaaggcc ctggaatgat aatcggattg tttgttgcaa acagcctgac agggcaaatg     27900
     gtgtccagaa tgacccggac gatgcctgtg tcgaagatgg agcactttgt atttgacttt     27960
     ataagctcgg gggcatctac aaacggggtt ttgactagaa gcttttacaa gtatgtttac     28020
     aatgtaattg attcgaccta ctatgttgcg attacaagca taggatacaa caatgtaaag     28080
     gcacagagga ttctggacct cttgcagaag aacacggatg gcgaagtgat tgatgtcttg     28140
     gtaacgatag acaacattct ttatggacaa acaacctttg actcgaacat cactttgata     28200
     aaggacatgg acagccagga ggaaaagatc catgagatga tgatgaaaaa caagagtaag     28260
     gagcttatcc agaagcagaa ggagttccag aagaggcctg tttcagacat tgatcgagaa     28320
     cttgaaagag taaagaatct cgagatagag atgagaaacg aaagcataca acagctcaag     28380
     agtattgtga agacaaacag taatcctgta aaggagaaga gaagggcctt ggaaacatca     28440
     ttgagcccag tattcattgt gttcaaggaa aggcttagga tggagatcga caaagaaaac     28500
     aacatcaaaa gcggagaggt tcagggagat atgagcatta ctataaagga ggaggagtat     28560
     agagacatag aaataaagct tggaaatgta gggaaggatg tgaagtttag cccaaatctg     28620
     aacaagtcta tgtctgggga aggaatactc agatgtgaaa agggatttcc tattgaaaag     28680
     aatgtggctc ttgtgaagtg gaaaagctct gatgttcgag aagcacccat tacagtcacg     28740
     ttctggccca gtgagacggg tctgaatgta taccaaataa tgtttgaata tactgcagag     28800
     tgcaatatga aggacttaag catcttcttt tctaaaagca aggtttcgaa cgtctcaatc     28860
     aatggaccag caagagaaag ggattctcac atagaatgga acatagggga tgttgagaaa     28920
     ggctcttcgg ataccttgga atttagctgc acatgtgcgg atccttccga agtttttcct     28980
     ttggagatat actttacttc cgactttgtt ttcacaaatc tgtttgtgga gagagtggtg     29040
     agaaaggggg aggagattga cgaggtagag atcaagaaag tgtttgaagt tgataagttt     29100
     agtgtagttg atgagtaagg ttatggtttt gtttctggga ttcggttggt acatttcctg     29160
     aaaaaaattt accctctatg tctgagacta atgagattga gaatgtagaa agggaggacg     29220
     acatttctaa gaagaagaga accttccgaa ggtacacata taggggagtt ccggttgagg     29280
     agcttgagaa gatggcattt agcgaggttg caaagctttt tccatcgaga ctccgcagga     29340
     agattagaag aggcctttcg tcgcgcgagg tgcagctaat caaggactgt attgcatcaa     29400
     aggcagcttg ttcctcgaca cttgagaagc ctgagatggt gcgtacacag gcaaggtctg     29460
     caattatctg gccagctatg attggagccc tggtcggggt tcatgttgga aatggatacc     29520
     ttcctattga aatcaagcct gagatgattg gatatacttt atctgagttt gcacccacta     29580
     gggttattcc aaagcatggt aggccgggaa taggagcaag ctcatcctcc aagtttgttc     29640
     cgttgaaata aaccaacttc ttctctattt tacagacaat atccctaggc tttgaatata     29700
     tcgggccctt tagaaatccc catgagtaag aaagctacgg gtgacgctga tgaatccgac     29760
     ttttcttatg aatacacatc ctctgattct tttgaaaccg tttccgagga gatctctgaa     29820
     tacgagaagg agtactttgg agatatttct gaagaagctg gagctgagtc tgaagagaag     29880
     gcggcctggg aagatagcga tgacgaccct ggaatacgag aagatcacaa gaaaacagta     29940
     acatggcttg acggaaagca atgcaagaag caaatagaag ttcgcaagaa aaaagtgaga     30000
     tttgaatacg agaagaatct atttctctcc aagtgcaaaa tcaaactggc caaagctcat     30060
     ggagagtatt tggttgttgt ggatacctac aacaatatct acatactcaa ggatttcaag     30120
     atccataaga cactttggat tgagttgttt gggatctcgg attttatata tacaggggaa     30180
     aggatcttat tctcttcgca taagcaaagc aacctaaagg aagttacatt tgatggagac     30240
     gtccgaaaca taagcataaa gtctgtagaa ggcataaaga agatgattag tattggagat     30300
     ttcatatata caattggaaa gaaattaatt cttttgaata gttcctacga ggtggttgag     30360
     gtgatggaag gagagtttat ggacattgca gtatctgagg aggctgtata tgcaatggga     30420
     tgtggaggag atatcgttat gctgacacct gatttgcaga ttttaaggaa ggagagcttt     30480
     gaggacaagt ttgatttcca ctcgatatat ttttttgcaa atcaagtctt tattggaatg     30540
     ggaatgggag taaaggtgct tgacaaagat atgaagccag tcaaggagtt caaaaacctt     30600
     aaaaatgggg ttacagggct tacaggccat agagaatatg tgatatacgg atcggattat     30660
     accaattccc tgaagataat ccttccaggc ctgaaatgct ttaacaagtt tccattcaac     30720
     gccatcagta tcccttcgat taattctcta gaatctgatg gtaagaatat tgtggtctgt     30780
     tctggaagat ctgttagcat tcttcgaatg aaagtggagt gagggtttgt ctggaaaccc     30840
     tggcgttttg gtaatgcagc cttggtgttg gagatttgta aaaatccatg aaaaattttc     30900
     atccccagat gaagaacttg aggaggcaga agacgtccag cagaagaaaa cagagaaagg     30960
     cacactttgc ctgcaacatt ggagaaaaga taataagatc atcggcacgt ctttcccatg     31020
     agcttagaaa agaatatgga ttcaggacat ttcccttgaa aagcggagac actgttctcg     31080
     tgaagggagg taagtttgac gggaaggaag gagtaatcac aagcatcaac tacgaggatt     31140
     acaaggtgta tgttgaagga tgctttgtga caaagaatga cgggacaaat gcattggtac     31200
     ctatttaccc atccaggttg accatcacca agtttttcct tggagagggc agggatcagc     31260
     agctagagag gaagaagaag gcccgggaat acaacatgga gattcttaga aagaaacagg     31320
     aggaagttgc tactaattaa accgttttgg aaatccgggc ttcttaagct tacctccatc     31380
     ttaaggccaa atggccggct caacctataa aagcgatatt atttattcat ttatttatct     31440
     gccctggatt tcaaaaccat ggcccttgct ttcttaattt tgtttcttac atcctctggg     31500
     aagaagcaca agtcgtcctc cgagatggag catattcttt ccaggatttg catcttctgc     31560
     ttggaaagat cgaaggattc ctttaaaacc tcatcaatag ccccaggatc taccagttta     31620
     agcttgagta tggcatggat gatcgcataa acaagactcg aatttttatt caaaagctct     31680
     cttaagtacg atggctgatc cagtgccaac tttctcaaat agaagagaac ctccttcaga     31740
     ttgtccttgt ccatattgtc tagcacgctg attaagttat ctatttctgg aacttgattg     31800
     tccggctcct tggccttggc gggcatgtca ttttcggcat agtttatctt tacaggcctt     31860
     ccgttgaatg atatcttcaa gttttgcaat gctttctcca caatcaatgg agattcatac     31920
     tcacaaaatc caaaccctct tgactttcct gttgtcttgt cgtaaaccat ccggaagcta     31980
     acaacttttc ctacagctcc gagctcttct attatgcgtt cttcaggaac ttcgaagtct     32040
     atgtttccaa caaaaatact gcacccgctc ttcatgggct tcccaaaaat ggtttataaa     32100
     aacaccggaa gttgggcaaa aatagaaaat ggaggcctgt ccaacaaata aaatttaata     32160
     atcattgcga tatcttgagt ttagcctcct gaacttcttc taaatactca ttgtcgctga     32220
     tgggctttgc ctcccaagaa atcttcaaac gctcactgga agaaacaaac ggaataacgt     32280
     gaaagtgtac atgcgagacg gattggtggt ttccgttatt ttggagaata ttatacttct     32340
     caagcccaaa ctttttcaca agatgtccaa tgactccaag cacgtcggac aattcctcgg     32400
     ggcggcattg gtgaaagtac gggtggtgtg cctttggaat cacaaggaaa tgtccctttg     32460
     ataaaggata cctgtccatc agtacaaagg atgtgtcggt ctcataaatg atgttggcgt     32520
     ctttctggta aagtgtgcag aatatgcatt cttccatttg gggagtgttc tcaggaaccc     32580
     aaattatcat cattattttc aaagtaaaaa acacccagaa tgccaaaaag ggagtatatg     32640
     gagtattata aaaggactct gggaatggat ggaggagact ttgacgaatt ccataggttt     32700
     tctgaaaggg atcttgccta tgcatttaga atcacaaata caccgctggc cggcatgata     32760
     agaagcaaga tagagaagca tccgtttgtt cggaagataa agtatcttga agatgtctat     32820
     gagttccata aaaagaaaga aaaagacgat gagtataggg aattttcaaa gtttttagtt     32880
     aaccagacca gtatagggct aattcagagg caagagattg ttagtatgat tcctgtttcg     32940
     ctaatggagt tgaagaaaga ctcaaaggtc attgacatgt gtgcagcccc aggatcgaaa     33000
     acaaaacaaa ttcttgatat tgttaccaat ggacttgtga tagcaaatga ctccaacgga     33060
     aagagactga aagtgcttgt aagtgagact tctaagaagc ccaatggatc actaataatt     33120
     agtaagcatg atgccaccat atttccaaac gtatatgaag gcggaaagct agtcaggttt     33180
     gaccgtgtat tctgtgatgt ggtttgctct agtgatggaa ccataagaaa aagccccgga     33240
     attcttgagg gatggaagct ttctcggacc acaggactgt ttaacactca gtttaggatt     33300
     ctgaagagag gatgtaatct tgttgcagaa ggaggcctgg tatcttactc cacatgctct     33360
     ttgaacccga tagagaatga atgtgtagtt caaaagatcc ttcttgaagg ggagtttgaa     33420
     ctagttgact tcagaaacga cccaagactc gtaccttttc ctacctgtgg agatggaacg     33480
     agacttgttt tcagagaggg tctgaggaag tggggaaccg aagatctgat tttcaagaat     33540
     ccagattatc ggccttccga tgtggacgtg gggcttgaga aatgcattag actgtatcca     33600
     catgaccagg acacaggagg atttttcatt gcaattctaa ggaagaaaag gaatttcgga     33660
     gaagagataa atactaagga ggtatcaaat gcatcctttc atcatttcat gtttctttca     33720
     aagagcgaaa aggaagaaat attcaaaact tattcaatat acatagacgg agaactgtat     33780
     aagaaaagaa agagtagtag tactataagt actgtatcga gcatagcagc aaaggtgctt     33840
     agtggaaatc cggtacttaa tgttataagt gcaggctacc ggattcttga gaaatcggga     33900
     ttatccaatg cagactttta tcttaaaaac ctctttcatc gaggagaagg acttgaatgt     33960
     agcttgaaga tctctatgga ccagttcaaa cttcttctga acgagacgtt tgttagtaat     34020
     gaccttttag gttttgagca tataggactg gccatcgccc gaattgaagt gataggcatc     34080
     acgctctgtg gatacggaag ccacacctca tttactctct ttatgaacaa taatctgaga     34140
     agagcattaa aagatctagt tttgtgaagc gaaccagtgt acagcgtccc caaaccattt     34200
     attattcaag tgctttgcta ctaggacaaa ttttattttc ctcgggactt ggcctggctc     34260
     tttgaaagag cattgtgaac ttctcttatg gccagcttcc tcaactctcc cttgagcaag     34320
     atctcaaagg cacttacaat gtcatcggat cccacggtct gcttgccaac cttccttgct     34380
     agctctcctg caaggtctgc aactgtgtca acaaagtcaa aagaaatccc gcagagaact     34440
     tggattgagt tgcttgtcag catgatgttg ttgtccgggc tgacctctcg agaaatacgc     34500
     ttgactgccg acttgaacat tcctccaacg cacatggaag atgacttctt cttagacttc     34560
     tttttgtcgc ctccatccaa agatgttcct ggagccttac ctgtaacatg tcttgcggac     34620
     tttgccattg taagggggat gtttttcttt atttatcctt tttggcgggt aattgggtgt     34680
     tttggaggga agctgaccta aaagaaagga gacacagatt gtttttgttt atgtttaagg     34740
     ctatggaaag gtttcttttg aaactttgat gggtatatgt ttaaacatga ttttcatgac     34800
     ccatataaga tggaggagta tttccggata tccgatagaa caaggactct agagcatcaa     34860
     tatacagatc ttcttaccag aagactgagg tttgaaacct tgctggttga agaggactac     34920
     agcaaccttc ttgcagctca tgaggagttt atttcgaagg caaagacctc cgaagacaac     34980
     tataaggagc aaatagatgg cctaaaggct atggtcgacc agctcaacca tgatatggca     35040
     gaaagagaag acaacataag gagacttatg gaagaaaata ttaatttggt aagtatggtt     35100
     caaaggcttg aggaaaaaag caaggaagat caaggagtaa gaaaggggct aaacgagcta     35160
     gtagaagaca ggttgtggga agctcaagac tttaaaaaaa tggatgagat gcacagaatt     35220
     gttaagtccg tcgaggacga gctacgaagc aacctaagca aacttcagga agattgtatt     35280
     cgatacagag gggatacaga aagaatgagc tctgaaatag agaagctgaa gctaaagaat     35340
     gccgaacaca tagaaaagat gaaggagatc aaggaaagca ggtccgtcct tgaagataaa     35400
     atgaaaaaac tagaggaaga gaataacaga cttatgaggg agaacattca ttctgatgag     35460
     cttcgaagat ttataagtga gaaagatgag attatatctg cattaaaaga aaacatgagg     35520
     cagaagtcag aggtaattga aatgcagaag aaaatgattg cgagttctcc aaaagagagc     35580
     agggttgttt tgagcaatga cgtctacaat gtgtttgaag aggaccttaa ggctgaggag     35640
     agtgacggag agctagaact aggagatgga tatggcacta aggagcagct ttggaatgac     35700
     atctcctctc agcccaagcc tgtaggaaag agtgctaaaa gcttgggatc tggaagaaag     35760
     aagacggcgg cccctaaaag agaaaagaca agaaaagttc ctccaaaact tacagcaacc     35820
     atagatagaa gtaatgccag agaaaatgca gacaataaga tttctggcaa attactagac     35880
     atccaggaag ccccaaaggc ttcggagcca tccaaaaaac tatttactcc gggatttttg     35940
     cttaagcctg aaaactcctc atactttgca gacttaacat tcaacaactc aagtccaatt     36000
     ataaagaagg accagcctaa tcttcccaag aagaggtaga catatttatc tctatccact     36060
     tgaattgtga ttaaaggagc ctgtttttca gactcttttc ccttaagaaa tgggaaagtt     36120
     gttcagattt ttattaaaaa agtcgaggaa tgaaaatctt gaaaaatcca ctggcggtat     36180
     atactgttgc gagtattcca agcataaata aactgcagaa gattatagaa aggagattta     36240
     tgccttcctt ctctagagag actggctttc caacataatt tttgagagct atcaagatag     36300
     aaattaatgc acaaggaata tcatatagca tagtcttatt tctccacgaa aggaatgcca     36360
     tgaagaacat tatagtaaga gctgttggat aaagaaattg ataaatatca tcactttgta     36420
     agaaaaacga cgatttccat gtgcatctaa agagatacac caacgaaacc attaggctat     36480
     agatcctcgc atctcttttc gaggattctt cttcttgtat gtagagaaga tgggtagtta     36540
     aaatgatccc aaaagctatt tgaaatactg atattaagtt cttgaattca agaagtttgc     36600
     gaatatcagg gtttcttctg tatgaagcat gaagcctttc aactgcttca atccatgaga     36660
     agactattgc agtcataaga atgcaaaagc taaaatactt gctttccatt ttaaagatac     36720
     ccaacattat tgatttaaga atcaaaataa aactgaaaat gatatcatag tcgatatcaa     36780
     acttccagtg tatattaact ctgtcgccga ttctacagat gaagaaggaa gacttttccc     36840
     catcttcgtc aagaagagtc tcccttacct ttacatggaa ttcctttatg tttttctcgt     36900
     ttttttcatg gagctcttca atgttctctt ggatttggcg tgcccagtct agctctttca     36960
     tttcaatacc cttctagcta tttacaaata taattggaaa agcggaaatc gttgtaccca     37020
     aaaaggccca tgaacaagga agacgataga gacgtcacag gagtagggaa aagtgatccc     37080
     gcagagaaca gaagcaggca aaagagggcc agaggaggag aagggcgggg agaaaagagg     37140
     gatcagagcc ctgaggagat cttggagtta tcgagatctt tgaggaaaag aatgcagagg     37200
     atcttgaggg aagacaatgc aaacaatcag aaagggcttc cagcaattgg gaagatggaa     37260
     agcgttgagg agatatcaga catcttaatg aataaggggt tacaggaaag ccttttggat     37320
     gagggcatcc ttaacgaaat caaaggatgg ctggagcctc tccccgacaa atccatgccc     37380
     aacataaaag ttaaaaagag acttctggat gtactcaaga acatgaggat tcataaggaa     37440
     cacttggtca cgagtggagt ggggaagatt gtttatttct acaccataaa ccccaaggaa     37500
     gcaaaggaga taaaatcgat ggcaaaaaca ctcgtacaga agtggaccag tgagatcttc     37560
     aagccagaga atgacgattg agagatttcg agaaggcatc tcttttgttg tatacaatcc     37620
     agacttctgc ctttatgggt cttctcaaat aaacagaaac tcaaacagat tactaacgtc     37680
     attcttcatg cagaactctt caagatactt tataaattca tatctgttca tgttcatact     37740
     cttccggact gggaggccat gtatccatgc aaagtaatag tcaatgaggt tatctacttc     37800
     ttttcgtatc agcttctcat taaggcggac atcctcttct gaagacgttc tattagtatg     37860
     gtctactaga aatgctatgc ccttctctga cacaaggaat ttctttacta tttccttttc     37920
     gttgtatctt ttctgcctct ctactccttc tgttcttttc ctgttcatgc ttaagcatgg     37980
     ggatatcctt ttaaacaaaa tcatcgggaa tatgaagcga ccccatttag atctcaagcc     38040
     tgaattcgtc tacaaaagat ctcttttgaa gtttcttcac ccactcctgc actattatgg     38100
     caccaagtaa gcagtcgtga gcaacagaga cactgtcata ttctctacaa acgtgttctt     38160
     ggtcaagagg atggaacgcc atacatctgg agcaaacata aatgcttgga caatttgttc     38220
     tcattttcat gtcaatgaag atggcctggg tgcacctggc ccagatttct tcatcctttt     38280
     cttgatcaat ggttgtcact tttacctcct catttatttt ttcaatctta ttagcaaata     38340
     ttttcttgaa ggagacaagg acgtctgcat ttaccgttat cttccttact ccaaggagca     38400
     ccagattctt gagtatttct cccccaacat cgttgatcct tttctctcca gccatgatgt     38460
     acggaggtcc ctgcaccact accacgtgtg actcttctat ggacttctgt gtgtcctttc     38520
     caaaaagcct tatctggcgg tcgtaaagcc catacagctc cttttccatg aggccagaaa     38580
     aaatttctgc tcaaaacgtt taattttctt aagcaaccat ccccaatgtc tgagaagaag     38640
     aaacaagacg tttactttga tgtgtatgca aatgacgaga gccttgggag aattgtaatg     38700
     aagcttgccg atgatattgt tccaaagact gccgaaaact tcagggcact ttgcgagatg     38760
     cccgagggaa agggatacaa gaattccacc ttccacagaa taattcctgg gtttatgatt     38820
     caagggggag attatactgc acataatgga accggaggaa aaagcatcta cgagactggg     38880
     aagttccctg acgagaactt tgtcctgaag cattcaaagg cagggattct ttcaatggca     38940
     aactgtgggc ctcacacaaa tggatctcag ttctttataa ccttggagga gacgccatgg     39000
     cttaatggaa agcatgttgt gtttggcgag gtggttgaag gaatggacgt tgtgcacaaa     39060
     atagccaagt atggatccca aaccggccag gtcagaaaag gatataagat tgagataaga     39120
     gattgcggtg ttctcaagga aaattaaaca tcttattcaa gactttttac agttcaactt     39180
     ttcgtgtatg cagaaaccct agcaatggaa aagttctcta aatacaatga tcctctttct     39240
     ggaatcaatc cgtttgttga aatcaagaaa aaacctctct caatccttga ctatctcaaa     39300
     gcaatcctga agatacctct tgtccctctt cttttaggga cgagaataaa tgttgttcaa     39360
     cttcttgtca gaatcaagtc caacaaaatt gaacgcccta aggtcctagc agccaatgca     39420
     tcttctctcc ttgacatctt tgttctgaaa tatcttacgg gaatcaaaaa cttctattat     39480
     gtcaccgagt ctggttttgt agatgctagg accggccact tctgtgtgaa aaccattgaa     39540
     ccttgtgtat tatttcccga gggatgtcgg acaaacaacc gggctgtact ccaatttgcc     39600
     cgagacatta aggttgacca tgtctgtgga ataaagtata gcaaggaatg catagacatg     39660
     tacggaaatc ccatatggtt tattctcaga cttcttgcat caggtggaac agtcgacatc     39720
     aacttcagga aaagtaatga cttgagtgat atttgcaaac tctctggact tccacaggta     39780
     aagtgggcat ccaaagataa ggacaggttt gtagaggagt ttgttaagaa atcagaataa     39840
     agaatttatt tctttctcag aatggaacct tcattattgt cctcaataat atatccatga     39900
     tctttaatgc tttctcgtat ccaatcgcat tttttaagaa aggaagaata gggttccttt     39960
     tgtcttgcca ttcttctgat gttttctctg aagtctccaa gcaactgtgc aatcgagtcc     40020
     tccttggaag aggtctgggc ctccacttca ttcagcccga atacttccat gatttctttg     40080
     atgtaatcct taacaacaag aaccgtcgat gacgatatat ctttcatcct tgagtttgta     40140
     aagtttatca tttccacaat cttcttcatc actgtaggag tatcaatgtt atcaagaatt     40200
     gagttatgaa tgaccttctg aacattttta agctcgccca gaacctctct gtcggcatcc     40260
     tccagggtct tgaattccaa agtgtttttt ctcatacttt ctgccacaga cataaagttg     40320
     aatatctttt tctcgatgct ttctgcaaac ttcagatgtt ctctttcata gttcatatcc     40380
     ttgttccatt ggtggtggag aaacagaatc cttagctgcc ggggagaaat cacctccaaa     40440
     gcttctttaa ttgttgtaaa gttcttcaag gatttggaca tcttcagtcc atcaatgttc     40500
     aaatgccctg tatgaagaaa acatttcacc caaggttcct tcatgaagta ggcctggcac     40560
     tgtgctattt cgttctcatg gtgggggaag gcaagatcaa tccctccggc atgtatgtca     40620
     agatcttctc caagaatatc actagacatc acgctgcatt caatatgcca tcctggtctt     40680
     ccgtatcccc atttcgactc atacctcggc tcgttttcct ttgacttttt ccatagtaca     40740
     aagtcacatg gatttctttt gtctttgttt tcgtctcctt cggtgtttat cccgtcctta     40800
     ttcttgaaca gtggataacc gtgtttatcc tgatacttgt tcaggttgaa atatacactt     40860
     ccctcactct cataagcaaa tccatttacc tccagtttct cgataaattt tataatctta     40920
     tcaacataag acgtcacaaa tgtaacaaac gaagggggac gcacattcag ggctttcatg     40980
     tcttcaaaaa actcctctgt gtatttccta gtaacctcgt ccatggagac ccctgtttca     41040
     ttcgccctga ctattatctt gtcgtcgatg tctgttatgt tcatcacaaa attcacattg     41100
     tatctcagat aatcgcttag gacacgcctt atcacatcaa acatcacata ggttcttgca     41160
     tgtcctatat gtggagagtc gtacaccgtc ggcccacata tatacatctt cacctcattg     41220
     tctcttctgg gtataaagac ttcgctggtc ttactgatcg aattgtagag ctttaaagtc     41280
     ctatccatgg tcatcggggc ttggcctaat tttacatttc aaactttgaa gaatttaatt     41340
     gtctctattt ccagaatatt ttctatgaaa gattcctgct attcttccaa tcaacattcc     41400
     tcattttgtt ttccatttcc tctttcacca cacactgttt aatttcctca gccagcctct     41460
     ccttttcata agtacaaaat actcggaaac attttttttc cgggttgttc tttgtcatct     41520
     tatgggcttc ttcaaaccca cgctctttat tttgctcagg acttagcctc tataaacaat     41580
     ctcgtcttta ctcacaagat ctataatatc tcctggcctt gtaacatcag ctgtgcttgc     41640
     cttgggattc agaacaactc cgtttctaac caaaaggtct ccttcaaatc ccatctctcc     41700
     aagccgttcg aaaattcctt caaccgaaag ctccttagaa acgctgagtt caactacttt     41760
     agcgtagtca acatttattt tcagcctaat tcctgcttct ctcgaagtct gcccctgcct     41820
     atgaatcata atccaatggc tttcgtcaaa tcctatctct tctagcgtta gatgccttga     41880
     tataggaacc gacttgtact tcatctttat tggagaatct tccctatggt aaaccttata     41940
     tatgtcctct aatgtatctg tactctttag atggaatatt ctctccaggc cctggtcaac     42000
     aaccgttact ctgcacagtc cttttcctct gtaggagtca tccttaagcc tttttctatc     42060
     atcttcatca ttcgggtttt cttctacagc tcgctttctt cctttcctag aagattcagc     42120
     tcttccagat ccttttcttc tctcattggg caatttcctg ccttctctaa caatctccac     42180
     tatgcttacc tcatcgctat catgatccac tctctcggca agaactattt cactagaaga     42240
     atcgtctccc atcgactcga ggatgactga agatatgaaa aaaatcataa gcgatgtgga     42300
     agtaagctcg aaccagcctc aggcatggtg catgtttgac tcaaacgaag acacatgttg     42360
     gttttcaggc catggaggcc aacaagacat aaacatttac cttaagcaag cagtatatgt     42420
     gcaaagagtt cgaatactct ttcaaagagg attccattgc acaaagggaa aagggtgtat     42480
     gattctgaat aactcccgtg attataaaga aatagaattt caagacggag gaagtacagg     42540
     aagtctggat attaaccaaa ctggggacca tatcaagata gttctggaga gaggtgcaga     42600
     catgtacggt agatattgta tctataaact tagctttgac ttgtagcatt gggattatct     42660
     tgggcctggg tatttacatg agaaacatct tgccctttag aatgagaata gtggttaaga     42720
     atcttccaga atccacaact aaggaagaaa tcgagaagga gttttccaaa catggaaaga     42780
     taacggatgt gtttatggtt aacaatgaac agggcaagtt ccggagaata tgttttatag     42840
     ggtacataga ggaaaaagat ggaatggagg caataaagta cagagacgga tccatgttta     42900
     agaaccacaa gataagatgt gagactacaa aagaagattc ctatgaaaca agcgaatctg     42960
     aggaaagaat gattagatat tctaggaaaa tattcattag aaacattcct gcagatgcgg     43020
     acgaacggtt tatcagtgat gtatttaaag agtatggaga ggttgaggag gttggattac     43080
     tgcctcgcca tgagggaaag ggagcatatg ttaagtttag taaaggagag tgtgcattgg     43140
     aggcatacag aaaagtaaag cttatcggag gagtaaagcc aagaatgcgc ccatggaaag     43200
     atagaggcga aaaacgtgag cacgagcatt acaatacatt gttctttaac ttcgagtcgg     43260
     ttgtgaagaa gatatgcgaa agcgaaagga ttggaatcaa ggatcttgtc gatgttaacg     43320
     ataaagatct tggggctcgg atggctcgtg ccgaaacaca tctggtccag gaaaccaagg     43380
     agtttcttga gaacaatggg atctatctcg atcatcttac cggctctgtc gacaggaaaa     43440
     agctgatagt ccggaatatg gaacttatga agtgcttgga ccttgtagac aatggttgca     43500
     agattagtat tgcaccttca aagtgccttg cacttcttaa gtttgattct gaggaagatg     43560
     ccaaaaggtg ttacaaaaag ctgagtctga gaaggatgag ggagcatgtt atctattgcg     43620
     agtatgcacc catatgcaat gctccgagta aaagagaaga gccacctaaa gaacacacag     43680
     aaaagaagag tagaaagggc acaaacaagc ttcttatcag aaatgttccg ttccaagcct     43740
     ccaaagaaga tgttaggaag atatttgatt cattccatgt ggtaaatgtc cgtattcctg     43800
     tgaagagaga agggactagc cgaggatttt gttttgtaac attccagtcg cccgaagaag     43860
     tttctgcagc cattgagtat tttggaagca gcacacattt gtacgggagg cgtcttgttc     43920
     tcgaaaaggc aaaatcctag ttttgataga aaattgacta tggatccaat aaaatttaaa     43980
     cccttaatga aaagtgtaat gaaaacagca aaacaaaaaa tactgtctct gatatccagt     44040
     agctttctcc tattcacaat gacttcatta gacctacttt cctttggaac aaagcttcta     44100
     agcacagaga acagccacaa caagaatatt ggaaatgtaa gtgccatgat gttcctctac     44160
     tcaacaatag cttcgcagtt tgtgttcggt ctgtttagta aactgggtgg aatcgcagca     44220
     ggagccatat ttgaggcaca aaaggacact cgaagaattc acaaggtatg tttcaagatg     44280
     tcatccacct ttggagaaga aatttccacc acctatgcat gcatctttct tagcaccatt     44340
     ctgtttgctt tcttctccta tgttctcaag acactcaaga ttggaagcaa tcttaaatac     44400
     atccctatac cggctctgta cggggttatg gtatccatag gggcaatgtc catcgaatgt     44460
     ggatttgagg aagtgtattc gattacatgg aagtatgttc atgtctgcct cgccgtgacc     44520
     attgtccttg cacttcttgc agtggtcttg gatattttgt tccctgaata tttcctgatg     44580
     attcccatgt tctcctttag catctttgca gtgttttatc tagtcttttt agctgcagga     44640
     aaggatatcg aatggatgaa atctgtgggt cttattccaa aagccggagg aattgatctc     44700
     aacccccttg aaactctgaa gcatctcaag atagaaaata taaaaataga ggcagttaag     44760
     gccaacttga tgaacatcct tggattatct ttattcaatt tagttcacat agctgtgaat     44820
     gtaccgagtt ttgcagagac ttttggtata aatgcagact tgaataagga gctaggagtc     44880
     cagtcgatcg ggaacattgt atctgcattc tttggatatc caacctattt tatatgctct     44940
     acatccatct acttcaacaa atcaggagga agatccagaa tccactcttt tgtgggcgca     45000
     attgccatgt cctcccttct ggttatcgga ggacccataa gagaaagaat tcctactatt     45060
     ctctcaggaa cgatccctat gttcatagga tttggcttcc tgtattcata tctatggact     45120
     cctatactca aactgtcctg ggtggatcta ctgacgctag taatgtccag cgttgtgtca     45180
     tggttcttaa caccaatatt cggactcgtg tttggaatgc tttttaactc cttctttgtc     45240
     ctgtggtctc atctattcac aacaaaggtc ttccattcga agctgggaga gaccataagg     45300
     atatcaagag aaacaacaga agaaatgtac agagtagtgg accttggccc tctaacttct     45360
     tttggaaatc taagtgaatc tgtcaaggca atgaaagtcc tttgcaagga aaatgtcctt     45420
     ttcgacctca ggtcttgtat gtatttcgga gccaatgcaa atatggctct tgaagaggtt     45480
     gctggagcaa tagaagaaaa tggaaaccaa gtattgatga tcggtagtcc acagaatctt     45540
     tatacccatc tgttctctaa atacatggcc gatttgcctg aatcggaact tagcaggtaa     45600
     attagcaata ctaaatattt cttgaatatg cggaaatccc tctttcttaa acttgcataa     45660
     atttcttatg ctgatactcc taccaatgaa aagttatcaa ttagctttct cattgctgtc     45720
     ttttccatat taggaagatc cacaaatata aataatgatt tataacaacc ctgtatcaaa     45780
     aatgatgatg aaagagggaa aaaatatcac aaatcttctt ttaggctttg attgcatttt     45840
     tgcattctta tcaattattg gatgtacact tggaatactt gggttatttg tggataggtt     45900
     aaaaacaata tctcaacatg gattaatagg aatttttgct ttggcatccc tgggacttct     45960
     gtggagcttt gccaattctt tgcacaagaa gatcgaaagc cctttctttg aaaagaaagg     46020
     aggattcctc aatccggcca ttttattgtc tcttatcgag atggttgtga tgctgctttg     46080
     tatcaaggct gtgctcttct atccctccag ctgttcttta acgtgtgagg acagtaaagt     46140
     ttgcaaattt gggtttcttg gagcaatctt tatgccttat gtcttcaatg agtgcataag     46200
     gcaactgcta ggctctggca aaagccgaaa gcaagataca gtgatcttgg ggattctaat     46260
     tctgggatgc ttggtaatgg caggactaat tggccttgac attaagatga agaaaaacta     46320
     cacttcgata ggaatcttta gtattggcgt gctgtcatta cttgttcgcc ttgctttcat     46380
     tggagaaaat gaaaacactg aatcttccga tgactctgaa gatgaggggc tcaaagaaga     46440
     tcccaaatac atcggaatgg ttactacact tatgctggta acactgatat ttgccaggtc     46500
     tcatcgtatt ctatttagca aggatggaac caccctattt gattccctca aatctcttaa     46560
     tctcctagga ttgaaggccg gaagccaggc cagttgaact tgatgggagg aggagagaca     46620
     ttaatggtaa aaatgaggat ggaagaaagg ggtccttata attaaaaatt taattgaatg     46680
     tctcttcttt tctcccgaat tcacaagttt tgctggagtt ccatttcacc tttctctggc     46740
     ttactgagaa tttctatatc cataacaaaa tctcccctgg ccatcaccag ccccaagact     46800
     ctacgtctag gctctttgct acctcttgca ttccggaatt cctcgctgtc atcaagaact     46860
     acatttacat cctcgtcaac agatagcatg gttccctcca tccatctccc atccttcatt     46920
     ttaaccttta ctctatagtt cacgtacttt cccaaactca gacccatggg caagagcctt     46980
     ggcggagaga aaataggaag aaatcacatt ttattcaaag gtgtagctcc aaggattttt     47040
     agtccgttat gaagaacgat ccttgcagaa gacagaacaa ggagtcgagc tctggcaagt     47100
     tccttctcca cacctagaac ctttaggcta ttgattgcga cattgacgca gctagcaaga     47160
     tcttgaagat atgtgacgat tctcgaaggc tcgtagtcgt ccagacactt ttcaacagca     47220
     tgctcaaacc acaggagctt gtagacaaga ttgaaaacct ctggaacatg aataaggcta     47280
     aagtcgatcg tgttgatatc gctgtagtca acatcgctgt tcctggattc gatgctcttc     47340
     agtctgcaat gagcatactg caagtacggc cctgttccag aggtgtttct tgccctcttt     47400
     tcaatgtcaa actcatatcc cttaactctt ctagcagtaa aatccattac tagaagtgtt     47460
     gatatggcaa ggacttcggc agtctggtca atctcgtcca ttgtaaacga gttcttggta     47520
     ctatccgaca tcatgacctt cttcatgaca cttgtagatt cttggattat gtcctcgagg     47580
     aattgggcct ttccggctct tgtagacatc ccagcaacca atccgtagct tacatgcaag     47640
     aatttgcttt cgtcgtgccc aagaatccca agaatcttga agagatcttc aaagtgtttg     47700
     ttctgctcgg tcgacacaac gtagatgatc ttttcaggag aatatttctc aagtctttca     47760
     attgcggcag caatatctct tgttatgtag agtgtcgttc catcgttctt catcacaagt     47820
     acctttctgt tttttccaag atcaaatacc ttggacccgt cctcatctgt cttgacttcc     47880
     ttatacgcct caactatctc tttccccttt ttgttgtaca ggctttctcc ggaatagaca     47940
     tcgaatctca cattcaatct ttcatagaga ctcttgtatt tttcaacact cagctcccgg     48000
     aatcttttcc agagattcat gcaccattcg tcgttttcct cctccatctt cctgaagatc     48060
     tctctggcct ccagatcaac ttctgggttt tcctttgcat cggcgcttat cttcacatag     48120
     acattgaaca gatgcttgag agggtctttc tccagctcct cttcacttcc atacttactg     48180
     tatccaagga gtacaaagcc aaattgtttt ccccaatctc caaagtagtt catactgact     48240
     gtctcgtatc cagatgcctt cagtaagttt acgataaact ggcctaatat tgttgttctc     48300
     agatgtccta tgtggaaaat ctttgcaatg ttggggctac tgtattccac caccattcgt     48360
     ttgccttttc caatgctatt gtttccaaat gtctccttgt tactttggat ataaccaaga     48420
     acatccttga gtattgcctt cttgttaatg tcaaagcaca ccgaaggtcc tcttatggcc     48480
     aggttttgaa tcagctcgat gcttgccttt tcaagcgctt catgaagctc cttagcatct     48540
     tcctgtggag aggacgatat tttaatgagg aaaagagtaa catttggctt ctttggctgg     48600
     caggactttt ccatacatct ctcgatttcc tctggactga actttgagac attggatact     48660
     tgttccacaa cttttttaaa aagctcgtta aacattttga agggtatatt ccttctgctg     48720
     gttttgcagg gatgaaaagg ctctcaaagc aaaggaaaga aaaaagcatt agaaaaaaaa     48780
     gccgaatcta catccggcaa cctctcaagt tatacatgtc gtccttacgc aggggccatg     48840
     ctaatcttct ctgtgttgtt ccaaatcaat ggcggtagaa aactacaacc cttccctgcg     48900
     agattttttt tatccattca gtttcctccc gtattaatta agcggccatg tgtttggtgg     48960
     atttttgttc ggaggccgaa agcaaaaaaa gaattggtat ggaaaatagg agacgtggca     49020
     aatttcattg gtaactaggt cattaaaagt ttcggcctgt cacatcacaa agggagaaag     49080
     atgaaacagg aagcaggcga ttttagatta tgggttgaga atgttgtttc aagaacagta     49140
     tccaaagcag gtataaacga ggtgtctctt ccagactctg aatcaaagat ctatgtgttc     49200
     cgatggacgg aagggtttta ttcaatgtat cggaccttgc agatatattc aggtgttttg     49260
     gaacttttgt gagttcttct cagatacatg agtatatgga gtctgccgga tatatagaaa     49320
     ggttggagca gctcaaagat ttctttggaa aagactgtct ggaggtggta tgcagcagtg     49380
     tattgaacag caagcttctt gaacgtatag agtcttctgc agatggcgga aaaggatccg     49440
     ggcatctgga tgatacaagg atagaattca ccgggtccaa gttctctttt ggagaataca     49500
     agtttgagag ccagaaagaa gatcaagatc ttgacagatt ccgtaatgta aacgaactat     49560
     acccttttaa ttgtcaatgg accgataaca tcatggatgg aatacttaag aacatatata     49620
     caagcgacgg aaagaaggct gaagacggct gcatgaagaa agggtccgac gttgtaagag     49680
     cagggagtag aggaagacat atgaaagtct cgggaagcct aaaggatcgc ccgtttgtgt     49740
     gtacatacaa cgattgtaag agagccttca agagatatga gcatttgaag cgccataacc     49800
     tgatgcatac tggagaaaga cctcataaat gcagattccc cgggtgctcc aaagcctttt     49860
     ccagatcaga caacctgtcc cagcactata aagttcatac cacaacaagt gagatacatg     49920
     ccaagagcta tgaatcctat agatacttga ataaagagtt taactagaga agattatttt     49980
     tccagcttgt ctttagaacc aaaagctgaa gtcgatgagt tgacatggtt cgcctgcatt     50040
     cggagcctat ttatttcatc tttcatggct gattccttct ttaacttcat ggatgtatct     50100
     tctgcttctt cttggatgcc gggctcctcc tctactttta cacaaccatc ttcggtgata     50160
     tacaccccat tctttggatc ggttttaatg cttaatatct tactgcatcc agtgcatttt     50220
     atgtggaagc gatggctttc tacccccaag tagtcctttc ccaatgctat ttcccttgtg     50280
     gcattgtgtc ttttattttt gtatatgtag gcaccacacg atagacactt gatcgtgaat     50340
     ggcgttgcca atcttgtggg cagtcctttt ggcttggagc ttttcttctt gtttagagca     50400
     ctcttcatta aggctatcca gaggcgagat ttatctttcc actctctttc agagaaggaa     50460
     gcaatggcaa taagggccag ggttcgtagc tcagaggtag agcaattgat tgcagatcaa     50520
     tcggtcacag gttcgattcc tgtcgggccc tttccttttc tcaaaactct ttttttgctc     50580
     ttatccatat ggatgcagta gagattcttc aaagattgaa ggaagttgcc gaacattcca     50640
     aagagctgga cttcaagctc caggaaacac acaagtctct ggagtcctgc gcagatgcca     50700
     ccatcgaaat ggaggcaata tccgccaaga tttcaaaagt ctttgctctg tacagagacc     50760
     ttgtcgattt gttgaataaa tacagcactt cttaaacagc cttacttaat gtcttttatt     50820
     aaaagcaggc atattcttct aaaaatcgac ggatgtcctg tgtagcagac accattgtac     50880
     caaactcctt cggagtttga aataaagttg atggttcctg caggaaagta cagcgatcca     50940
     ataagatacg acagaaatat aaagtagaag ggcgattttt cctcgttgtc aatggtctcc     51000
     acaaggcgaa ttatatattt actgctcact atcgtcttaa tctttgttcc gttgactatc     51060
     attacaaccc gatcccgcat gggatttata agcctcagtg tgaagtagaa tccctcaaag     51120
     tcttctctct ttatttttaa ttcctctctc atttccttgg aggcattgag atacgtcctt     51180
     gtttggaact catcgtttgg agtctcgatc ttgctattaa tttccttggg cgacggaaac     51240
     atcatcatgc acataataat caccatcata atccctgcaa tggccagcag cttaggagtt     51300
     agcgaattac tcccaaatct taagcttttt attatcttca ttatacgttt tttaaatcag     51360
     ggtacttctt agggctttgt tacgtcctgt gcataaagga gatattcagt ctccatggtt     51420
     cccgatccaa ggagagggaa aaccagtaat atccttccat tattcataca agccttggac     51480
     cattttggat agtggcccgt cccctggctc tcttccttca aatatatctc taacacatct     51540
     caagcccatc tcgctcttcc attcctctcc ctcaaacacc tccttcaatt tctttaccat     51600
     cccaacaagt tcaaagtact cagagctctc tagcctatgc ttcaacacta tctcttcaag     51660
     aacaaaccca tctatcttct cttttacact gtgctttatg gcattgtacg acaagcactc     51720
     tttataatct tcaagacacc tttcaacatc aaccactaga ttccggaata ccatccctgg     51780
     atcatgaaaa aacttcctga ttggccggag cctttcagct gtgtcattca ttgccaacga     51840
     cataatcagc ttgagattct cactattgaa atcagaaatc ctctctagag atcccgttac     51900
     agcctcgtga agcatatctt gaggatttcc tccttcctcc ttcacaacca tagtcttatt     51960
     ctctatgctt aatctgctgt caaagaccac ctcactctct tgctctagca aaaatgtctt     52020
     caacctttca aactcactgt acacccagca aagaactctt acctcttgcc tgtttatgta     52080
     ccttaggctt tccaaaaaca ctctgttgta gtcaacaata atcttaatgg catcttccat     52140
     cccaaacact ggatccaacg tccggaacct gtagatatac agaagacact ctcttgaaag     52200
     ctctttgtat cctccaaacc attttacatg tcttgcctcg tgtatcttca ccagtctttc     52260
     ccgaacatat ttcttctgtt cttggcagag aacacttcct agagagggaa attcaagaac     52320
     aatgttgtag ctgtgataaa cctcgtatct aaacttcata acctgggttc caagatgcag     52380
     tgctagattt ctcttctgtt tactactact tccagatatc tcttctatct tctcttttat     52440
     taggtttccg gtcctaacca ctaagtctct aaattcccca ttgccttcgc cgtctctttt     52500
     gttcttcttg cttagctcta gatatatgtc aagaatcccc ctgctttcac gaagcttcaa     52560
     aagaatgaag tctagaaacc attcaggttt atccagtctg tttgtatccc tgttgctcat     52620
     aaagtggtac tcaaagccct tcgatatcct ttcgtaaaga aagtctatca ttgtatcttc     52680
     acaaaaatat tcctcatatt ttctcagaaa cttcatattg aacacaaact catgcatctt     52740
     ctgtttgtcc tgcaacttct tttccatctg tgacaaaata tattccctta acttcccctt     52800
     ctcttctgca tagaacctct ccagacgtct cccaaggttt ctaaatacat tcctcttaat     52860
     caatccctta atctttgtaa actcctcaaa agctgcgaat gatgtcgaag gatgaattct     52920
     agaggcctct tcaaatattt ctctgtacag agactcaaat tcccccttta tacttctcag     52980
     gacatccttc ctgtatttgg aaaccttatc tttcagctcc ataaatcctt cctttttctc     53040
     aagaagagct gaaaccattc catttatttc cttttccaat gcttctatcg ccgatctttc     53100
     tttctgtgct tgctcgagaa gttgattcct gtactcgatc ctgtcgtttt ccttttgttt     53160
     aaattgttcc agtcggtatt ccagatgatc cttttttttt aaaagaacat ccatcgatgg     53220
     gcctgcttga agaatttaca aaacccatgt ccatcaccaa tatcccaagg tatcttcatt     53280
     ccaatctctc tatcaagatc gaatcggata tctcatccct gcacgggatt tgtgtttgaa     53340
     aaaatttacc cctatgaagt cagagacctc caggccaacg atgttctcaa aggtaaacat     53400
     gacaaaccct ataacaaagg aatacagaat ccatggaagt gcaatgccta ctgaggactg     53460
     cccaagaccc caggtatttg tggcaaccat ctttacgaag aaccatgtgt ttgccaaggc     53520
     aaagttcttc aagattcttg agaagaagta caagatcaaa gcatccagag ggttgattat     53580
     caactgcgaa cagattcccg agccttcgtt caaggaggtc cagaactacg gggtacgatt     53640
     tgtctaccgc agcagaagtg gaatccacaa cggatataag gaatgcagag caataagcag     53700
     gtgtggggct gtcgactatg tgttaaggga gctggcgggc agacacaagc taaagagatc     53760
     tgcagtggac ataataggtg tggaagttgt tcctgtggaa cagctgaaga gggcaaaaac     53820
     catggagttt gccgatgaga atgtcgagtt tcctgtcttt accaagattc tcaacaccaa     53880
     gagtttactg attcctgcag aatacaatcc ctctgaataa tcccaggtga tcactattaa     53940
     agcttatttt attcttttag acttcctgtt ccagcttgga gatttgttct aatgtatgag     54000
     ggccttaccc taagtcatga ctacagccga ggcttgtaac cttgagagaa tgcaacttat     54060
     attcaacgag atccagcagt gcgatacaaa gagatattcg gaaacattga aggagatggt     54120
     ggagatgtta actacacagg agctttttga ggaattctgc aaggtcataa acattatcct     54180
     tgtatgcaaa aggacgagca tcccgtctag aatatccaat ttcctccgaa gaacatttga     54240
     agatgtatcg gatgttccaa agggtgccga gtttgttctc caggtgttct gctacctttc     54300
     caagcttgca gagtcgaaga tcgcaaaggt gagaaaaaac tccctctctc ttctcagatt     54360
     gttaacagag acagtgggac cagaggctat tggaaatggg tttctggaaa ggatttcaga     54420
     gaggttgttt gataaagaaa aaggagtaag gaaagaagca ctaaaagttc tttccagtta     54480
     ccagggaatg gaattgaatc caaaggtgag gattgtaaac ttgttcaagg acatagtcag     54540
     gcacgatcca agcgacgaag taagagctct tgctttgagc ctgatctcta tagatcaatc     54600
     gacctatgga tgcataaccg aaagatgtat ggatgcaaat gagtcaataa gaaagatgtt     54660
     ctacgagaat tgccttctag aaattgatct gaagggtctt tctcaggatc gaaggatcct     54720
     tttgatggaa aaggctatac tcgaaaggga gtttgatgca aagggactgc tgattgatgc     54780
     catacttgca gcatacaagc tcccttctga actcaaggct atgaatgaat ccttctatag     54840
     cagatcttct cagaggtatc tggagacttt gcttaggggg atttttgaaa gagtcgggtg     54900
     tgagaaagag tttggatatc tcctttcgga gccttcggaa gaaaatacct ttctgtcaag     54960
     ggttgagctc ctatacatag aagaattctt tggaagagat gacctgcagc tcccagacct     55020
     cgagagtttt gttactgtga tgtatcagtc gtgcctttcg gttgttgagt ctcgagacgc     55080
     cctggaaaga gaagtaaggg ttgaagcaat gaagaatctg ttcaagattg cccgattcta     55140
     cgatttcttt aatgagacat ccagaaagta cattcttagc gctgtttata agctccttgg     55200
     gaagaattcc gtagaagaag ttgtggagga ggcaatgcag atagcaagtc ttgtctgtga     55260
     cgacgatctg aatagtttca taggaagtat cataaagaaa aatgcaaagg cttctccaag     55320
     ggtatgtctg atggtatgca agcaggtcat gaaacacatt catccctttg gacaacttca     55380
     cgaagcaata atagaagaga ttgtcttgcc taacttaggc ttgcaagaaa cagtcgcaga     55440
     gatactggag gtggggtttt attatgtctt aaacaagact caccatgcaa tcactcagag     55500
     tcttattcac aacatagaag cagataacaa ggtgcttaag atgtgtgtgg atcttgcact     55560
     ctctcccaat ggtgaagaac tgctaagcca tgtcttaaga tacatagaga agaagttgga     55620
     ggatggggaa agtgaggaca tcataattcc aggctctaag atagtattat ccaaaaccaa     55680
     agctccaaaa gagctccgag aaaagttcat tgcgtttgca cttgagagat attaccatac     55740
     acaggatgac catctcaagc agtattgcag catactgttt ttcgaactgt tttcggaaga     55800
     cagttccctt cttacttccg tgttctgtgg tctcctcgag gccctgggat cctcgtgcaa     55860
     ggtatttatc gaccaatctc tctattggat aggaaacagt aggtatccta acggatcaca     55920
     gctcctcttc tacaatatct gtgtttatct tgcaggtgga tatggaaagg atcaaaccaa     55980
     aaagaccctt ctcaaggttc tggagagaat agaggtctta agatgctggg acccaagaat     56040
     taccaagaag atcctgttct gctgtcctct aatggcaaaa aagctgggag gcaggttcaa     56100
     tgtaagcgaa gtaacaggaa ggctgagaga aatagacgat ggtgtgccta tttccccaga     56160
     ggacttgtgc gacgtaagga aggatctgga gaattgaatg cactttgcct tacgattcct     56220
     gggattctct caagcttttc ttcagaaatt ccaagagctt ctttgacaat gtcttctcct     56280
     tgttcttggc cagattgtaa aaaatgaaca ggcagtaata tctgtcgttt cttacgatgg     56340
     accggatcag gcagctagtg tcaaagatgt gaaaatagtc tagggagatc aagaacattt     56400
     ttgaaagaag cttctttgag agactgaatc ttactatgct tccaagcaat tggaagaact     56460
     catccattaa tcttctcttg gtttcattaa atcttgatat tccatgcaaa tccacaaggt     56520
     ggagaataaa atttgatttg gaaatcctat tctcatagaa catccctgtg ctgtctatga     56580
     tcttcttaag aaaaacagaa acagccataa gctctccctc agcagggacg atggttagct     56640
     catcccatgc aatcgctgca agtacattta cattgtcttc atccacgtct cttgtgtcta     56700
     ccctctcaaa aatgttctct ggaatcgaac atgtgcattc tacattccat gttttctgtg     56760
     attcattcaa atgtctgctg tgttctatgg ccttgtctag tagagaatac tgtacaaata     56820
     actcaccaag cacctcgtat ttcatacacc tgaccctata gtcttcgtta tctaaatata     56880
     tcagtccgtc aaatatcctc ctgaggattg atcttcttag aaagttcttt tccacaacaa     56940
     ctttcaagaa atacaaatac agactcaagt cctttgcatc tgaacaccta ctgacaaatt     57000
     caattgactg gagaataaag tcctccagct ttggcctgaa ctcgattcct attaggttga     57060
     tcagaatcct agggcttgtt ttcagcttgt tgaatgcata ttcaagaagt tcgtcgtaat     57120
     tctcagacac cacttttcgg acattaagtc tcttccagac atcactccca agaacctgct     57180
     ttggagaatc acataactct agatactttc caatcacctc gacatgaaga gggacatcag     57240
     tagcatttcg aagaaacatt tcgatttttc tcaggtcgtt tgtgtcgagc actgttcttg     57300
     tagtctcttt atttaccaca catagctccg gcactctaca gacaacccca catgtttcct     57360
     ggattcggag tattatatcc gaaacatcct ctcctttttt gtacatctgg ataagctttt     57420
     caaatatctc ttcattgttc ctgtactttt ctctatctag gagttttctg atcagttcca     57480
     gagaaaatat ctcctcaata ccctcgttaa tggcatcata gtcgctgtcc tccagcggat     57540
     atccaagaag aaggagctcg gagataaaaa acactcttct agatgtctta aacttctgtg     57600
     cacatatttt atagatctct tcaaacatag gacctcggcg aaagtagaag aattcatgta     57660
     ttcgggcctc tgcaacgtca ttcagccgag ctgcagattc cagtacatgc tttattgaat     57720
     cgattaccat cctttctgtt cttctgttgg ttttctggtc cttcaagagg ctgaagtaaa     57780
     aggataggag gcccggaaca aatcttgtga tgagctccga gggaattctg ttaagcaggt     57840
     agtgatggat ggagggatct tccttaaata catccatggt cttcctcaag aaatacgcca     57900
     gaatctcaga ggagtccgcc aggactccca tcttcaatat cttcttgatt tgttcctcca     57960
     aactcccttc ctccttgatt acctcatata ttctgctgct cattcaaagg gatccagaat     58020
     caagctcaag acaagcccct ccatttctcg gcaataccga gatacggctg aagacgctca     58080
     ggcgattcta aaacatctcc caacctcggg aaatcctcta gtttgacaga atccaaagag     58140
     gatggatcaa tggggacaga gatgatctct gtggaaggat gtaccgaaaa tggcatcttt     58200
     atcagatgct tactcttctg tgttacctct ttatcgattc ttatgtacat cttctcaaat     58260
     aactccgact ccttaaacgt ctcgtctcca agaaaaaaag aatattctcg caagatctct     58320
     tcatattcct tagagtatac tttcttctta accactgtgt catagtatct tactatctcc     58380
     cctctctcaa tatcgttgag ctctagtgct gcctcatcaa acacccaaca atgcattcca     58440
     cgtcttcccg aaaagacaaa gcctacgttc ttgaagccaa actcttttct caaagaataa     58500
     tcaagaatcc taacagccac ctttatcagc accagacact tgttgcatac gagcttttca     58560
     gtacagcact ccctagggta gtccgtcaga tctacatcga aaactagttc cttcccagca     58620
     acttttggaa cattatgctt tacaggccga tccttataga tggctccaac atcgattctc     58680
     tcagggacaa ttcctagtag cttcttccta aattcttcag cagtcttgaa tgtaagaaag     58740
     cgaatatatc ctccagaccc tagcccaaaa gaaatctccc ggttctcgtc gatccggaga     58800
     cacttgaaaa tcaggtccaa gggaaacaaa gttctataat atgtcttcat cagccgttcg     58860
     tcaagcccca ttggcaagga tcaaaacaat aattttattt ctatgatgta catgcttgct     58920
     caaacggttg aacgctttcc ttccaaaaga aattaaatac ttggacgccg atcacagtga     58980
     aggaaaacgc caagaaccgt tgtacgtcta tctctctgca cagatacaag tcggtgacaa     59040
     ttgccgaaaa gcctgtgatc acgttgagaa gcgtggactt ctccactttg tccagaaaca     59100
     aagaaatctc ggatagcaga tatgttgtta ctatctccat aagaagcaca aggtatatgc     59160
     ctggagacga gactatcttg acataggtag atttctgcga aagcgcctct tctgtcatat     59220
     agaacaagga aaacagggtg agaaagaacc catatgttgt catatagcac cagaacttct     59280
     taaagtccac aagagtaggc tttatcttgg cttcaaacac tgctaggctg acggctccaa     59340
     acaaccctga taaagatcca atgaacatgt ggagtggaat ggagagagat tctcccgaag     59400
     atatctctat aagaaaccct cctagaacca ttaggagccc aatgtattgg gtgtatgagt     59460
     actttgttcc attccagatt atggctatga gtgcagtaaa aagatattgg agatcagaag     59520
     agatcacata tgatgtcgat gatgcttttg aatagtacga aagcaccccc agataaccac     59580
     caagaaaact taaacttgca acaataaatg tatacttcat cttgaaatca aatgattgca     59640
     tgtttagata tgaaatagcc atttttatga agcttgagat caacatcagc aaccccccga     59700
     ctttgtagtt cacaagtatc acaactttca ggacagagag catcacggct gcaactatgc     59760
     tcattactac aaatatctct agttttttct tgctccacat ctgcccctag ggctttatta     59820
     tttagattta aacatatcag tagattagtt tcaaagagtg atgaagtagt gtctattatg     59880
     ataagtcttg agggaagaga gagccaaagc attggaagaa gataaacccg ggatggttgg     59940
     agattgtaag ttatttcggc tggagggctt ccccctctat ttggatgttc tacagtgcaa     60000
     agatcgagga caaaattaaa atttccctaa acagcaatgt ggagaaaaaa agagaagtct     60060
     ttgaggagct taagaaaaag tatgttggaa gaacactaga aaacactagc atgtgtgttc     60120
     ttatagaaag ggttatagat gtctatgaat ataaagtata tgacgaattc ctagttgccg     60180
     aggttgagtt tgaggcactt ttctttagat ttttcaagga tgaagtggga tgtggaacaa     60240
     tactggaaca gaatgagaag ggcataagga tcggagtatc ctttttccac aatctctggg     60300
     ctaagaagga cttcctgccg tctgtgagcg aaaaggcata tgtgagcgat tgtggagaaa     60360
     agcaattggc ctgggtgtgg atttaccgag agaacaaatt gtattttaga aggaagtcct     60420
     gtataagatt ccgagttttg catcccgagg agaagtcttc ccttgttctc tgtggtctca     60480
     acgaggcggg attggggcca ttagaatggt gggtgtagga agtacagggc ttggatggtg     60540
     taaacagggt ttgtgtggcc cctatggaga aaatgggttg cgaggaggaa aggttagata     60600
     tgattataag aagcttacgt gaaatgtccg cagatctgga ccatctcctc cttcttggat     60660
     cagatgttaa ggacttgagc cgaaatcttg ataagtttct gtgatgtttc ttttctggat     60720
     gctgtttccg agaataaaga gttttcctaa aattgtctaa atcccttgaa tctaccatga     60780
     aagtacaaaa aattatagag ttgatcaagc ggtcctatga ccagccaata ttgttccata     60840
     ggctccactg tcacttggcc tacattctgg aaaaaggcaa tctgttgtat gaaatatctg     60900
     atgagtggtc aagaatacta gttctcagtg caacccagag caaggacccg aaccaaggcc     60960
     tcgaaagaaa gattctgtcg tttctaaagg aaataagacc tccagtgagt agcaaggaat     61020
     caagattgaa gctgtggata attttgtact atcttagcag cagatctcca acccaggtga     61080
     atcatttggt gctttttgaa cttgtttcca acttcatagg tacctcgcct tttgtggatg     61140
     ggctcatctt gtcaatattc agcagagctg ttacctgcac cagctttggc cttgaaagta     61200
     acaagaagtt gggaaatgag agtattgggc atctgcttga aataataaag aagaagtcct     61260
     taggagttct gtgcagggcc ttggctcttc catgttatat aaatcacaag gtcgagccgc     61320
     catccctcct agacctagtt gttgaaaacg atgcacagac cctcatagtt ctggaaagag     61380
     tattcttcta tgcgaagtat tccaagcatg ttgagtttgt gaaaaaaata gttccagacg     61440
     atgcagtctt tgttagtagc ttgaaagagt ttatctctaa gtcctttcgt gtaagtacca     61500
     aagatggtgg gggatgtcag gttgcagata gtgttgttga taatctcggc atattgaacg     61560
     aaataaagag ggcatatgaa gaggcacggg acaaaaaaag atttgtatcg aggatcacag     61620
     agtttgtgat ggagttggat aagtagttat gagtccggaa caggaaaaga gcaacaccct     61680
     gagcgggact cgaacccgca atcttctgct tagaaggcag acgcgttagc cattacgcca     61740
     tcagggctcg atcccacgcc taccaatccc caatacctct ggaatccaaa caacttgcga     61800
     aaccttgcga agccctcatg cgtgaagtga taacactaca ggttggtcag tgcggaaatc     61860
     aaatgggtgc cgagttctgg aagacattgt gcaaggaaca cggaatatcc aactgtggga     61920
     ctttacaaga caacagagac cttggagaca ggaaagatgt cttcttttac caatcagacg     61980
     ataatgtgtt tgttcccaga gcaatgcttg tggatttgga gccccgggtt atatcccaag     62040
     caccatcatt tttcaatcag gagaatattt ttctatccaa cgaaggaggt ggagcaggaa     62100
     ataactgggg acatggatac tatatgggca agaccatggg agacgacgtg gtagaagtga     62160
     tccaaaggga agcagagggc tgcgattctc tcgagacctt cttcttgctc cactccatag     62220
     caggaggaac aggatcagga tttgggtctt tacttttgga aagaataaga gaggagtttc     62280
     ccaagaagat tgtccagaca tactctatat tccctaacaa cgatgaatcc agcgacgttg     62340
     ttgtccagcc atacaactcc atgctgacgc ttcaaagact catagaaaac tcggactgca     62400
     ttgtcgtgat ggacaactca tcgcttggaa gatatacctt ggactctctg aggatcggca     62460
     ccccaacatt cgaccatata aatcacctta tatcaacagt gatggctgca tccacatcta     62520
     caattagatt tccgggatat atgtattgca cacatcagtc cataaatagc tgtcttattc     62580
     ctgttgatcc actcaaattc gttgcaccat catacactcc ttttgcatgc gatgaaatgt     62640
     ctaggatcgt caggaagaca acatgttccg acgtcatgag aagacttctc ctaccaaaga     62700
     ccaggcttgc aagctatgag caaacgaagg tccagtctgt agtgtcgatg ctgaatatct     62760
     tgcacggtat cgaagatccc ggagaggtgt ccaggacagt tatgcggttt cttgacaagg     62820
     gaatagtcaa ctttgtcccc tggatgcctc cctcattcaa tgttgcattg ggaaagaaca     62880
     ttgccaacaa cataatgcca agcaggattt ccggtctaag cctcactaac tcgacaggaa     62940
     tctcttcggt cctgtcgaag atatctggac agtttgacaa actcaagaag cagcgtgcat     63000
     tcctggatat ttacaagaga tttggggttg aacctgaaat gtttgaccat gcaaaagaga     63060
     ttgtccagaa gactcttgag gaataccgca tggccgaaat gtcgacatat ttaagccact     63120
     aggcatgcta accgaagtaa actcaaccat gtccacctta tttattgtta tttcctatgt     63180
     taagagatcg agacgcccta tggagaaagg aagcaaatcc ttttggaacc tttattccgt     63240
     ccactccctc gaagttcctc tttggtagct tactaagcat ctcgtcactc ttcccaagca     63300
     taataacacc ctcgtagaga aatcccgcta caagcaggac aatctggtcg tattttttcc     63360
     atactctttc ttgtgttggt gtcttgacaa catcgacaaa tgcagctgcg aattcatcaa     63420
     aggcctgccc tacaaatgcc tcattcacct ccatcggcga atatatgatc aaaagtatct     63480
     cgtccagcct cttacacatg acaattctgt cacggaacac tgctatactc tctctatctc     63540
     ttacagtctt ttccacaatc ttctccacaa ctccctcatc ctttgtaaag actttcttat     63600
     agagaatctc cccttggcta cttgccacaa ccaacccttc aacatcaaag aggctcatcc     63660
     agggttcgtc ctgctagtca ttttggcctt tgtttatcta tctccacatc ccttgagatg     63720
     atgcatgaat tgaactgtgt cccacaagag acaataacaa gtgtttcata caacaaggat     63780
     atacttattt ccctgtggag tggagagctt atgctgtatt ctggagtcac ctttggatgt     63840
     aagggatcgg tagaagcgga gattcctgtt accagggcta ttcttacgtc ggacgtggtg     63900
     gctggagata tagagggaag tgttcggata tatgacatgt ctttgaacga aaaggcaaag     63960
     atctcaagcg gggttggtgg aatacaactc ctgcatgagt acaaaggaag tgtagtggct     64020
     ggaggatgga acaagaaaat tgtgtttgtt aacggatgtg tggaaaatgt gataaataca     64080
     gagaagaagg tgtactgttc ggatattttg aatgatgttc ttctagtagg ccagcaagaa     64140
     tatgttgtgg catatgacct ccgcacaaat tcattcttct ttagaagaca gttcaacaca     64200
     gttgttagat cactagcctt gggcccagga ggtttctttg caggtacaac cgatggccgg     64260
     atatactacg aggactttga ggacaagtcc agatcctatg tgttcaatgc acattactcc     64320
     atatcgggag actcgaaaat cttttatcct gtaaactcga tagtggtggg aaaatatctt     64380
     ctttcagggg gatctgacgg aagagtactc aggtggaagc ttgaggcaaa gaaaacttac     64440
     aaagaaattg cctgtgacaa agtgggggtg agtggtcttt gcacagcaga ggaaaaagtg     64500
     gccataggct tttcttactc acatgataga ggagagaaag aagagatgag ttgcagcaga     64560
     gtagtgctgg ttgatttata ggcggcttag gagtaaaaga tctaaagata agtttcctaa     64620
     ggggtttatg agctcattgc aaaacccccc aaatggactt gaaaacatta aagcaaatct     64680
     acttagatag acttgcgcca aggccagatg taagatgggg aataacagga gtggcgtttg     64740
     tcctgtactg cattcgtata tggacaacag gagctttcta cctaataaca tactgtctag     64800
     ggatctatct tctccatgct ctaatccttt tcctcacgcc aaagggagag atgattccag     64860
     atcctttcga gaatatcgag gatgatgact atgttccaga ggcaatagac aacgagttca     64920
     agcccttcat ccggaatctt cctgagtttg acttttggat gtttgtcaca aagacagtcg     64980
     gggtagcact tgtggggacg tactttgaca tattggacat tccggtgtac acaccgattc     65040
     ttgtgttcta ttttattttc atggttggat ataccacaaa gcgcctagtt gcacacatga     65100
     agaagtacaa ctacaatccg tttctccaaa gtaaggagta ctataagaaa taaagcacgg     65160
     taatttctgc atgttgtcct ggttctaagc accgttggtg caaaaataca cctgggatcc     65220
     accctaggga atcttgagca atggaacgga ttagactacc actgaagcgg cacaagatcg     65280
     agcaagaggg aaaaggctgg agaggcagag agcagaagaa ggtggatctg aaacgatttg     65340
     tggaaatgtt tgtcaaccaa gccttgaagg agatgaagga agcacttggg aaattccatt     65400
     ctatttccga aatagtgtgc agaagggaat tgagcgtgtt tttcaaacag aaggctgcag     65460
     actttgaatg tttgtttcta cttataagtg gagttgagta cctgaaagag gcaaattcaa     65520
     acagacatag gatggagaag atcaaagatg tagatgggga atatgtgatg atggcggatc     65580
     gacttgcaca tctgtttgga tccttcaagt cgatgattgt acccaagagt gatgtcttta     65640
     cctcactcca gacggtttac aacagcagct atcttcttcc aagtcttgtt ggagatagta     65700
     ctgagcatga ggtggcaagc ttcgaagaaa tcaatagaat cacccgaatg tacttggaca     65760
     aggaggatct gtctgtttat gacagtgttg tgattgatcg aggtattaca gttctgtcga     65820
     ccagattttt ttcgtttagc cttgcattat gtggagagat atccaggcct gaatggaaac     65880
     tgatcaatgt caggggagat aacgaggtct tcaaccgcca ccttctgttt ggtatgcccc     65940
     atcaaataga caagatatcg aggtttctga gggtctatga ggcacacacg aaggcccggg     66000
     atatatttct gatggtgaaa agatcttccg agcgcataga actgagtata aagggccact     66060
     acaagagatt tgaggtttct tttcacgtgt tcaagatggc agtgcatgtc gaatgcagcg     66120
     atattaacgg gaagttgttt atagaagaag atgtgtttcc ttctggaaag aatgtggtag     66180
     agtcgtttga aagtagagtt tcggagtatc tctgcaggga cggaaggaat gcttctttta     66240
     gttttgaaaa gggatttgta gctcttggag atgaagagat ccaaaccttc agaagtttta     66300
     cagacctaga tgtcttcttg gaaagaaaga aagaaaattc cagcttttat agcttttttg     66360
     aggaaagatt tccctgctac agaaaccata ggacaaacat gtttggggat agaaatgtct     66420
     tcattataga aaacgggctt tttgtgtgca tccgtctggt gagatttgta gatagccaca     66480
     tggagataaa ggtaatagtt gggagctgtg aactggtaga ctttccgagt tatacagaag     66540
     tcatcatgga agaggacgat agaggagaga tagtggggat tataaacgga ggaaaggtaa     66600
     agcaatcgac gatcaagacc gaatcattgt gcaaatactt tgaaaaaggc atggagcttt     66660
     tgtttctttc ctataggctt ctcccgatga tcaacggaaa gattagtgtt ggagaacaaa     66720
     tcttgctgaa ccatagagtc aagaatacac aaattgatat ttatatagag aagagggagg     66780
     agaagtttat tgttacaaca agcagatttg gggcaaggac agccacaacc tcaggggatg     66840
     ttcataactg tgttgctttt gcgttgcttc taatggatat ctttacaagc tcaaaggatt     66900
     cggagctatt gaatgttatc tcgattgacc ttttcaaagg aacgacgttg agaatttcgg     66960
     gtcttcccgt gtctcttaag ctggactgtt caaaatccct caaggcaagt ccactggctg     67020
     tgaattgtgg actaagaaac agttctatcc ttggggccct gggccttcta tactgtttcc     67080
     atgggttctt ttccaatggg cttgtaccta cagcttccac acccacaagt ctgatatttg     67140
     tgtttagaca cctgttcaaa gggcatgtga aggtaaagat ggttgataga actaagtaca     67200
     tggtttctct gaatggaggt agaattaagg acgctcttgg aggctttgga cgtgagatat     67260
     ctagcatgga cacgtctttt cctcgaaagc tatcttcctt ctacttcaag gaaaagattg     67320
     gattaatatc cgatgtggca aggaagagtt ataaaataac tgccagtgaa agcgaggtga     67380
     gcatttcaac agcctgtgga aacttcaaga tctatatcga agattgcaga tgtaaatttc     67440
     agatctgctc catcaacaca gtcgaaccaa gcgatcagtt catagaagcc atcagcgagt     67500
     attttggaga ggctatgagt gaaggaagag atattcctag ttgtataaag cttttagaca     67560
     gttcagaaga acttaagaga ctgtttgaaa acattgagtc gaagagaaaa gggaattaca     67620
     gtaactaggt ttattaaaca gcccttccta ggagaaattc ggcctgtttt tttcctgttt     67680
     gtggacacga agctgtgata tctaaactta tttatttaca cttcctcgat gctgttgact     67740
     gccagggtat cgaatgtatt tcttctgcag aatagaatat aaaaaatcga gccaatgaac     67800
     gagaagataa ggacaacagc caacgggaga gcaacaagga ccatctgggg cccaacccca     67860
     agaacaagac atacagtcaa gagggtcaca agcatgctga tgtgtgcagt aagaactctt     67920
     ttccatccaa gaacctcttc gttttcatct tccgaggccg tttcaaggag cgcaaagaag     67980
     tcattctgtg ttctgtctat ttcaaaaaga aagtcgtcgt ctgcatccag ggtgttcctc     68040
     cggaagtact ctctgatctc cggctgcatc agaaagtcgt cgtccgaagc gaaatagttg     68100
     gcactgtaca tcacgcttct ttctggagga attgacttag gcatagctat tgtgcctttc     68160
     tgaatctttt ctatgatctc tctgggattt tcctccatgc tacttatctt caaggatcgg     68220
     tcgctagcat cgagactgtc tcttgactta tgacatctct tgttgtcctc cgatgcctct     68280
     tctaccttgt gtctgaacac ctgtgaaaac gccttttttg ttgttttgcc ttccaccttg     68340
     gtttctatga agaaatactc aacaagtgct ctgtcgactt cttggggcgg gactttgtaa     68400
     tagtaaacct gccctagtat atacatgttg ttaagggggt ttcgaacctt cattctgtgc     68460
     aacaatcttc tgtcagactc aaacctgaat agtatcctat tcaattctga tgcagcgtag     68520
     tagaagttgt atatgacgct ctggtcatct ggatctggag ttgtgactct tgcaagtatg     68580
     aagtccttat tcttcgacct gcagtccaat actattgttt tgaactcttc taaagtgaaa     68640
     gtttcaacag tgtttgcatc cagtacgtcc aattcatcgc cttctccata tgccaggttg     68700
     tttggacccc cgactatcct gattttggat ggcattccct tggatttctc atacagatct     68760
     agtgtctctt ttgccatccg gcttgaactt gtttgtaaac aaataaaaat atatttggcc     68820
     atgtgattaa attaaaaaca atggccttcc ttcccttgct tggcgatcca tgcttctttc     68880
     ctggaaatac tgtccattcg tgttctgggg agttgtaaac cttttatttg ctaatctgaa     68940
     acagacagta ataaaagaag cttgacagta aacaaaaaat gcctggcatc aaggaggata     69000
     tgaagaccta tacattcaag atggtggttc ttggatacta ttcggtgggt aagagcagct     69060
     tggtgctcaa gtatgtcaag ggggagttca atccaaatga ggagagtacc ataggtgcat     69120
     cgttcttaac aaaaactgtt tttactcctg aaggaagcat caagttcgaa atatgggaca     69180
     ctgcaggcca ggaaagatac aacagcctga ttccgatgta ttaccgtggg gcgcaggtgg     69240
     ccctgatagt ttatgatata acttctgtgg aaagcttcga aactgcaaag agatgggttg     69300
     aagagcttag ctttgagaag ccaagggagt tcatcaaggt tctgattgga aataagtccg     69360
     atctagagga agaccgaaaa gtagagttcc agcagggaaa ggaatatgca gatagtcaaa     69420
     accttctatt cttcgagtcg agtgcaaaga caggaaaaaa catagccgag atatttaatg     69480
     caattgcaga gaaagttcca aaagaggagg tcaagaaaaa cacaaaagga tttaggctga     69540
     gagatgatta cataaaatac ctttgctgct gatctttatt tactttaaat gtttgtaatc     69600
     tcgaggacag atcttctgag tcttatgtaa gactcgatcg atccacattt ctcgaggaac     69660
     ttcccttcat ctagtgcttc gcagagcaga ggatcgattt tcagctcgca tataaagcga     69720
     acacccatct ccattgcaag tctttctcct cctcttgccc caaatatgtt ggtggggttt     69780
     ccacaggact cgcagcagta tccactcata ttctccacaa gcccgagaat ctggattcca     69840
     ttagaaatgc aaaagtcaat tgctctcgaa gaatctccta gggagatgtt ctgcggagta     69900
     gtggcaatca aaacactaat gtcctttcca accagaaatc catgttcctc agatattcct     69960
     ggaggcatat caatcactac gttatcaaag ccatcggccg attcatagaa catcgataat     70020
     acagacatct tctttggacc tctccatatc acagagtcac tttccttcat aagcaaagcc     70080
     atcgaaagta tgtacaagtt ctcagatgct ttggccggaa tcaatccctt ctctcctttg     70140
     tatatctttt ccttaatccc aagtccacta gccacacttg gcccacacag atcaaagtcc     70200
     aacagcagtg tctttcctct ttcggacatc gccgtgctca gcatgataga gatcgagctt     70260
     tttccaactc ctcccttacc actcataaca gccaccatga ccatacaagg ggtgccccaa     70320
     tcagtctatc attcaatttc ttccgactca tttacagacg ccagtttctt cacaaatact     70380
     ctttccttcc ttttcactac aggcaatctt cttggcttgg ctgttggaag tagtatagag     70440
     ggaaactcct tgatgttatg cacctttgca ttaggcctgt cttggaattt tatctttctt     70500
     ttccgtcttc tacttatgtg ctctggacat ctgctttctc catcaaacac aagaacaaca     70560
     tatctgtatc cagaattctt gagagtattc ttttcaacaa tttccttcat acattttttt     70620
     tttgttccct ttgcatgacc attcgagtcc ttcttggcta acggatcttt ccccttcctc     70680
     atttggtatc caacagacac ttttcttttc ctaatcgtcc catcttctac aagctttgct     70740
     tcctttttct ttctaggctt ccttctttta aaagccccga agcccaactc agtcttattt     70800
     tcttcgagcc tcttcgccat tccccttttc aatatctcac ttcggagtcc gatgttgttt     70860
     agtagtgagt attccctatt tagaagatac atatctatct ccctcttaga aggccttcct     70920
     ataaatattt catccatcaa tttcctcccc tgctttggct tttgttttat tctctcctcc     70980
     gccctcctgc ctgaagaagt tgtatataag aacaccattc tctctcccaa gagtcaactc     71040
     aaggcgatcc atgctggaga atatgaggtc cttcaggctc ttgaaacatt ttcgaacctt     71100
     taggatgttg aactgtgtta ttccaggaat actcagaagt atctcatgga ggacggggtc     71160
     catcttatgc ctttcagaaa cacttggtac atcttccttc ctctgaagat ctcttatcac     71220
     ctttgtggaa aatagtcttg actcagacca gataaccctc agcattccga agttaaacag     71280
     aagcaaggca aactttgctg caatgctgtt tttgaatgtg tcctggtcat agcggtagtg     71340
     gtcagacaga catggccttc catcaaactc aaggaggaga acagggcttg gatacctgtg     71400
     gcatagcatg ctcatctgag aataaagcct tcctgtccct agagatgata taaagtcgga     71460
     gatcgatttt ctttcgatgc agattgtggg ccctattagg taatctccag tgggaagagt     71520
     ggaaatgcat atcttgtttc ttgccctgaa cagaaagaag ggaagttcgg ctcttagctc     71580
     cctggagtca accacaaccg tgtagtcctt ctctcccgac tcatgctcct ctagatcaat     71640
     cacatcctcc ccatccaatt gcaaaggaag tcttgatctc tcttctatga gcttttcaaa     71700
     cgatgtcttt tctcttctta tctcattcaa gtatctttgt tcctctagag acgaggagtg     71760
     cataaggaaa aacactttaa caggatgcat caccctgtat ctttctatct tcctaacgct     71820
     gtcctgccca gattctacaa aaatcacatt ctcataactg ctctcgtaat acttgaactc     71880
     gtagtgggtc aagatcttta ctgtgttctc cttcttttca atactctcga cagagactag     71940
     accaaacaca acaaaaacat ttaagatcat gttcctgact gcacggttgg aaactaatac     72000
     tatcgacgat gcctctccta actcctgcag aatctctatc aatttcttga tctttggatt     72060
     caaggtatag aaggctctta acttggaatc ggaaagtccc aagagagatt ccagttcatt     72120
     cttctcattt ctcttttcct tctgctccct aatatcttct attttttgga ttgcttcttc     72180
     aaactgttct ctggctccat caattagtac atgagatatt ggtagattga tccatgtgct     72240
     atcctttcca agttctactt gcttctttac aatttccttg acatatccat agaacgatcc     72300
     tggatcgcaa gaaaacagca gaaaaatcaa tccacgtatg tcatacagat cctccattat     72360
     cctgctgttc aaaacgttca tctgcttgaa tgtcttgcgg atacttccaa atattatggc     72420
     ctctgcatcc acctcctctc gatcaggacc tctgaaggcc attttcagaa gcccgttgat     72480
     gatctccaaa agaatcactt ggagatgact gcggctctcc gacattttga acttgatctc     72540
     aacaacatct gcatcccctt tcaaggactt ctcgaccgag gaatggaatc gtgggaaaaa     72600
     aacaaccttg ttcatcttca ggcttttcat cttcctggct agcggagaga acccaagaga     72660
     aagaggcaca ggcgactccg aaaacccgtt tatgaatcct gttttattct ttgatctgaa     72720
     gacatggctg atgaaggact ccagcgatgt ctctgttact gtctctgcat ggttgacaag     72780
     aatgcaatct attttctcaa catccactgt gccgtcaatc atgtctgcaa gaaatacacg     72840
     gctacttgca ataaacactc ctccattgag atacttttct ctccttcttg tccttggcaa     72900
     agttcttaca tcatgaagga aaggagactc catcctcaga agcatcgatt cgtcctctgt     72960
     attgaaattc accagaagca caagataggt cttctccaga tacttcttta ccacctccaa     73020
     aattatccct tggatgttaa ggcctccccc cattacaaga aggctgtttt gtccgtcgca     73080
     tgtttgaagt gcttctttct cgtactccaa gagcattttg ggattagaag atgacatgct     73140
     caagtgagag atattttcaa gccctaaatc gatggaaatc gatgagtgtg ctgaggatat     73200
     aaaagactcc catccagtta tgcttgccga ggcaagatat ttgcttgaag gacagaaaga     73260
     aagattccga gcagatttta gatcgaatgc atcgaagata tttagatcaa cattaggata     73320
     tttggacgag ttctgcagga ttaaagacaa gtcggttgca gaagacctcc gaacaacctt     73380
     ttctggatta gggttcagcg aggttgagat agccttgctt ggatccctat tcccccagtc     73440
     tgttgaggag gccaagtcac tcattccatc tctggcgtct aaggatgatg acacaatcag     73500
     ccatgctgtt gagaagatac agcagcttat gtgatgagct ttggaaggaa ggaaagacac     73560
     tattaaattc ttaagaccca aataccatgt aaattcttga agtacaaccc atggaaggaa     73620
     agtgttggat atctcttcgt acggaagaag ccattgacct ggagctgacc ttgttcagtg     73680
     gacaagtgtt ttcattcaag aggacgggag agaaggaata tactggggtg ctgggagaat     73740
     gtctggtgag ttttttgcaa gatggaagta gggtcctcta caaggtgctc agcggaaaaa     73800
     ggtctccaaa ggaagttgag gaggatattt tttatttctt tacattagat ataaagctca     73860
     agcctcttct ggagaaatgg aaggttgatt ctgacggcct cctaaacggc ttaagggctc     73920
     tccgatacga tctaattcca acgatatttt cgtttatctg ctcgtccaac aacaacattt     73980
     ccagaataac aaggatggtc gagtttcttt attcaaaggg agagtttatc atgaagtata     74040
     aggggattga cttccatcgc tttccaagcc tggaggagtt ggtaagcatt gaaggagaac     74100
     tcaaagctaa agggtttggg tacagatctt catacatctg caatgcagca acatatctac     74160
     aagagaacta ttccaagcta cagcaaaggt ctagaatcag ggaggcattg gtttcgatca     74220
     agggcgttgg agagaagata gccgattgca ttttgttgat aggtgttggc gagctgagtg     74280
     ctgttcctat tgacacacat attttcaagc attctaagaa gatgtttaga atccatggaa     74340
     agacattgac tcggagggca tatggagctg tgcaggaact gtataaagag aagtttgggg     74400
     aatatgcagg gatagcacag ctctatatat ttaagaggat ggtcgaccag gcaaagaaga     74460
     ggcaaagagg catcgatagg tttggacatc ttggaatgtt ggatgaaaag aagaagtaaa     74520
     aggactcccc ttgatgaaat gggatgtgga caaagagtat tcgactaacg aacctcaaga     74580
     agaggtaaag agagtcaaga gggctattga gggcatggat gtcaaaccta tggagtctgg     74640
     tagggtctcc ttaacagcag aagaaaatgg ggttgaaggc catgatctga acttcaagag     74700
     gcaggttaag aagaaggtga acgattacaa gtacaagacc ctttacaacg ttgggaaaac     74760
     aaagaatcca tatgctctca cacgtaatag tgtggtgata gccatggaag aggagctagg     74820
     ggtggagatc cttgtcaagg gaagttacaa gccagaagag ctgaatggag acacagacga     74880
     ttcggatggg ctggtgtatg agatctcggc cccgacgccc gagatcctcc aggaagcaat     74940
     gttcaaaatt ccatctatgg tcaagactgt gcctgtgctc ccatggacct cgtccagtat     75000
     cttgggaaga tatgtctgga aaaacggcac ccggtaccat tcgtacagga tttttgtaga     75060
     tcctgacgat ttatcgggga agatgaatga gttccgcaag gacatagaag cggttgcagc     75120
     cgataaatcg gtagacattg ccattagagg aaagttttct gggcatgtgg agccatgctt     75180
     tggtcaggag gcgaatgagc ctccatatat tcaaatacta acaaaaacca agaaggaaat     75240
     aagagaagta agaaaggcat gcagggaagt gatctccaag cacagcgaaa tttctggata     75300
     gatttctgga cttttggaag ggattacttc tcccgaagat gatttgatat ctcaattgga     75360
     attctgaaac acgattgcta taaaggtaat ttgtttatga agtgaatcca atggacagca     75420
     acgtggcgga agtagttctg aaaggccgat ccaggatcgt atttggcggg gaagattccg     75480
     gcctaccgct ctacactctt gatacggagg ttgtagaggc ctttactctg gaaaggttta     75540
     aggagctgat tgcctccaat gttaaggaag gaaaggactt tgtagttggg gaggtgacta     75600
     caagggatcc tccaacgggt tcaatcttta agaactacta tgctgcagtt gaactgaaca     75660
     gaatcctctt ttgtgtagag ggccgtaaca accttttgta cagggtaata gctaggaatc     75720
     caataaacaa ccttgagatt gaaggaaaag tcttgtatta caagataaca tggaaagctc     75780
     tgtccagcgc cgtggagaaa aggcattctt ccaaggacga gtttctgata aaagcagact     75840
     actttgctaa tgatgaggat ctgctttttg atccatcggt tagaagatac tttgccaaga     75900
     actttgcaga tgaagagtat ttcgtgcatc gactcgagaa tatggaaagc ccaatggtga     75960
     tctcggagga tccgttagaa ggctaccgcg atgacaaatt cgggcttaag atcatactct     76020
     acacaaacat agggactata ttggttgtat ttggaatgtg tatcctcctt gggtccagag     76080
     aggctttttt tgttgcaatt gcccctcttt caatgacact cctcttttca atcctcttcc     76140
     ttgtcctcta cgccttgctt ttcgaggctc cagagggcct ttcttcgata ttcaacttcc     76200
     gaaaaactag atttagatac gaaagcagtt aattaaagcc atgttgatcg aaaggagtta     76260
     aaggcctaag gcccatggat ttccaataat gcatttattt tttcttcttt gtctttttct     76320
     tcctaacaag attaagctta ttctcaacat acacgccctt ctgaacaact ccatgcacca     76380
     cctttccatg ggcctgcttt cctgaagaaa cactgccccc acttcttgca gaggatctca     76440
     tctctgcaat cgtttggctt actccctcta caacaaacag ttttccatac tcctttttaa     76500
     tccggaacct tccattgttg aagaagtctc gaggatgctt cttcaaaggc tcttcgacac     76560
     attcgatttc aagtttttcc aaggcatttt tgatttcatg gtatcgaggc ttctcaatgc     76620
     aaatctcttt tctatacttc cttccctccg aaagcgccct ggatgaatcc atgtaggcag     76680
     gatacaagca gaagtacttg ttctccatca aggggaagtt ttctggaaaa ttataattga     76740
     ggtttctctg caaaatcctt tccaagcttc ctatctagcc taccattttc aatcctggtc     76800
     cataaatcga ctttgtttac accctttaat gttgtcaaag tcattagagc ctttctttga     76860
     aatgccatca gcatcaggta cggcaatata cattgcctgc tgatttgttg tcttggcatt     76920
     tcttaatatc ttctatgcac acgagtatca ttccaaggtt acaaagcata tcacaaagaa     76980
     aatagaaaac atctttatcc aagctcttgt gttatgcttt ttaaacggca ttccaaagat     77040
     gattctgatg gtaaatttgt atagaacctt ccccatacag gtgtttgcgt cggccatttc     77100
     aggtaccact caaatctcca ttgcaatatc tctcgctctt gttttgatat ttgccaagac     77160
     aaattgtttt gtccaccata taagcttcta taaggatgtc ctctttcttg aagcctccca     77220
     tctgcttcta ctgataatgt tctcgaacac ggcagatact ctaacaattc caattatgac     77280
     cttgagtgtg ttctttgcct ttctgttcaa cactttctct ctgcctgcat atatctcgca     77340
     ggtaccggca gaagcccagg acaccgtctc ttcccatcct caagctccgc atccatccct     77400
     tggcctatac cccatccgat tcatattcaa caccatcttt ctggacccag accagctgtc     77460
     ttcgtcctca aagaaaacat catatacaat catgctttct ccggcgatca gccttctagt     77520
     aggcatggta cactttcgca tagacatcgg acgccttgaa ttccttcttt ctcttatctg     77580
     ctccttcttt gcaggcttgc ttttatacat gatgataaga aaaaggatct tctccacaat     77640
     ttcatgtctc tacaccttgg ctgtttccat gctctttttc tcgataataa tggaaaatct     77700
     tgtggatctt accgttcgca tcagcaatgc aacaggatta ggaattcagc ttctttccgg     77760
     tacgtttctt tcactccaat caaatcttac ggaaatagta acatgtctta aatacaaggg     77820
     aaatgagatg ttgactgtgt cgtcttgctc catcctctac acgcacatat tcaatgctct     77880
     tctcttcttt cctaccatcc ggttgctact gaccaaagac gggatcctcc ctcattcaca     77940
     aaacatctcc aatgctccct ttgtatactt ttcatatgtc tttatccttg ctgaaatcaa     78000
     agtaatcttt gtaaactacc tcctcagaca ccacaagctg acaaaggacc ttgggtacac     78060
     actcatagca atatatgcat tattcatcat cggatttgcc atagaaggta aggagcatct     78120
     ttgtaaataa acatattcct accgccattc tttggagata ttagccttga agataaaaaa     78180
     gatcggttta attagtggat cttattgcag atggatcaag cttcttaaca aacctcagcc     78240
     tttccttcat ctcttcatca ctcagcttga gctctgtcct tcccacaaac agaggctcgt     78300
     cgagaatggc ctgcactgca tcactgtaga acagctcttc aagatcgtca tgggccacaa     78360
     tcctgtcggg aagcttgaat ccaggagtaa gctcggcctc tctctcaact cctccaaaga     78420
     tcttgtccag cttctcaaag gcactttcgg tccatatgat cagccttcct ggcagtcctc     78480
     ccggcgcaag ctcaaggaga tccaagctgt caatgctcat ctgatctact ccccgaatgt     78540
     ttctgaaccc aagaagctca gaggactctc cgtgcacaat aaggatccct tttctttgtg     78600
     tatatcttct gttcctcatc ttccccttac cacatcgcac tcctcggctc ttttcaatcc     78660
     tcttcaattc ctccttcatg tttaagtcct tgagaatctg tagtgcatcc ttggtcttct     78720
     tggcctttga aatgtcgtca gagacaatga tgggaagcat cttcacattc gataccctgt     78780
     gcccccgagc ttccacaagt gatgtttgtg cagatgctgc aactgccatg gcctcggcta     78840
     tcttcttggt gttctccaca acctttctag cccatctcct atgcgtcttg gttgggtgtg     78900
     ccatcctacc ctttcggcag aagtttgcaa atgcaccctg tcctgccctt cttgttcctc     78960
     ctcccttcac tctcggcaca cgtgcaatcg ccctcccggt tccccaggac tctgcagaat     79020
     gctgcatacc tgcatacttc gatactgcat atggctgcct ggtcttcatc ctgtatatcg     79080
     agtacgtctt cagcacaaga tcctgtctga taggtgtgga aaacacctct ggaagatcca     79140
     aggtcttctt caccgtcacc ccatcaacct cataacagtt gatctgttgc ttcatttcaa     79200
     gccctcagag caaatttttt ttaaattctg ggattttcaa cctagctgtc ttctgtccca     79260
     attccaaact acttgacgag tctttcaccg tctccactgc caactccttc ttcttgcttc     79320
     cattccgttt ggatttaata cctttgcaac aatcccccaa gctcatgact tatgtgagat     79380
     ggctgaatgg agaagaggaa tggcttataa gaagatcccg caaaagatct tcatcgagag     79440
     gctcacaaag aacaatgaag gcaaagagct tgataacagt tgcaaacaat ttgtatgtcc     79500
     gaaacgagct tggaaagtgt gtggaagtcc tcaaggaaac aatatgtctt gtgccaagaa     79560
     atccgcatcc atacttcact cttgggctca tttttgagga gagaggagag ataccaaagg     79620
     catattactg cttttttgtt gctgcacacc ttcaaagaaa caactacgga ctttggagga     79680
     agctctacga ttactcacgg caacttggtt acaaccgaga aaggatatac ttcatcgagg     79740
     ttctgcagag gaaggggaac aagagagaga tggttgtgga gaagatgggc ctgtattctg     79800
     gagacaaggt caaggagctg agctgcaaga tagagctgtt tgagtttgat ggggtggatg     79860
     atgggatctt tgatgctatt cgtggggcga taacacacaa ggctcggctt gcacggctgg     79920
     caaagaggct tctaaatcat cttacaaagg acgaaagctc gtgctcggac tattatgtta     79980
     agcagcttgt cattctgaag tacgaagctt ccgacttcat tgggatgaag acaatgttcg     80040
     acaagtatct ctttaagaga cgtgttgaac tctgcacaaa gctcagagtg atatacataa     80100
     tggcatgtct ccaagatgga ggaggaagcg gcaccgagga atgtattggc ctcttcctgg     80160
     aagatgatag gctgtggtca gagattggag agatagatct tttgaagcat cttgccgata     80220
     tactcataga gcatggaaag actgacgaag tgataaagtt acttgggagg ataagaaaca     80280
     aattcaacga ccagaaggaa tttgtatatt ggaagctggg aaggatgctc catgacaaag     80340
     agaattatga cgaagctctg ctgtactaca ggctggtgct tgaaattaat cctatcaacg     80400
     acgatgttaa gtcacggatg cattctatct acacaaagca aggaaaccac gaaatggcca     80460
     agaaatatga aacgattgcc cagctgattg ggattgttga tgaaagaaat aagaaaggat     80520
     gtgcatattc acctgaaatg tgcatgagca taagggctct ctacgaggaa gccaggacta     80580
     ttggggatga ctgcaggaaa tttattgaat cgaatggggt tctggtggat gactttctga     80640
     aaaacagatt tatctttgag aagagaaaga aaagaccctc tggatccata aagttatata     80700
     gacaaagata tattgggaat ggcatctctt ccgaggggag aggggaggac aggatcatga     80760
     aggaaggatg cagagaggga ttccgatttg gggatcttca tgggctgagt gttgatgaat     80820
     ggttcaatgt tgttttgagc cagattgttg gcctactttc tgtctcccgc aatgaggagg     80880
     ctatgtctct agtgtttcga tccctggagg catatatctt ccgtcaccgg agtgacatca     80940
     tatgtaagct tgtgtttgtt gggctgaagg catcactgat gtttggagat tttggagact     81000
     ttgtcacctt ggtgagaagt gtgatctgcc atacaggaaa ttattcctat gcttatctac     81060
     tgttttactt cagcaacttc tttatgtgct tccaaaggaa caacgacttt tcctacttcc     81120
     agaagtacct tcagagagtg tgcagaagga ggcttagaat ccttccaaat ctcggagaag     81180
     acctgtcttc ggaatcttgt ggagactctt ccgaatccag aagcataaac gacgaaggcc     81240
     ataaggagga gacttgcgaa aatgctcata aggaagacgc tacaagaaga agagccatag     81300
     gggtgtccca cttcctgttc ttgaactcgc acattccaaa tctcctgcag tcgaaaactg     81360
     tggagatgat gtcgtctctc caaatggaac ggaacacatc tgaaagtata attcttgcgt     81420
     cgatgttcct catccactcg aagtcgagaa gagtgagcga taggaatatg tttataagaa     81480
     agggaatatc catcctcaag agtctaaaag agaagactca aggagaagat ggatgtgtag     81540
     tttcctacaa cattggaaaa gcctatcagt tctttgggtt tccggggctt gcagaaagct     81600
     tctacatgga agcgttgggc acatcggatg ttgaacttcg aaggcttgta caattcaact     81660
     tgtatcttat atacaaaaag aataacacaa tggagctatt taaagacatt ctcaaaagca     81720
     aagagccctc attcgcggag taactcatta ttttgtttat gcccctggga tgagcgaagg     81780
     ccagatactt aatgtgtgga aggacaacct ccatggagaa atgaaaaaga tatcccagct     81840
     tataagcaga tacaactaca taagcatgga cacggagttt ccaggggttg tagcgaagcc     81900
     tgttggaagc ttcaagtcgc cctcctcgtt tgcgtaccag cagctgagat gtaatgtgga     81960
     catattgaat atcatccagc ttgggatatc tctgagcgat ggggaaggaa accggccatg     82020
     ccccataagt acgtggcagt tcaactttgc attcagcctg gaaacagaca tgtatgcaca     82080
     ggagtcgatt gatttgctga tccaagccaa aatagacttt aaggagcacg agaggagagg     82140
     aatcagagtg gaagagtttg gagaggttct aatgacctcg ggattggtga tgtcttcaga     82200
     cgttgtatgg gtttcgttcc actccgccta tgactttgga tatcttatca agatcctgac     82260
     atgcaaccct cttccggaaa gagaagagga cttttacagg ttcctcgcag ctctgttccc     82320
     agatttctac gatataaagt ttcttgtaca gaacagcaga tatctgaaga agggacttca     82380
     ggagatatcc aacgacctcg ggcttgtgcg agatggaatt cagcaccagg cggggagtga     82440
     tgcacttctg acatcccacg cgttcttcaa gaccaaggag gttcttttca accgaagcat     82500
     cggaaaggat ctcatgtgta agttgtttgg aattgaggtc aaagaccccc tacagtaaag     82560
     atcttctaga gaactgcttt attaaaagcc taagctttcc tcgtcactta gactgttgtt     82620
     tgtttctaca tctatcttct ctttggttat gggaatggca tacttcttga catagcttcg     82680
     aacaacttcg ttgtactttt ctctgttatt gagatacatc gagccggcct cgcaattgag     82740
     aggatctgca gcatttgggt aggatagaag ctggggaaga agaatgtcga cgatgtttag     82800
     gaggtcgtat atgggagacc atatctggtt gagaacgtcg aggcatatcg agccgcttgt     82860
     ttcatcgaca tttggatgaa atatcctggt tgtgaatcct atcgaaggac ttttgaatgg     82920
     atagttatct ggaagaagta tgttaacgat gtactttgca ccgtagtacg gagagtcttc     82980
     ggggccattt atcaggacct ccatctgcgt atgcttcccc tcaagcatcc ggacctcgta     83040
     gtttgccctg tagagtttct ggatctcgtt cttaacccgt ggattgagct tgaccatgtc     83100
     ctttccttgt gtaaatttat tgtgtcttca ttacgttttt atgtgacagg tttcagaaac     83160
     ttctgcgaat cgatttggct cctggaaatc aaatctggac ggcaaatttc tttgtgcatg     83220
     aaacatttag cttttttgaa gaaatgggat tgggctgtgg gctccaccag ccaataagct     83280
     gagttttgat ggcgaaaaaa atttgcccta aaaatgccga ctggacaccg cgaccatctg     83340
     aagcgaaaga ctgcaccgaa gtcatggatg ctgaacaaac aaggaggaac gtttgcaatg     83400
     atgccggcca gcgggcctca caggaagacg gagtgcattc cgcttggata cttgatctca     83460
     aggtttctca agtattctag taactccaag gagcttagaa taatcctgga tggaaagaac     83520
     gttaaggtga atggaaaggt acgcacaaac tcgcactttc ctgttggtct gtttgatgtg     83580
     gtatctatcg agaagactgg agaacatttc agagttctat acaatgtgca caagaagttc     83640
     catcttcaca ggatcaattc atcggaggct agctaccgcc ttgcaaaggt cacaaagaaa     83700
     tacgagtcac agaatgtgcc atatgttgtt tcgagctgtg gactaagcat ccgtttctgc     83760
     gacccggcga tcgacgttgg atacacaatc aagatctcta acgagacgtc caaggtgatt     83820
     gaatatattg agccgggggt ggataaggtt gtatttgtgt ctagtggaaa agctagagga     83880
     cgaattggag tcataaatac catcagcatc caaggaaagg aagttgtcta cggcatgacc     83940
     gactttgcag gccatacctt ctcttgtaca agcaagagtt gcatactgat tggagaatcg     84000
     gaggagaata tcctgatcac gcttccgaag gagcggggga tacgactttc cagtcttgag     84060
     aggatcaatg ctcagctggg ggaaatggtc gatataggag tagttgaggt ctgcgaataa     84120
     aatatttctt ctttaatgtt atattcactt ctgagagagt caaaaaaagc tactaggaca     84180
     tttgcttctg atacaacact cttcacattt tggccttctt gcaacacaga ctgtttggcc     84240
     gtatcctacc agaactctat taattgtctc ccactctctc tttggaacga tcttctccag     84300
     ctcccttcga gtgctttcgg catccttagt cttgaccagc cctattctat tggagattct     84360
     gtgtacatgt gtatccacac ttattccaac cacactgccg catgcatggt tcatgtacag     84420
     aatggccatc ttgtttccaa ttccaggaag agacacaaga tccttcattt cttctggaag     84480
     tcccttttct ctgagaattt ctgtaatcct cttcaagttt tcggcctttt tggtatggaa     84540
     cccaactctc ttgatgcagg agtcgatgta tccaacactc gaactcgtta cattctccat     84600
     ggtcaggcca cagtctctgc catctgcagc accaccttct ggaagaagag tcctcagcct     84660
     ctccatggcc tcatatgtta tctcgtcttt tgtctgcgaa gaaagaagaa gagaaaccag     84720
     gatatgaaat ctcctttctt cttccgtctt atatgacggg gtaacaaagc accccatggt     84780
     atccacagga gatacaatgt tctccctctg ttttttgatt tctaagtaaa gttctagaga     84840
     ctcttttttc ctttctttag aggaggtgtc tttcatagtc cactgtataa gatgggaatg     84900
     ggccctccta ttgtattttg cgataaaaca ccaaaatcaa agcttcccat ctggaaagca     84960
     atgctcaaca acgtcaggac ataccttcgg atcaagccac aggaaatccc agaagacatt     85020
     gcagtcagca aggactcgat ggttatagat ggaagcaagt tctgcttcga taggatcttt     85080
     agaggctcca cccagcaaga aatcttccaa gagatatcaa ggagtctttt ggtggagtgt     85140
     atgcagggat acaactgcac tctctttgcc tatgggcaga caggaagtgg gaagacctac     85200
     accatacaag gaaatgaaca caacattggg attgtccaaa ggtctctgag tcttctgcac     85260
     agaaacacag acctaaagat ctctctctcc tttgttgaga tatacaacga gacaatgctg     85320
     gatctgtttg atcccgaggc caatctgtcc atacgcgaag atcctcttta cggggtagtt     85380
     gtcgacaacc taacgacagt ggaatcagac agctacgaga agagcatgga aatgtacacg     85440
     aagggaataa gaataagaag aacatcgtcg acgtcaatga acaaggaaag cagtcggagc     85500
     cattcgatat tcactgtgta tcttaagagc aatggagaag tgatgaaaag gtcatcaagg     85560
     ctgtgctttg tagatcttgc agggtcggag aggcttagag agcgaggagt ggaagagatg     85620
     aagatgaagg aggcagctaa cataaacaag tctcttttat gtcttggaaa agtgatcaat     85680
     aaacttagca acggcgagga cgggcatata gggtataggg agtccaagct tactttttta     85740
     ctaaaagact ctcttggagg aaattgcaag ttgacggtca ttggaaatgt ctctcttgag     85800
     agcagaggtg acagcataaa cacaatgaac ttcctccaga ggtccaagat gataagaaac     85860
     cttgctgttg tgaattcaga cgtaagcggg gagttggaag aggtgaagaa caagctgaag     85920
     attctagact gtgagaacca aagcctgaag gccaggattg ctctgatgga ctcgcagatc     85980
     caagaggagt ctgggattct cccctcctac cactacgaca ttgcaagggt gagaagtgca     86040
     gttgacgaga tcatgaacac ggttctggaa ctggaagcca ttgccaagaa aatccctgga     86100
     gttgaatttg gcaagaacag gaatcttctt cttggaatcc acgaatgctt catggctctg     86160
     catggaaagg agcagaaaga cacagacacg atgaaaagaa agcgaatggg cgaaagagag     86220
     caaacaaata aagaagctat gttctgaggt ggatgctgta atacagtcct taggcttatg     86280
     ggctgtaaat ttggatattt tggatccctg atttactatg aacttggcgt cgcagtgggt     86340
     tctttggcag aacaacaacg acgagtcgaa tgccaagagc tggggagacg acctcatggt     86400
     tgttggggag gtgtcgacga taccggagtt cctgtatctc tgtgacgaga tatcgaatgt     86460
     cggggttgga aagctgtgca caatgaatct gtttaagaaa ggaatcaagc cgatgtggga     86520
     ggatgaggga aacatagaag gaggaagaat tataatggat gttcctgtgg tgggcaagga     86580
     cagtattgat gagctgtgga aaagaaccat ggcgttctgt gtctcgaata ccgtcgataa     86640
     catatgcggg tgtgtactca gtgaaaaaca gtcgttttac aaggtggcaa tctggtttgg     86700
     gaaagattat aaccaggatt cgattaagga catgtggcaa gaagcccttg gagggggaaa     86760
     gctatccatc tactctttct tgcacaagaa gtcgttggac agcaacaaag gaaaaaaaaa     86820
     gtggggagga agaaggtaga gcacggagaa gtttcaataa agttatcttt gtttaattgt     86880
     ctgagagaca accctaggcc tatttccttc tggacccttt tcttgttaca ggtgtgacct     86940
     ttacaaagcc atctgggcaa atatccgaga ggatcgacag cttcgactca tcaagaaata     87000
     ggttaagaaa ctcctcgcat tcggtcttgc tgagccccga ggcatgggag atgatcttaa     87060
     cggcttcaga aaaagacttc cccgaaatcc tcctttccat ggagccaagg gtcaccgacg     87120
     ggtttctgga atgtaagaag ttctttgatt tgacacaggc ttcaaggatc tttgagcggt     87180
     caagatcctt ctttggatgc ttctttagag acaaagaaga aagatcctca aagaactcct     87240
     gaggcttttc aagaggcttc ttaacggcag catggctttc aaagtactcg tctagcttct     87300
     ctgaagaaag gaaatctcca agatctgctg caaggctatc gtaggataca aatcccttgt     87360
     ctatatctct tctgacctgt gtatttttta gttcttgggt gtttatcttc tctctcattt     87420
     cccggtcagt gaatggtcct tggatgtctt ctccccttct caccagccac ataaaggaaa     87480
     ggctcggagc agctccgaga acaaagtttc ctctttggtc gaaatgccct tggtccgacc     87540
     ttgttagatc tacatcccac attgattcag actctctttt caatgccttc ttctggggcc     87600
     atcctccctt ccggcttgca agtgccagta tccgccttcg aaggacgcac gccttttctt     87660
     cctttgaata ttcctgaaga atccttggtg ttctactctc cttagtgcat attgtcttgt     87720
     caaaaacaaa gtcatttggc ttcgtcgagc agatctccat aaagtttatt ggcagcatgg     87780
     gtgccctgat cccacaacta aagtaaattt aatctggagt gtcttaagat tactccaaaa     87840
     gacatttgga ttacacgttt aataaggagg aaaccgggag ttcttgtctg gcttgtagtg     87900
     gtcggggtct ggctcaaaac tgtccttcct gtttcttgag ggtgttatag gatctatgtt     87960
     gatcaacggg tctgtatcct cgtcctcaga aggtcgtcca gaaggcaagc gaaagatgct     88020
     tgggtccgcc agagatcctc ttggatgttt tctgactgtt ctgagaacac taatttcctc     88080
     ggtgtctgga aacagatcat ctctcccgac gtttctgaag ccggccaaag gggagcccaa     88140
     caaatcgaag atcctgttta tgcagagctg gtcgcatagc tcggactcat ggattttcac     88200
     acgtctatct ccatttgaga caacgtatgt accgtctggg attctctcga cattgtattt     88260
     tgcttttagt gtgtccagga acttattagg tttcatggtg ggattattcg cagacggaat     88320
     ataatacttg ggctttggat gaagaaggcc agataagaga agaaaaatcc ctcccttcaa     88380
     tgagtagaga cgagaagctt tttgaggaaa ttggaaacaa gatcaaggac ctgaagtttc     88440
     gagtcaacga agatgttgtt cagacgattt atgagatggt tgtgaaggaa aagggtgcaa     88500
     ccgatgatct gggtggattt gtgaagaggc tagaggaaga cgggacgctg atgaatctgc     88560
     aactgaactc gaaaggaaga gacaaagaaa gccttggagg aaaatggagg gcattgagga     88620
     gaagtggagt ttactcggaa agaattacac ccgagacgtt tcagctgagc tactacccga     88680
     aggatgaaga aacaatgaag tttcttagtt cgattcttgt tagtgacatt ccatttggat     88740
     ttctgaatcc cgagcaaaag ataagactaa ttgagtcgat ggagccggtg gagattccat     88800
     gtgggacatt tgtaatccgt gaagaggacg ttggatcgca gatgtacatt gtggaccacg     88860
     gggagtttga ggtttcgaag agaggacagt ttcttaggaa gctgtcaaga gggaacttct     88920
     ttggagagat agctcttctg cacaacatcc ccaggacggc ctctgtcaag gcagttagtg     88980
     atggaaaggt atgggttgtg gagcagacgt cgttttctgg aataaggatg atggaccgga     89040
     tttccaacaa gagaatcatc atggaaggtc tgaaggaaca caaggttttc ccgtcatttg     89100
     gagacgagga ctatgagcat attctgaact cattaagttt tgagtactac aagaagggaa     89160
     gcagagttga ggtgaaggat agcgagtttt tgatgagttt atttgagggg gagattgacg     89220
     atggagagcg aaggaagatc caggcaaagg agatgattgg aaagagcttt atggcgataa     89280
     gtgagatcca gggagcacat atatgtaggg agtatgagag acctaggtgt tatgattctg     89340
     gggggtctgg aagataagga gtggattgag caataaagtc ctattgggcg cctgggggcc     89400
     ttatggtgag atcgggggtt gtggggggta tggcaagtga ccttagtgta gtggttatca     89460
     cgttcgtcta acacgcggaa ggtccccagt tcgagcctgg gaggtcgcat tatttttgca     89520
     ttgggttttg ggccaaaagg attgtctgaa aaaagactct cccaagctgg agtcgaacca     89580
     gcggccattc gataacggca tacttctaca gtcgaatgct ctaccactga gctattggga     89640
     gttgccatgc tcagcccttc cagacttcac aaaacaagaa cctaaaaaca taagatattt     89700
     aatgaaaaga cccagatcct aacacgaact agaggcacat cctcacagct ctcgaatgtt     89760
     cttcgacttg aatggcgatc gaggaaatga ggaaaataaa agatccatct cggtttcatc     89820
     ctcttgggat gctctgttca tttcttgtgc cggaggcttt gtcttctctg tgatctctct     89880
     cagcgctgtg tatctcttcc tctgctttac cttggtaggt gtaaactcct tgatgtgtgg     89940
     attgtagttc tccttctcag gtaggttgtc aaaccctgca ccatctggtc tttcacatct     90000
     catgttaggg attcctccta ttgtccaata agtccatttt ggagggaaga ttccaagacc     90060
     ttgcaaaata acagcattca aagccctaag aagagtacag aatttattgt tacacatccg     90120
     gaatgccctt gtccctcttt accttcagta cattccgctc tttccctgcg gggtaaaaca     90180
     actcctttag cccagatccg aagtacctgt agtccaagac cgagtaatac agaaaaatca     90240
     ggtttataac tgcctcgaag ttattcctta tgatgaagag cctaaaatta aaaatgctca     90300
     cttacctcct cagatgccaa tccagagcgt cactgttcct atgtctcgaa acctgggatg     90360
     tacagtacga aagattcaag gctgttgcca tgattagaga catcctttgg ccctcatttt     90420
     cttcattagg cctcatgaac attaagaaaa aggtgataac ctcgagaata tggtcaagca     90480
     ccatcaagaa agcctctaaa gagtttacag tgtagtattt gatcccctcg atctgaagat     90540
     atatcccctg gatggctgct aggatcatta gaaacttcga tgcatcgtac cgggcccttg     90600
     ctttgtatgc agcttaaaat tatatgtgtc acttaccttt cagcttgctg ctaacacccc     90660
     cctgcttaaa atagtaccat tcaaacatgt ctccatattc cttgcatacg aagtacatcc     90720
     taataaactc tccaacgcat agtcctaaat acaaaaggga aaaagccaca actcccaggt     90780
     tgtgattggt aaacttgaaa acgctttcca caatcacaga tgcctccaga gaagctatga     90840
     gaatgataac ccagtatgcc ttgcactgct caaggttttt tctcgacatt gcattttcaa     90900
     gatagataaa catgtagacg tttgtaacac atatggacag acacatcgat cggattatga     90960
     ccatttgctt accgataatg tttttccggt aaaatccaat tccgatgact aatatcctca     91020
     aaagcaagta cataaacgaa accttcctcc ctttgttcaa cagttcgtcc ttccccaaca     91080
     agtccattca atgggtctgt gccatttcaa aaaaaatatc atttatcaca ggtttagatc     91140
     cactgatcta cttaaattat aaaatttcag aaggcaatct atctctaatt agttggaatt     91200
     ccctgctaat gcaattctga taaattaaat catgcctgtg ttattgatcc gatccgagat     91260
     agcatcctag aacccgttcc ttgtgaagac aatttggcca tatgctttct tctgcacagg     91320
     tataatgtcc cctcttgagc tcatcaaaag aatggaatag aatgtccttg ctcttgtcct     91380
     tctgcttgtg ccagcatact cgtcgaagtc tccattgctc agcaggatgc ttgccatgtc     91440
     ttcgctggaa gtgctgtttg aaaagtcctc tctactcgaa tgcctagacc aattacgtgc     91500
     tttttctaca gagtcaaagg aagacatccc ggcatacaac atcccagtcc cctggattgg     91560
     aggtcttatc ttcttaactt ccctggtgat aaaggcttct tcttcaaaca cccgggtttc     91620
     agccctctct tcatgcttgg atgttcttga agctcctgct ttattgatat tcagtactgt     91680
     tgtgctgtcc actacattct aaagacgctt tctggatata tgttccggcc cgtccacaac     91740
     tccaaatgtt tcgctgtagc taaacattat actatccata caatcgaccc catccagttc     91800
     ggagctacag acacttgcca catatcctgt ttcaatcgaa agcatgttct tcttttttct     91860
     ttccaccgtc cttctcctct tttttcttct atctagtatc ccagctagcg atctaatttc     91920
     aagcagctga atcctaactt tggctttata gattcttatc agcatttgaa gaaataccga     91980
     ggctcctctt aacgcataca ccggaaagat gtccaccaca gccttcacaa cccctggaat     92040
     ccagatcttt tccacagcct ttcttccaat tcggactttc ctccccctct tcccaagtat     92100
     tcggagaaag gtcaatgctt cttgattcct aaggagattt tggaaagcca taaatattca     92160
     tctcatacac catttaatta ttttaagata tatactaaat aaaaagcact gcttaacccc     92220
     cctccaggcc tcttcgactc ctatgcttgt taacaacatc caccaagtct cccggctcaa     92280
     ggggcatcaa gagagtctct gtcaccctta tccccaaaat actcatatat tcgcttttga     92340
     atccttcgtc tacaaccaaa acaataggaa catcctcgtc ctcgcttctt attcggctca     92400
     caaccttgct gcactcaggc gcatccgcat ataatacaac tacatcatac ttccatttca     92460
     tcacattctt catgtctgta ctttcttcta ctattgtcaa agagtaattg ggaatcttta     92520
     gagcactgta tatccactca gacccaggaa catccttctt gacaaacagc acatttgtct     92580
     tggaagcaat cctcatcctc tcgtgataaa tgtatttctt tatctcgttg atgtcctcga     92640
     caacagtctg aagatacttc gaaatactcc ggatggcatt cagcacatgc gactggtaga     92700
     ctatgccgct ttcaatctgc tttggattcg agcctccaga caccccgcac tcgctcggtg     92760
     ctttcttcct acggatcttg tccagaagct ccggccttcc tctttggaaa tatttgtttc     92820
     ggtattccca ttgtgccctc tccccatccc tccgtacctt gtaaaaatca tatttgttga     92880
     gctgtctaac aaaggagctc cagttcttgt gtctaaaatg cctttcgaga acaaactcag     92940
     agaatccctg aatatcagat atgacaaagc ttcttccgtc gggactccat gatatgtatg     93000
     gataattctc aggctcctcc aacatctgaa aaagcttcac tacaaactca gaccccatgg     93060
     tcaacctcat ggactccatc cgacctaagg ccttaactaa tcaataattc ccatatcaat     93120
     taagccatat taaaagataa tccccttcca tatccggaag catccaaaaa agaataaaca     93180
     tttatttcta ccccaaacac attatcccct acttttcttg aagtacagct ttccgtttct     93240
     tatatcaaca tcgtttcctt tctgtggcct gagccctatt ttcagtctaa atatggtgtt     93300
     tctcttactc agctgttgtc tgtatctttt ctgagctctt tgttttcttc cgtccccata     93360
     gacagaattt atgtatcttt gctgataata caaaagcagc tcgcaaacca gtgtatcctc     93420
     agttgctagg ggcctgttct caagaactgt tatctccttg agtagtccca tcatctcgtc     93480
     tatctccatc gagattccat ccacctcttt gctattcata aacagcatgt cttcatacag     93540
     gtcaaaccca aatatatgat atggaagaag acactcgtaa gcatggttga gattcatgaa     93600
     tctcctcaga tcaggcctcc caatctggaa cagatccttc tgcaggaacc caagaacctt     93660
     ctgtctccgt gcctgtgcct gttcatacag attgccgtac aagtgtccat atcctccccc     93720
     gtcaatcccc cgtgtctttc ggtaaggccc acgaactcct tttgtccttt ccatactctg     93780
     gccctcaagg gacttcttca ctggcgagga ccctttgctc tccaatccaa ccaattcccc     93840
     cttttccagg gccccgcctc cattcaaccc tcccattcca caatcagccc cttcaggctt     93900
     atccgacggc ctctccattt ttaggcccaa aaaatttcaa gaatttacac caaatggctc     93960
     atcctcggaa acatgtatct ccacatgaag ctaagatgcg gcaagatctc aacaggaaac     94020
     actgcaatga tgtgcgataa atgctcggga aaatgctatg catgcggcct ggacaccaga     94080
     gagtccgtgg aaaaggtcta catttgcacc ccgtgcttcc attccacgta caaagacaga     94140
     tgcatcgttt gcaagcttaa ggacccgaga aacaatgcat actattgcag ggaatgcaag     94200
     ctccagaaaa accacgacag atgccctgtc ctcgcccaat aaatcataga catgtttaat     94260
     aaagtaggtg tgtatctcat cccccaccac tatttgttgg ccacttgttg ggactgttgt     94320
     ttgaaacatt cttcacatga ggaaatagtt gctccacgtc aatctcgtgc ccactagaga     94380
     agtatttctc aagagccctg tggtcctgca tcttcacctt gaagtttatt gccgggtctt     94440
     tcgcaaagtc cggaacaaca aagtctgggt ccaagatggc atcattttcg tctacttgcg     94500
     gtatctttgt ctttggcctg taaatatgct gtgggaccct tcctgtcgat ctgaggagtt     94560
     gataatcaat ggcttgtttg tagagattcc ctccgttgaa cctcttgcct gtctctgtct     94620
     cttttcctct cactccaaga gaatccaaat ctgcttggtg cagaggcatc atctcaggct     94680
     tgcttatctc cttctctagt aagctttcct gccctttctt gccatactca gattcatttg     94740
     ccttctccat acatcttttc ttcagctgtt gcaaggctgc attcaatttg gaatttgcat     94800
     taaggttcct gatgcccttt gctgcagttc aagtagtctc cttccaatcc cattttccaa     94860
     ttctgcatca ttgcattgtg cttcccccat ctctcttttc ttcaataagc tgggaaaatc     94920
     cccgattaca gaaggcttct tgagtcttgt tcccttgtag atctctctag aatccatgtc     94980
     tattatccga ggactttctc tcatggaaat ctccttgtag ccacccttgc atccttggct     95040
     tactttctta caagaaaccg aaggatgtcc attcattcca ttcctttcac tctcctcaga     95100
     ggtccttttg cccaggcctc catccttgct ctttatgact ggaatgtgcc ctggaatcag     95160
     gctttcctga tcaaatgcac ttccatcaaa gtctccatca tacaaaaatt cctcattctc     95220
     cttgtccctc tcataaccat ctcttccctt tcccccattc gatatattct tcaaatcctt     95280
     catctcgtat ccactctcca cattcatttt ctcacacatc acacggtcct tcacacctgc     95340
     aattgcattt ttccattcct caagaaattc cttcagaaac tccataaggg attaaaaacc     95400
     cttggttaca tacacacact catacagtct tgtccaaaaa atcaaaattc atcatcctcc     95460
     atcctgcttc aagcttgctt ccaacatcca ctctgttcct gactctaggc cagtaacttc     95520
     ctcctcgagg atcaaaaaac tcaaccatcc tcacgagctc tccatcaacc cctccgccca     95580
     cgcaatagta caagatgtaa ttgtctccgt tgtcctggtc tttcattatc ttttctctat     95640
     aatactcctt catcctccct acacagtcta ggcacatccc gccaatgtta cactccttga     95700
     tccttgctct cctgtatgca tagaacccag aatacttgct ttcctcagat atttccttgt     95760
     tctcataata ctttatctcc gactcaatca gttccgatct cacatgcctc cgggagttgt     95820
     agagaacaga cagcgatatc tttcccagct tcctgaatat tacaaatctc tcaaaccaca     95880
     tccattcctc agacataaat ctctttgcaa gcttgtcact catctccaag gcctttttca     95940
     tgtcctttct cttcagatac ctcagatacc caattccaac cttgaagttc tcgggatatc     96000
     gagacatgca ttcttcgtat attccactgg catctatccc tcttctctct ccaagctctg     96060
     catatagaag ccagtgctta taatcaaaca gatcctttcc taactcctca aaagcccttt     96120
     ccaggcttat ttgagacagg attacatatt ttcttattgt cctcatcttt ccaggaatca     96180
     cagaatagct gctgtggaag tctcctccca tgtaatacat cttcgatcta gcaaggataa     96240
     atgttttctt ctctctcccg tactgtctca ttccgctcct tagaatcttc tcggccctcc     96300
     ggaaatatcc aatctccttg ctccccacaa acagcttcca ccactccttg gccttcatca     96360
     aatcaacaaa atacctacga ggctccatca caaaaaatct ctcaatgaac tcggagtcca     96420
     gaaaatactc ctttgcaaca ttatagcagg aaataaacgt ctcgtcgtca tggagcccat     96480
     gcttgctcat cgagacaaac agagaccaga ggtcagaagg aagagctgac atcggctcag     96540
     gtctctcccc ttgcaggtag aggagaaggg tatctttgga gaggatgggg gacggaagct     96600
     cgaccctccg ctttcctctt cgaagaatcc gaagagttcc ttccagtcca agtctgagaa     96660
     gatcttcaac caccatcgag ttgtctccat cttccaccag acagctcaga agatgctccg     96720
     agtagattcc tttgtcccta aggactctgt acagagactc cacaagccca tggttgggtt     96780
     ttgtgccaat aaacagatct acaagtctct cctcatgagt ctcaaccaca ctttcatata     96840
     ggaacatctg tttctccaaa atatcttcca gattctcgct catcattttt cggagaccaa     96900
     aactcctggg atgtcttgag accccagccc tcaggatctt gatgtctctg tcttttcgaa     96960
     acagatcttc ataaaagcct tcatctccgt ctacaacctc caatgcctcg tcaagcatgt     97020
     cggatgcata gtatctacta ataatctctc tccacagtct ctcgtccttg atgtctcggc     97080
     cctcgagcaa tatctttgaa ccctcgtttc tcccaacaag tctactgagt ctgattctcg     97140
     catccacatt caaacggttc ttcttcaata agttccttag gacgtgggtc ttccattcgt     97200
     tattttcctg gtcctgctct ccatccatct ccacttcctc tattcctttc caagaaggaa     97260
     tgtgtctgga agtggcttcc tctatatcca tctttccaag agcctccacc tcctctctgg     97320
     aaagtatcct ttgctttgga tcctttattt tcctctttct tttttcttct attgctgtgt     97380
     agatctcgtc ctcctctccg tcatatctag atgcagtgtt ctgttcaaac agactcctta     97440
     tgtcaaagag ctttcttcct tttcccatag gcacagcaca aagaacacaa aaataaatcc     97500
     gatgtggggc attaaaactt tagagatggg cgaggagaaa gacacaaaga agaagagggt     97560
     ttcgtttgca cctgagcctc aggtgatgta tatatatcct gaagaggaga acaaaagcaa     97620
     caaggctgta gactctggaa tgatgagcga ggatgagata tctgtggagc tgacggtaga     97680
     tcatcttcga gggaggaaga cagaagacgg aggagatgga gaatttttga atgcagagct     97740
     gaaggatttg atggaggata gtgaggttgg gtatggagcc atgggtgaca acagtggaaa     97800
     agaagatgag gtggaaaaag agaagtgcaa ggagaactat ggggtggagg aaggagagat     97860
     taaagaagtc aaggatgatg aagagtgtaa ggaaggaggg gctgagaaca gcgagacagg     97920
     gtggagagaa gggccctgta ggaatgaaca ggaggaattt gaagatactc tgatgagcaa     97980
     tgagacagtg aatgtagaag agatcatcaa cacccaagat cttcggaaga taattccaca     98040
     agtgaggaaa gagatggtga atgtttctga gctactggtt tccaaaggaa tcagatttct     98100
     ggacagtctt gttgtgtcga atacaagaag ggatacaatg tcgaagtcgc ggaacgaggt     98160
     acatcctcgg caggaaaggt tctacgagag tttcctggag cctcggacac ggttcttctt     98220
     ggagttcagt tctgatcttg aggataggat gttgcggcag gagaaggtga acgaggagct     98280
     ggaaagagaa ttcaggattg cagggactgt ttttgagagc ccggatgcct caagccttct     98340
     gagagctttg aagacggaat gccggatgaa gtctaagatt gagtggtatg agcttcgtaa     98400
     agagaaggaa gttgagttca atagagaggt aactgataga aggaatcggc ttgctgaaga     98460
     gtataatcat cttggaggat gtctgaagga aacctctgag aaggttgaag agagtaaaag     98520
     aaggaatgaa gagatggagg agcagatacg cagaataaag aataggcttg ggatggatgg     98580
     ggatgggagg caccagaaga tctctgagct gagagcattg atgagtaagc aggagggaac     98640
     gattgagagt ggaaggaagg aagtgaagag acttgaggaa gagagaacaa ggaagcaagc     98700
     cgagagacgt gtgctgaaag aagcattgga gaagatggag atggaaatta gagaccttga     98760
     ggaagtgtta aaaacccaaa acataaccga gggtgatgtg aaggaaataa gacaggagtt     98820
     ccggacattg tgtgcagcct ttggaatgga actaatgaaa gtagatacaa gcgaggttag     98880
     gctccgaata ctggaataca acctcaagat aaatctaggg gctggcttcg tgattgaatc     98940
     gattgaagcc actcctctgt gcgatagaaa agacctgggg catctctacc accacttcgg     99000
     aaaatacttt gaaggaaagg gatgcagctt cttcaaggga attagagacg ccatgtttat     99060
     gtcggcgatg gtgtcagggc tatgtaaaga gttgtctgga attaagaaaa gacactctgt     99120
     agaatgcagc ggggaagaca acgaagccat tgttaggatc ttagcattgg atgtggaaaa     99180
     gtgcaccaag catgagattt ccatcaagat aaaaaatgga tttgaatgct tgatccaatg     99240
     gaaagacaga agccagatgt gggatcttaa gaaggatgta ggtataatat ccagatcggt     99300
     cgaagaagca cttgcaaatc gctgacggcc attggagtct ttgataaatt gttaatcccg     99360
     ggacaggagt ccgagtaata aacaattagt ttattgatag atcacatttg ttataatttg     99420
     tccttctctt cttcggagtc ctggggcttt gaattccccg ggagtgcata gtactcttgc     99480
     agagaccggt tgaagtcttc aagacatctt atcagtacgt cttcctccat gttctcaacc     99540
     tgcattccct cgtacaaaga aacagccttt tcataaacaa gtctctgatg ctggatggac     99600
     ttggatagaa gctccaggtc ctccttagga catgtctccg agatatcccc aacaaccctg     99660
     tctaagatgg ttctaagaac agacaagctt tcgagatgct ctccttttct tatggctttc     99720
     tctagcttta agtagttctc cctgtccata ggaagggcca cgaatctaaa catttgattc     99780
     caggaagcct agattaagaa ttagattttg aaagctccca gaaatatctt aatatatagt     99840
     ccagtgatat aattctcaat tgatatctat ttaattaaag gataaaaagc cagagcatcc     99900
     aaactctctt aatggagaag aatcaggccg agccagaaaa gaacataagt tacacaaaac     99960
     ttgcattttt ctttttcgta ataagaacag tagtaatagg tctggcctta ctatcgggac    100020
     catactttgc actagatgac gaaacaacaa cattcaagat gtttataatt ttcttggaca    100080
     taacaaacat attacagttt atatttcaat gggacataat tcagcgtaag attctatttc    100140
     aatatcttct atatattcct gtccttgctt actctctgac tcttacaatc acgttaatag    100200
     ttgatgcaca caatactaac agttgtaact tcaaagtaga aggtaaaatt aagaaattag    100260
     ctattggata tatctataca tatatgggaa ttcttcttgg ggaagttgct ctccttccaa    100320
     tcatatacag aagactcaag agtgacttta tgtgggcaaa cttcaaaaag ctaggagcta    100380
     acacagctat taatggtaag tggagataag taattttaga tgccttcggg aggagagaac    100440
     agtttagtgc aataagaaga tttatgttga tttttctgtg tggagaagtt gcaagtttca    100500
     atataagcat aagagataac aaagatgtct tcttttttgt agcagggaca cagatatttg    100560
     tgattttcct ttcttttata tttttcaacg aagaatatgt acatcagaga aggtttcttc    100620
     tgggattttc cggactgtgt acattaggag gaatagcata cactgtgatt tatattgtta    100680
     tggctagtag gagtagcgaa ataagaaagt aagtgaagat gttaatttta gaggagttat    100740
     ttccgaaatt gtattctata caattacaat gcttattttc tttgttggag cctttaggga    100800
     ttatcagaca tttgggaagg gactaaaaga ttattatagt ggaagtcttg gaataagaaa    100860
     aaaactcaca ccttaggcag agcagaatac ttttccacga gacaataaaa accaaagact    100920
     ttatttctct tggggactcc ccgcatacac cgtcatccgg ctgttcccca acaccttctc    100980
     aatcaccccc tcagacgcta ggtgccgcaa cacattctcc gcaaccccga ggttcagatt    101040
     gtacttgctc ccaacaccat accgcgtcac aacactcgct cggcacacat ccttgcgcac    101100
     cttcgacagg agctcctcgg tcaccgtcac tcccctgcgc acttcctcct tcttctttcc    101160
     gtcgctccac ttcttcttgt ccttccttgt tccagacatg gccttgagtg ccttcttctc    101220
     cttcgactcc tggatcttct tggccatttg tgggagtcca attttcccac ttcaaatccc    101280
     atcccagaaa ctcccaaaga agcccatagc ctccgaatgc caggagtgga tttctggatt    101340
     ggaaaaattt gccctcaatc taaagatggc aaagatgcat tctagcggaa gaggacgctc    101400
     ggggagcgtt aagccgtatg caacagtgtt tccaacatgg ctgacaaaga cggctgatga    101460
     aattaaggcc gatgttatcc agatgggaaa caaggggatt cctgcacctg atatagggaa    101520
     aaagctaaga gacgaatatg gagtcggaaa tgccaaggac gtcctggggt gtgaaatcac    101580
     aaagttcctt gaagagaatg gggcatctcc aaagatccca tttgatcttg agtctctggt    101640
     tcgccgagcg aacaccctcc gaagtcactt gaacatctat aggaaagaca actctgcaaa    101700
     atacagactt atccttgttt catcccggat gtatcgtgtt gcaaggtact acaagcgcaa    101760
     gatgaggatt ccagggaact ggaagccaaa gcttgttgag ctcattaaat gatcttcttg    101820
     aagtctcgaa ctggctgttt caaggccacc tctgtgtgtt tttgacgtct ttccaacagg    101880
     cgattttatt tgcgaagaga ggtatatttt gtgaaaaaca aaccccgtga atgtatgagg    101940
     agctcttgaa ctttctgctg gcgaggaaga agaggctgct gtctgaggaa gaggccgata    102000
     gacttatgga gcttattacc cagtcgatgg aagccagaga gggccgggaa gggaaagagg    102060
     acaatacagc attgataagg aagatcctcg aaaatgtgga tatggaccaa gcttacgaaa    102120
     cagacactga gagcatggaa aatgctatgg aagatttgct ttttgatggc tacagcagcg    102180
     aaatttacag caacgatact atagacttga gcgagtctga caacgacaca gagcctctgt    102240
     ctgagcggaa gttccagaga ggagagttta gagctggagt gaaggcttct gagaatgaag    102300
     aggagccgaa gaggaggatt gggctcaaag acaaagcaaa agaaggggaa tggaaggatc    102360
     tgtcgggagg gaaggataac gatctccaac caccaaagga tagcacagga gttctgtcgg    102420
     aggatgggga aggccccaag agaagggaat tcaagctccc tggatttagt aaggagaaga    102480
     aggagagatc atttgagatg agggatggcg gggactttaa cttgccaggg tctgtggaat    102540
     ttgagtttga tctcggagaa ctaaagaagg tgaataatac cgggccgaat gtgaagtttt    102600
     tcgacgagga tggagaagag atctgaaagt ctttggtttt gaatgtagag taatagtgac    102660
     tgttttatgg atgaattatc tttattaaag tagcaagttc tctcaatgat tgtgtttttt    102720
     cttttgggag tttctgggat gggatttgaa gtgggaaaat tggactccca caaatggcca    102780
     agaagatcca ggagtcgaag gagaagaagg cactcaaggc catgtctgga acaaggaagg    102840
     acaagaagaa gtggagcgac ggaaagaaga aggaggaagt gcgcagggga gtgacggtga    102900
     ccgaggagct cctgtcgaag gtgcgcaagg atgtgtgccg agcgagtgtt gtgacgcggt    102960
     atggtgttgg gagcaagtac aatctgaacc tcggggttgc ggagaatgtg ttgcggcacc    103020
     tagcgtctga gggggtgatt gagaaggtgt tggggaacag ccggatgacg gtgtatgcgg    103080
     ggagtcccca agagaaataa agtctttggt ttttattgtc tcgtggcagc attggaactt    103140
     ttctgttgag tggctgttat cttaaaatat cgcattaaaa atttacccca caatgacata    103200
     cagagggtat agtggagata gaagagggtt tcggacgtcg cccagatttg acagaggggg    103260
     cagatatcct cctcgggaaa gacgtgaggg acagagatac gatcctcttc cagagcttcc    103320
     tcctgtggag tttcagaaga acttctacaa ggaggcggag tctatcagta gaatgagttc    103380
     gcgcgatgtc gattcgttca ggaagacaaa cgagatgacg gtcaagggga tggatattcc    103440
     acatccgatc agccggtttg aggaggcagg gtttccctct aggattgtgg aggagcttga    103500
     aggaaaggga ttcagtgggc ccacgcctat ccaagcacaa ggatggccga tggcattaag    103560
     cggaagggat atggtaggga ttgcacagac tggatctgga aagacactga gttttattct    103620
     tcctgggctt gtgcatgcaa aggatcagca gcctctgcga agaggggacg ggcctattgc    103680
     gcttgtgctt gcgccgactc gggagcttgt gatgcaaatc aagaaagttg ccgacgagtt    103740
     ctgtgggatg tttggactaa ggagtacagc ggtttatgga ggagcttcat cgcagccaca    103800
     aataaaggct ttgcatgagg gggtagaaat agttattgca actcctggaa ggttgattga    103860
     cctgcatgag caagggcatg caccgcttag cagagtgaca ttccttgttc ttgacgaggc    103920
     cgacaggatg cttgacatgg ggtttgagcc gcagctccga aagattattc caaagacaaa    103980
     tggaaacaga cagacattaa tgtggagtgc aacatggccg agagaggtgc gaggactggc    104040
     agaaagctac atgaatgatt acattcaagt ggttgttgga aatgaagagc ttaagacaaa    104100
     cagcaagatc aagcaagtga ttgaagtctg tagtggacgt gagaaggagg acaagctgct    104160
     tggagttctt gacaaattca agggagacaa ggtcattgtg ttctgcaaca tgaaaagaac    104220
     atgcgacgat ttggagtatg ttctgaatag atctgggtat ggggctgcag cattgcatgg    104280
     agacaaatcg cagaacattc gagataaagt tcttgatgac ttccgatcag ggaggaggcc    104340
     gattctaatt gccacagagg ttgcaggaag aggacttgat gtaaatgacg tcaagcttgt    104400
     gatcaacttc gacttcccag ggacatgcga ggactatgtg catcgaattg gaaggacggc    104460
     aagaggcaac acaaaggagg ggatatcgca tacattcttt acaatcaacg acaaaggaaa    104520
     tgcacgggag ctgatccgga tgctaagaga agccaatcag acggttcctt ctgatctcga    104580
     ggacatggtg agagtgtcga acgatagata tggatccagg ggtgtcaaac acgactacag    104640
     aggaagacct gggagatttc cttatcgagg atgatctcca gattggacaa ctcaaaaaca    104700
     aaagatactg aatgaaccag gggatccttg gctctcggaa gttaccttct actttggaga    104760
     gaagccagat aaaattcatc aaataaaatt ttgtttaata taatcttcag ggcttagcat    104820
     aggtccttga ccatgtacgg gccctccagg acatacccaa acttggagta gtagttcctg    104880
     gtccctactc ccgagataat tgcgatcttg cttgatccat gctcgtccct tgcaatcctc    104940
     tcggcttcgg ctatcaggag tgtgccatat ccccggtgct ggtactttct ttcatcgctc    105000
     ttgtttatgg ccaccgcact cccgtacacg tggagttctc ttatcatgga tgcatttcca    105060
     ttaaccacag caggatggta tttccctccc cgaggacttt ctccacctgt ttccgaaggt    105120
     ggatctaggc ccttcaactc ctttcgaaac gtgtccacac tgcatttgcg cagcctcaaa    105180
     agccctatca aaatatcctg cttcacatct tcatagctaa ggaatgtctc ccaacccttg    105240
     ttggccacat aatctctcct cacaagttct acttcttctg gtaagacact ttcatgaata    105300
     ttcttgattc caacctctct agtccttaca tctctgcacc ttgttctgta gtccttcatt    105360
     ctggcaagtg cgagttctct tatgttgccg tgttccaccc cagagcttac caatgtcatc    105420
     ggaatgtctc tttgcactct gtagactctc atccatggag gtacaaatga aagaatcctt    105480
     gctaggagat caatcagctc gtcgggggaa tagttcttat atttgttgtt cttccacaac    105540
     tcaaaaagtc ctgtcccctt aattacgaga gtaggatata tcttcagccc gtcactccgg    105600
     aacctagggt tatcgaagta ttctcggaac tgtgcaagat ccctcttcat aggaacattt    105660
     ggaaggttag gcatcatatg tgcaactatc ttgaacccgg catccttaga aagcccaaag    105720
     gattcacaca cacttccaac cgtgtgtcct ctgttggtat ccagggcaac atcttcatac    105780
     acgctttgaa cacctatctc aatcctcgtg catccatagc ttagcatctt actgaggtgt    105840
     ggacgcacac agaaatccgg tcttgtctct attgttatcc caacacattt caaccgtcct    105900
     tctgctccaa ccctcactgc ctcttctacc gaggcagatg tatgcccgct cagggcatca    105960
     tgcagccttg agataaagtg gtctctatag gattcgggca gggacataaa cgttcccccc    106020
     attattatgt actcgacttt gtccacatta tgcccaaggc ttttgagttg cttgagtctt    106080
     tctcgtgctt gctcaaatgg atcatatcta cttcttatgg ctctcatgct tgtcggctca    106140
     tatcccgtgt acgattgtgt agaatattca aagtcggagt cggggcctcc agggcagtat    106200
     acacatatgt tccccgttag tgctatgtgg gggcatctgt ggggcttgca catcactgca    106260
     acaacagcaa ccccagatgc agtcctaacc ggcttcaccc taagctgctg aatcagatgc    106320
     ccatactcgg gtggaataaa cgagattatg tccaccacac gcggagtagc cccgaggttg    106380
     tacttcttgc acaccctgga cttgattgca ttcacatcta tcttcttctc ttgcttgtag    106440
     agtctaatga tctcgccaga aatttcgtta catgccttga ggaagtcgga cattcttggg    106500
     gaggatggag tctggaatta attccttaga aagaggagtt gggcttccat gtgagcaatg    106560
     ggcaatgctg gctggaagtg cactttggga tattttgtat tcgattttga gccccgaaga    106620
     tgcaggcttc tctgtaccta aacacatcaa cacggatgag gaaagacgag ataatgcaga    106680
     agctggggtc gaacaacgag gaggacaagg ctgaaggaat gaaacagata atagcacaga    106740
     tgagccaggg agaggacttt ggctctctta cacacaaagt aacaaaggag accttagtgg    106800
     tgaagagcaa cgagcttaag aggctattct attactatct agagctactt ccgaaatcca    106860
     gaggatctca gtcgtttgag gagatacttc ttctgtctaa tcaagttcga aaggatcttg    106920
     agcatccaaa tgagtatgtc cgagggtttg taatgagatt tgtcagtact ctggacgacc    106980
     aggaacttgt agggaacttc tacaagttga tcaaagacaa cctcaaccat ccgaacgcat    107040
     atgttcgaag aaatgcatac ttctgtcttg gagagatctt cctgaagatg gacacataca    107100
     aggaaattcc agaccttctg taccatgcac tgctcagaga cctggatcca aactgtttgc    107160
     gggaggcctt tgtctctctg caccagacgg atccagactt ggcattgaag tatgctaacg    107220
     aggtggactt gtcgatacca agcgagcttt ccacggccat catagagaag actagcgacc    107280
     caggccttct ggagaggttc cttttttccg gggatttcca aacggcgctt gaagcgggga    107340
     tatcgattca caggattagt agcgacgaag agttgttgaa gagaagtaca gacaccatac    107400
     tgaggtgtct tgcagatctt cccgaattca gagaatatgc tgttgacgag cttctgctct    107460
     ccacatactc gttttcagga tatgcaatga gcttcttgga acttatagac ccgtacgact    107520
     tgagtctttg ttcaaagtgc ctggaccttg ctttcaagat tgcagagacc cacgagtttc    107580
     tgcgaatctc cgagttcctg ggatcgaagt tcattgatac tcatgatgca tcatcgcaga    107640
     accagaactt caaggtgctt ctcctgaaga agatggcata ctttgctgat gtctattcat    107700
     cctacagcga agagatgatt tctgagtcat tgaaaaacat tgtgtcggac aatccggaga    107760
     tgagctatgg atccttggta tttctctcct cttgcttcga ggtcatgagg aagaatacta    107820
     tgcctgggca gagagaaaca ataggatata tcggccatct gaagacattg gtgaataaga    107880
     taaacgcggt gaagtatggg aagatattga ggtgctgttt tgaggttctt aggaaatatg    107940
     ccacaaagga gatcttcctc agtactgttg agatgctgga ctgttcgttt gagctttcca    108000
     gcaagccttt gtatttagaa aacacacaga cgtttttggg agcatttatg tgcattgaat    108060
     tggctaagat gtgcaagaca tttggagaag accaaaagga cagggttatt gggatcatgc    108120
     taaagtttgt tgaatacggg aaggaaagca agactatcga tgtgagttcc cattcgacaa    108180
     taatatcatg tattagatct ctgatgtctt gtgatgagga ggtggggatt gagtttgata    108240
     ggcaagtacg gtgcagggag aatgttctgg accctattgt acttcctggg gtgcgacccg    108300
     gtgatgaaag gaatcaaaat aagctttgcg agtttctgag aaaggatgaa ggcgggagcg    108360
     gagaaatgag gaatgtaacc cagctgacag ggctgtcgga tcccatctat gttgaggcca    108420
     ctacaagtta cacccggcac gaggttgtga tggatatgct tcttatcaac cagacctcgt    108480
     cctatcttca aaacatacta ctggactttg tgaccagcca gggatttaat gcaacattca    108540
     tcaacacgcc gttttcgttg tccagtaggt cagtggtgac caagagattt acattcagaa    108600
     tcatcgaagg atcgaatggg tttataagtg gatccataac cttcaggtat cctgacgaat    108660
     gtggagagta tgccaacacg gtgtatacaa tcaatttggc ggaggtaaga acggcagtgt    108720
     cggagtttct cgagccaaag aagatggact ctgacgaatt ccgagagacg tggaaggagc    108780
     ttgagtggga aaacacatac acactcaagt ttgttaccag aagaaccttg gaagagatat    108840
     ttgaggaggt gagcaaggtc ctgaacgggg agatactgga catcgagtac gacgagagct    108900
     atgctgttgg gaacatagct tgtatgactc tccagaacgt atgtgtgctg atcaatgtat    108960
     gtcttagaaa aggggagtat gtgcactttg aatctaggat ccgtagcaga agggagggga    109020
     tagtaaagtc tgtaagcgca gtggttgggg atgtcctgaa gtcgcttaag aataaatgat    109080
     ctttggtaaa gcggatttct ttgaaaattt ttgatccctg aaaatgtcat cggccgagct    109140
     ggaggttttg gaatatctga acgggcacaa ggacgaggtc aagggcctga aggttgtgcg    109200
     agtatctgga aaggagatcc tgtactcctc atcgaaggac aagaaggttt tcagctggga    109260
     tctgcacagc aagattgact ctgagtttgg caagatactt aagttatatg aaggggggca    109320
     tagcaagaga attaacggga ttgatgtgtc taaggacgga agcatgatgg tgactgttgg    109380
     atctgacggg atagggagga tctgggacac agaggccaaa aaatcaaagc cccttgaggg    109440
     gcatagtaga gatgttctgt gtgtgagcat caacagcaac gatacaaaga tagtcagtgg    109500
     gtctgttgac aggacgatga acctctataa cacaagaggg gagctgattg caaagattgg    109560
     gaaggagacg gaaaagatgc atcgaggatg gatcaactgt gttgcgttcc acccgattga    109620
     ggagaacatt ctcgcaagcg gatccacaga tgggactgtg aagatctggg acttggatgc    109680
     tccggagcac atgcagacat atcttggagg gatgtatgtt gactatgaga aggcaaagga    109740
     gaagaaggtt tcccctgcag actacgacga gtcgaagagt gtcactgcaa tggcattttc    109800
     gaaggacggg tcgattctga catatggaga gaagagtggg aaggtatatc ttgtgaagct    109860
     agactccaag gagtgcatac agagtcttga cacgctcatt cctgttaggt cgattgcagt    109920
     tggagagact gagcctgtga ttgcattagg gacagatgag tccgtaatta tttgggagac    109980
     aatcagctca aggattattg caaattataa ccttaaggaa attggaaacg gagttcgatg    110040
     cctatcccta gcgttttctg gcaacactct ttattgcgga ttgtcttctg ggacaattgt    110100
     cccattggag cttagaaaat cggattaaac tggttctttg gttttctttt tagtttcctt    110160
     tctgcctccc tgggatggac aggatcgagc tatacgaatc ccagaagtta tttatagaag    110220
     atgcgaggag ggtgattgat ggcggatctg ttggaatatt ctcgagtcct accggaacgg    110280
     gcaaaacgat ctctcttctc agcgcagtgg cagattatat ggacatagag gagacagaga    110340
     tggattgtag aaacagaatg ctggagaaga tacttttcca ggggtccagg aaagcagtgt    110400
     tctattgcac aagaacacat actcagctgg cacaagctat taatgaactc aagaagctag    110460
     gtgtaagatg caattcggtt gtactaggat ccagaaagat ctactgcctg aatgaagaga    110520
     ttcggaagta taagagctcc gatgaaatga acgaagcgtg caaggaggca gtcaaggagg    110580
     gaaagtgcat gctccatgac ggatgcgaag agtttgatgg atatggggtg attgatgtgg    110640
     aggatctact tgctacaggg gggagagaga ggttctgtcc gtactatact gccagaagct    110700
     actcgcagca atgcgacatt gtatttcttc cctatcagtt gttattcacc agagagggaa    110760
     ggaaaagtgc agatattgat gtgaaaggaa gtattgtggt tgtggatgaa gcacataaca    110820
     tttatgattc tgtgatacag atgaacacag caagtatatc gtttggaaca gtagatagat    110880
     atgtcaaagc gatggaactc tacaagaaaa gatatggggg gaggatgaaa agggatgggc    110940
     agtttgagag ggttatggag gtactcaaga agatagggag cttcaggtgt gtacactgca    111000
     gagacatgga gggagatgaa ggagtgatgg gtgtttcgga gtttctgctc ggggctggta    111060
     ttgaggactt caacatgctt gagatcgagg actacatagc cgttagcggg atttcaagga    111120
     agctggaggg gtttgagaag gacctgaata tgaaacttcc tgagatatcg aagtttctgt    111180
     ctcttctaac aatgagtgac aaaagcggga ggatccttta cagttcaaag ggaatcaaat    111240
     ttacacctct agatgcatcc atgtactttg aagatgtgct cgaatgcagg tcgttgctac    111300
     tggctggagg gacgatggaa cctattgacc agcttgtctc tgcacttaga aagagaagcc    111360
     ccaaatactt ttcatatgga agtgtctgca aggacttctt gccgattgtg attcggtcag    111420
     ggccgtctgg aaaagagatt gtagtgaact atgaaacaag ggagagtcca atgtctatca    111480
     aggacgtagc ttcatccata ctcaacctat cgaatgcagt cagaagtgga gggatggtat    111540
     gtttcctgcc ctcaaaagca tatctcaaaa tacttaagga ggcatgtgga gatacgatag    111600
     gatcgaagaa agctctctac gaagactcgg taacctttga ggaatacgtg caggaggtta    111660
     gaagaagccc ttgtattctc tttgctgtga tggggggaag ccttagcgaa ggagtaaact    111720
     tcaacgatag tctctgcaga ctacttgtgg ttgttggagt tccctatcca agccaagatc    111780
     tagaacttaa agaaagagcc aaattcaacg ggagtggata cactacagcc atagcaatga    111840
     aaacggtgaa tcaagctctg gggagggcgc tgagacacag agacgactat gccgtacttg    111900
     tgctactgga caagagatac gtccagctct caagactcac tagcccatgg ataagggaaa    111960
     agataattca ctgcaacttt ggagatggac ttttcaagac taataagttc ctgaataaag    112020
     atagatgcct ctaagtgctt tatttgaacg gataacccta ctcaaaaaac ccatccatct    112080
     tcttaacaag cttcattgtg atccggggcc ctatttcatt gaacccaacc tttatgtctt    112140
     cctcctcttt tgtgagaatg gcataatgcc ttatgtgaat aagatctcca tcgaagtaga    112200
     agtgcaggct tctcttgaat gcttcgggct gggacgacag agatagaaac aagcctttga    112260
     ggtcgctttc tcctgtgaac gtaatgcaag gatcgctctt gtaatactct tcttccaccc    112320
     taacgtattt cgggttgtag tcgactacgt tgaatacata tgtaggaccc tttggccgga    112380
     ctccgatctt gatgtctctt gcatccacca gaatgaagtg agatagctcc aatgcatcgg    112440
     caacatctag ataagacttc actgttgtgt ttctgtctct aagtttggca gtgacattag    112500
     gctccagcat cctacgtatg tgcatgcaga tttgtttcga cctctttgtg ggcttcttca    112560
     cagttatcac caacttgttc aggaacccca tgaggggtct ccaaaccccg cctttgtttc    112620
     gtttgcaatg gagttagata tttggaattg tggaaacatc catcatatcg tccccactcc    112680
     tgtgttcaag atttaagaaa cccgacgcaa catgcttctt tatgccttcc atcttctgga    112740
     tagactcaca gatgccgttc cccggggtaa ccaggaactt aatcgagtag tagcatagcc    112800
     ccacgaagaa ggccgtttct gcaagcgagt tggtaggaat tcccaagcca tattctacag    112860
     gaaaaaacat ccttgccatt ctaaatgctc cggaagccat gtccgcacac aaatatgcca    112920
     taatgccaac aatcttgggg ctgacccttc caagaacctc ttcgatctca aacttggtga    112980
     tgatctgtgt gtatgagagg acatcatgca tcttccatat tttttgaagc aatgcaaagt    113040
     acagtaaaag cagcagggaa ttctctgcta tgtttagaac ttctaccaaa taacctccaa    113100
     gatcatatcc attggaaacg tggaagataa acggatacaa aaaacttcca aagagtgaat    113160
     agtaccttac aaatgcaatt gaaacctttt cgtcgacacc cagcacccgg aatctcctcg    113220
     atgacaccag aggaatgaca agggcagttg cataaaacat aaagcttttt tgaatgtttc    113280
     tggtacacag ctcaagcatc ttcaaggaat ggctgtccat gcggatcacc ttgagaaagt    113340
     tgggaggact tccctcgagg tagttctgtg tgcaaaggaa gtaataaatg cttgtaagca    113400
     caagaaccag aagaaggaac atgagtccct ttgctcttgt ggactggatt tcctctatgt    113460
     actttgtgcc agagacctcc ggactgctat tcgctctcaa cacaatgaga tttacggcag    113520
     tggctccaag aacaagcact gctgcaaaaa gcagaagtgg tgcgatggca gagtccattt    113580
     ttgtttatct tggagaaagg gaattgtggt aactgtaaat ggctcaaaca gattttgaaa    113640
     cagatcaagg gagacaagta caaagagaag aataatcaaa acacttaatt aacattcttc    113700
     tggcaactcg aaagtgtatt caaattattt ttcttctagt gccctggaaa tggttatcca    113760
     gctaatttat ctaggcgtgt catacatgat gttgaagata ctcccgacca tataccagta    113820
     catatactcg aagtgtagaa accatcaagt gtgggaagga ttgaagaaga agtatgttct    113880
     catcaatgga gcaacaggaa aggttggaat ggggctggcc aggaagtttg cagaaaaagg    113940
     aatgaagatt ctccttgttg gaagaagcga gtcccggctc acaagactcc atgcaaagat    114000
     agggaggatg accgagtgcc acatgcacat tgtggactac aaaagaaacc ccaacctgtc    114060
     gttcatagaa agatatgaca taggaattct gatcaactgt gtaagtgcaa tagaggacag    114120
     cccagcatac tttgtggagc aaactgtaga agacatcatg aatgctaacc ttgttggggt    114180
     gatgtctctg acaagacatg tgcttgtcaa catgatggac agcggatatg ggtatgtcat    114240
     caacatcgga tctttgatgg cagaagcatc gacacctctg tattctgcat ttggatgctc    114300
     gaaacaggcc ctaaagactt tgtcggactc tctctattat gagttgtctg gatataacat    114360
     aaacatagag tatatgggag ttgggaatgt atcgtgcgag gactatggag agaagtcttc    114420
     gttcctgagg ccgtcctcgg acacacttgc atcatcgatc ctgggcacat ttgggtcggc    114480
     aaagatgtct ataccgtact ttccccattt tattatgtat cttctaatgc tttgcattcc    114540
     ctctccgctt ctgagcagac tagtcctcca taaaaataga caggaaatgc ttgagatgag    114600
     aaacaatgag tccagctttg aagaacggaa agtgaaatga tttcctgtcc tgatactcaa    114660
     gacaagtaag atacaaagct ttagaccacg tcaagaataa aactggttta ttgtcagttg    114720
     atagacgatg cttgggatga tatcttaggc cacatgtcgg caacttctct ggggactggg    114780
     ccagctatct gggctcctct caactctccc ttgttgttga tgaggactgc agcattgtcc    114840
     tcaaacataa tgtgagatcc atctgtgcgc ctccagatct tcttctgcct tataagaatg    114900
     gcataatgca ccttttttcg gagctcaggc tttccctttt taacggacac gacacatata    114960
     tccccaggcg ctgctgcagg aagcctgttg agccttcctc tgtacctctt tactccaatg    115020
     catcggagga tctttgctcc actattgtcg gcacatttca tgagagtctc cacctgaaca    115080
     ccccttgtta tcttgttgcg gggctttatt gagatcttct tctcaagaac ttctgtcttc    115140
     ttctcggcag ccatatttcc ggggcttctg tcgaaatttt tttctagaga gatgttcgcc    115200
     ctagaacttc attagaggct gtatccctca taggcttcat tggccctgta aagatccttt    115260
     gtggtagcag ttggccttga tattcccgat ttcatctcct cctttcttcc aaggagctgc    115320
     catattcttt gccttagctc tttaatctcc tcttttccaa ggtcctcagt aagcatctta    115380
     tctatggcaa ggagttttag ccttatcttc gttttgatct caaggtcttt ggaagtgtcc    115440
     attctgtata gtgggatgga acccagatgg atttaccctg ttttaaagtc tctttgatag    115500
     acttcttgga taacaattat atgcagaccc catcagatga agccgtttct tctaggcctc    115560
     ctcaagtgca aaagatgttc gtttacatca agactagttc ctcgatgcga aaaggtgaag    115620
     agaagcagca tagatggaaa tgcaaagatt ttcaacaagc atacgtttac agagaatgga    115680
     ggagagagac tcaaacttct tgttgaaagt ctacagggct tttttggcaa tttactttcg    115740
     gagcaggaga tcggatcctt tgtcgaggat ccagacgacg atgaaaggat aaaggagctt    115800
     ttgtttggag tcgatgttgt agagggaagc ctgacgtgtg atgaatgcgg ccttatatac    115860
     ccgattaggg attccattgt ggagacagtc gatactcttg aatctaaata aaatgttttt    115920
     catgattggt gagttgatcg tttctagaga aatctctctc cattagccct tggaatgtcg    115980
     gacatagagg cctttgtggc tttttacgag catctgaagt ctcaaggaaa gggagattcc    116040
     gagctccgga gcgaggagct ggagagggcc atgagggaga tgctgaggag agcaaagata    116100
     acggacttta aggagtatgc acgaagttac aagtacaaga ggagggagct gagtggtttt    116160
     caggaagtac tggtgtgggg aaagaggaat tccatatgga atggaatggg agacatgttt    116220
     agaagcagta tggagcttct cgggcattct ggacaggttg atagaatatg ctttgaccaa    116280
     ggaaatagat tctttatgtc tggaggctct gatggaatga tcaagctctg ggacatttac    116340
     tcagggcttt tggtatacag cttcataggc caccgaaacc ttgtgagcga cctttgtgtt    116400
     agtagtgatg ggaaagtcct tgtttcgtgt gattcccacg gattactgag catctggtcc    116460
     ttggagaggt ttgaaatgct cctccagctt gaactggaat gcgagattgt ctttaccgaa    116520
     ttttttgaca cagacgacct atctacctat aatctgattg ttgttttgtc gaagggtgtt    116580
     atcaagacat acaggtttga tgagagaagg atagtgtctg agtctgaaaa cctttgtctt    116640
     cttgacgagt ccatcaaggg cctgtgcttt acagatgggg gaaggtttct tctgtgtagt    116700
     ggatggtggc catttcttgt tgtcttcgac acccagaact ccgatggatg catagttctt    116760
     gagacaaatg gaatgccggt gaataccata tgcggatcga agaagggtct taagatagca    116820
     gcagcgtgcg actctcaaat attccaatgg acattctttg cagagggaaa tcctggaatg    116880
     ggaaacttca aaaggagaac aaaggacacg tcgttagagg gacactggaa aagatctatc    116940
     accaagattg acattgggga gaacgagtcg atcgagagga tatgctatct ccgggacaat    117000
     tttctcgttt gcatatgcac tgatttgaag ataaggatat ttgcgggatc tgagcttaga    117060
     tgcataatag acataccgga aatggggatt gcatatccac atcctctgga gaacatattt    117120
     gccctctgcg gtagtagcct tcgaatatat agcatggaca agctgatcta cgaggagatg    117180
     ctgagctttg cagccaatga tggccagttt tcgaatgatg gagagttctt tgtgtttgga    117240
     gacgaaagag gagtggtaag ggtactttcg atgagtttcc taccaaagcc accgaaggag    117300
     cagttttttg aatccgacct tgaccacctt aactctactg agtggaatgg agttgttgag    117360
     tgcaggagag aatccactta tgagtcggat agaaagagga acgaagattg gttccaagtg    117420
     gaatatgcca ttacaaagaa gtccaacgac tgtgtaaagg ttgaggatct gggatcaaag    117480
     cactttgtga aagactttgt aggtcttgaa gcattccgaa aaaagtacat gaacattccc    117540
     ttgcctgggg agacacagtc tgtggagcag acaatgatat ctgagtatag cagcagcatc    117600
     ctagagggag acacatccag tgggttttac gaggaatcta cagacatgac aggagatgaa    117660
     gaaatattgt ttgaagacaa aggggcacct gtaagaagat cccttgttat cagtgatgag    117720
     tcctcggaga tggtgcctgt tttgagaaga aacacccggg tctcggagga tgttgagaac    117780
     gatttaagtc caacaggaat tgtaagaagg ttaaggagat tcaatagaga ccaggctgtg    117840
     gaggatgaag aaaacggaat ccgcattctg tcgctagagg gaggggacgg tatggacagg    117900
     aggggtgctg agcattgtgc aggacctcgt agtagtatta acgacagcga aagaagtgaa    117960
     ctagcagaaa acagtgatga ccgatatgtg attggattgt ctggagggat agggcatgga    118020
     gagcaggagc taaggcagta tgttcaatcg tggctgtcgt ctccaagtat ggtacctcag    118080
     ccgggagatg ttgtttacct aaactccgaa ggcctgagag aatttcaaat gtttgatggg    118140
     agaaagaagt ttaaggggca agaaatatgc tctggatact acgaagtgag aagtcttgag    118200
     gcagtcaggt acagcccacc atttcttaag gtggggctgg gccttagaga cgagagcttt    118260
     tcgataagat actacaggta tcctggatca tctcctgtgc tcttgttaag agaacagatg    118320
     aatgctgggg caggggattt tataagtttt gtgtcaaatg ggataatatc tcgaggaagg    118380
     gtgtctggag ttcgaggaat ccatcttgta gttgattctg gagggacttc tgtcctggtt    118440
     gagaggctgg acatgttaat tccaagggca ttatttcctg gggatatgaa gaccgagatg    118500
     ttaaaagtac tcaggcaaag gagaatgcac agaggacttt acgtaaccct gagaagagag    118560
     tcaaatccgt cttactacga gaatgcaact tctactgtca acctagggat tattgaagaa    118620
     aagatcctcc acgacttata tcggacaata ggtggactgg agtttgatct tgacatggca    118680
     gttagtaact cattatattt ggggccagtt cttcatgagc attgtcagca ggctgtggaa    118740
     ggggtccgaa cgattataag aaggatttga gggttgcgga catgtaatca agggctgggg    118800
     ttaccctgat gtactacgac gtgaatatta gtctggatta tccaaagcaa gatatcgagg    118860
     agctggagaa aagtgaatac gaagggtttt gtgtgaataa gactatgagg cccaaggacc    118920
     tcgaaagact ttcccatgga tctcttgagt ttcctggggc aaagcgttac tacaaccgtg    118980
     cggagattgt atttggagag ggagagcaga ttggatacga ctttagaaaa gcaatgagat    119040
     atgatctgtt tgttgtgaag ctgagcggga cagagggaat ggataagata ataaaacatc    119100
     agccagatat gattacattt gactatggtg gaaaagtcct tccatttaag cccggacttg    119160
     tcaagacggc aatcagggaa ggcatattct ttgagatacc gatgagagag ggcttgagag    119220
     gagggtcttt aaccatcatg tggatccgga atgtacggag actgctgttt attacaaatg    119280
     ggaagaacat tgtagttagc agtggggccc aatgctccat ggagattaag aaagtcagag    119340
     atgttgttaa gatgcttgag atgtttggac ttggggagaa aagagcactg gaagtgatgc    119400
     tcaactcgga gaggctttta aagaggtgtg caatgaaaag gcattgctac agagactcga    119460
     ttgtgcacag tgtggatgaa ggggccctaa aaagggactt tgtactgtct ctgtacaaaa    119520
     attgattttt tacaaaataa agtctacgac taataagact tgtatttttg attacctttc    119580
     caaggctcga tgttctttga tgtaaatgta agtaacagat gcccaagagg ggatctggat    119640
     gttttaaagg agcttggatg ggatggaatc tgcataaaca ctgttgttgg cttggacaac    119700
     ctggaaggat ggagcagtcc ccttcttgat gtgtggaagg acgagaaggc ctatgagagg    119760
     atagaggtaa gatacaagga taatgagaag tggagtgaag ttagaaagat ggtgaatcct    119820
     gatgtgcttt cggtgagaat agaaggggtt gaagacttta agaaagctct cgaggtttct    119880
     ccagacgtga ttacatttga ttattccagg agcttctgtc tcggaaagga cgaagttttt    119940
     gaagctgtga agagaaatat atttcttgag attccattgg tgtgtgggat gtatggccag    120000
     agaaacaaag ttgtatggat gagaaatgcc agaaaacttg tggagatcac ggggggagtg    120060
     aatgttgtgg ttgggagcgg ggcgtcatgt tgtacagaga tgagaagttc ccatgacatt    120120
     ataaagatat tgggaggact tggaacgagt ggagactgtg gaaggaagat actgcagaac    120180
     tctgggaggc tgatcaggtc ctgcagaata agaaaaggat gtgttatgaa ggaagagata    120240
     tgattggttc cttgaagatg agattctgaa acatctctag ttctgtgact actgagataa    120300
     atagaattct gaatccaaac caaaggcatg ggagcaagaa aaaacaggat gagaggacga    120360
     ggtagaattc aaggggctgg gagaagtatt gttattgaga gaagtgaggt taagaaggaa    120420
     gagaaggcgg aagggaagtt caatgtcgat ttccaggagc ttaacgaaga actatctggc    120480
     atcgaattaa aagaggagaa ttcaaagtgc tctgatgttg atgagatggt gtgtgagaga    120540
     gtctgcaaag acgacaaagt tgaggaagta cctgaggtat ccgagattaa tagggaaaat    120600
     acagtggatg aagaggtgga ggctgagaag aaggaagaga atatcgaaaa cagaaaggaa    120660
     gaaggagaag atgctgtaaa agcatcgcaa gccctctatc cagcaacacc cagtgtattg    120720
     accactgtta tacctcagac accaatgagg agggtacttc atgaggaagg aagccatctt    120780
     tttgttaagg aggaaagtat ggctcttcct gggaaggtga ttatcaatag gtatccggga    120840
     catttgttta ttcatataga ccaggtcgag aggttcatga catccaggaa ggaggtggag    120900
     agtgtatcta ttaagattga atcgaagggg atcttctatg agacaaagaa atatccagtg    120960
     cagccggaca taggaatcaa cgagatgctg caagtcccca tcaacaaggc cgagagcaat    121020
     ggaacacctc tgagatttat acttctcctg taccacaggt ctggaaatat agtaaagtcg    121080
     tgtgaaactg tgcttgtggt tgacggaagt agaatccgct caatacataa caatcttctc    121140
     gaaagtagat tggcatggga caactatgtg tcgaggaatc tatttaaaag cattcgaagc    121200
     ttttttacaa gtggagcacc tgatgcatgg agcctgaaga tttacttgtc gtttgtgtcg    121260
     gacgatgagc ttaggttgat tcctgcgcct cttcctcagg accttaagtc cctcagcaag    121320
     tggctggtgg tgaagaagtt ttcttataac atatggttta gaggatttgt gaatgtccgg    121380
     ggagatgttg aaaaggcatg taccaaccta tggaagagaa gatatgttcg atgctatgga    121440
     tacatgatct ttatatttaa cgagcattcg agaagccttg ttgggacaat aaacctcgtg    121500
     gatgcaagct ttgatccaag cacgagtaac aaggtatatt tagagaactt tcttcggatt    121560
     aatgttgggg agaaggtggt tgagttgcat tttgacacaa aggacaaata taatacatgt    121620
     aggagcgcac ttaccatgat gcttccacga acactgtttc acaagaaggg gtgatctggc    121680
     agacgatgtg tttcctgaaa cctatcttat taaagaattg aatacggcct ttctctatgt    121740
     tctgatggag ggaagttttc ccgccaagcc taaggatttc aagaaaatcc aggatcctgg    121800
     gagtttatgc ggcctgtttt gaacgagaca acgaatgcta ccaaaagact ggagacaaag    121860
     agtaaggaag gggaaagtga caagggaagg gtgctccact tcctgaaggg tgtctacgca    121920
     acgaccaggg actattcgtt gaagtatgac ctgaagaaat gtatggagat aattgaaggg    121980
     aaagagaacc aagaggtcat cgaccttaag aatgcgttgt ctgaagctct tatagagaac    122040
     gagacgctgt ttgcagagaa atgcgagctt gcagttactc tggaatgtat gaaagcagaa    122100
     agaaaggagt gatcactgga ctctgatata cattaaagga cttatttact atttggtatt    122160
     gagagatgga tttttggcgg gacacccctc ggctgaatgg agttgcgata tagattgtaa    122220
     gtggaagcaa ctaattttag ggtttttggc agaaagggtg ttctgatcga agaccgagct    122280
     ctgaaggagt ttgtgagcgg gcttatccgg ggctttgggg gccttgattt gctgagcaga    122340
     gttagtgtaa gatgtgatgg aggagtgatc aatatctcgg cggacaaaga ggcttctagc    122400
     attgtgcatg gatctctatt tctctgcgga gagtataagt ctgttggatg tagatttgag    122460
     cgaatcgatt aaatggttta tcaagtgtca ttactataaa ttattccaaa tgatttgttt    122520
     aaaaaacaga tgcatagaaa aacaatgaca gagagcttgg atggatacag ggagataacc    122580
     gagatccgga gagacaggag gattgtgata agctctgccg tagatgtagt gactggagaa    122640
     aaggttattc ttgaggaggc agatctttct gggatttctt cgtactacca gccgttattg    122700
     atgggttttt tactagagca tgaactcaac aactcgcctt atgtgatgaa ggtgatgagg    122760
     gtttttgaga gctctaaccg aatttatgtg gtacagaggc atatgtctct tgggcctgtg    122820
     gatactacga ttggaaacca aatctttgtg agcgatgact ttgtgttcta tgtatttatg    122880
     caagtggtgt atgccatgaa gctgaacggg gaagagggat ggttttggga ccgaatgtcg    122940
     ccaagataca tatggattga tgaggatggg aaagtccgaa tatgctgggc agatgttgta    123000
     ttggggaata tgaaggcgat ggttaagcag ttggataagt ggaacggaag aatgaagagt    123060
     gaagagaaga caacaggggg agataaggtt aattctgggt gcgaggggtc ggtgtccttt    123120
     ggaaatctaa gaaggatttt tgtgtcgcta gctctgggtg tatcggaagt gtcgaaagtc    123180
     atgtattctt ggaacggcag gattgggaga tctggattct tgggacatat ccagggtctt    123240
     tcgccggatc tagacgggct tgcatcgctt ctgtttgagg atggagtcgg gataaaagat    123300
     cttgaagagt atacacggag gatgatccaa gaaaagagaa tagccagtaa tcctcgggag    123360
     atattcaaat ccctgggaac tgttttggaa gagatgaaaa gagacgaaaa caagacgttg    123420
     gaagaaacaa gggcatggaa tggaaagtcc ccgagaacag aagaaccgga aagcggaagt    123480
     gggtctgagg agagcgggag aaatatgagc gagagtggga gtagaggaga tgatgaaaga    123540
     gttggatctt ttgggacaag agagtacaga aaagggagat tctatgtatg cgatgccatt    123600
     cccttaggag aaagagaaaa aggcctaggg atgaatgatc agatgaagag aatgggccga    123660
     attgtgaatg tacaaaatcg gcagataagt cttcttacag gtgtaatgag gaaatcagga    123720
     ctcctagaca aggagacaga tgcagaactt ggagaattag aagatctagt gaattttctg    123780
     ttgtttggag tggagaggca gtagaaacat attatagata aaatctgttt aatctatttc    123840
     ttctttgaac gatctccaag ccctcgaatg gaggaaatcg tttacttatg cgatttgagc    123900
     ttttactcgt cgtctgtggc aggagattcg ctaattgcct cggacaagat ggggggagta    123960
     cacataatag ctccggaaat aagcacagtg aatatagatc atttcaagaa ggatgttaac    124020
     ttctatcctg ttgatgattt atgcttcacc accacagaca tgttcaaggg aatacgggtg    124080
     tgggatagat gccggggaga catagtgtat tcatataaag aagatagcat caagatgcat    124140
     acatacagca ggacgggatg tttagcagct gttggagaag gatgtgtgaa actttatgat    124200
     ctccgtgtca ggtacaatat tgatgcagtg cctctaaaga tgtgcaagaa agcagaatgg    124260
     ggaaatgaca ggatttattg catcaacgac gagtgtgtgg ttgaatatga tactcggaac    124320
     atgagtagca tggtatgcgg agagaagaat gaggcctatc tgaagaaaaa gaatattgag    124380
     ggaattctcg accttatcag tattagtaag ggggagtttt gtacggtgaa aagagatggg    124440
     gtcccatatc tcatgagatt gtctggggta gatgtgatgg aagggacaag aagagcatcg    124500
     attggatgga agatgataaa ggttaaggat acgtctgatg attttgtgat tggaatggta    124560
     agcgaaaaca ctgtaggatt ctacgggtat aaggacacgt ggactcatga atttgatggg    124620
     attagtcatg tggactggat gtgcttttcc aaaaggaaaa tctatatgtt tgcagataaa    124680
     aagatttatc tcatagagag agagtacgaa gggttgaagg agcttatgaa ggaagggcct    124740
     gggtccttgg aagaatgagc aaggaagccc ctggagattg tagtgaataa aaatggatta    124800
     ggagatgggc tgtaaacaaa atgaaattca agaggacaat acagaaaaca tttggatcgt    124860
     cgaagataaa gagtatacag gtgcatccta ccaagccgat agggataatg gggctgtttt    124920
     ctggggatat ccaggtttgg gacatcgaca aaatgggaat gataaacagc atccatgtgt    124980
     gtaatgaacc gataagaacc tgtgcaatct tgagtaggat ggactgggta cttgtgggaa    125040
     gtgacaacgg aaaggttagc atatacgaac tgggaaagta caggaagatc aagatgtttc    125100
     atgggcatga cgacttcatc aggaagatcg aggtccaccc acaggaaccg atgtttttga    125160
     ctgcctccga tgattcgaca ctgaagagct ggacatatga agaggagatt gttcagaaga    125220
     tggtatacac aggacacaag cactttgtaa tggatgtttg tttttacccg aatgactgca    125280
     gtaagttcgt atcgtgctct ctggactcca caatcaaggt atggcacata ggacagccgc    125340
     attgtgtgaa aacgttcaag ggacacgcgt ctggagtaaa cagtatatgc tttctgagtg    125400
     gagattatct ggtttctggg gcagacgacc taacattgaa ggtttgggac ttccaaacaa    125460
     cacagtgcat aacaaccctc gcaggacata caaacaatgt caacaaggtg tatccgttta    125520
     gtagcttctc tctttttgct tcatgtggag aggatggaag catgcggcta tggaacagca    125580
     agacattcaa gcaggaggat ctgattatgc tgcaaggggg aagagtatgg gatgtgaagg    125640
     agaaggacgg aaggataatt gttgggtgtg atgaagagct tgtctttatc aatgcttggc    125700
     agggatcatc tcttgttcgg atgagtagga acagaatatt ctactctgca tctgggtcta    125760
     tgtttggtac caggagtgac aacataggtg tggtcaaaga gttgcataac attggattct    125820
     accccgacga gttagaggtg tccccgagtg gaaagacaat agcagttggg aacgagggag    125880
     agtttaagat cttttcatct ctgggatttc gaaacaagtt tggcggagag ggaagagatt    125940
     tccacttcat agaggatgat gaatttgttg tgagaaacgg agaggttgtg aacttctaca    126000
     agaaggccga agtgatccga agtattagca tcaaggggat cagcaaagtg ttttttctaa    126060
     gtcctaggtt gataggatgc aatgtctgcg atcagacgag aatttaccta tctactggag    126120
     agttcgtgtc atctgttagt catgcgtccg accatcttgc catgatcgga gactttctga    126180
     ttgcatgtgg agcatttata agcatctaca gagtggacca tgaagtgatc aacgggttta    126240
     ttgaacagga gattgagatt ccagaggaag ggataaagga agcattaata catcttggga    126300
     ctgagtacta ttcggtagca tcctggtgtg caaaagaaga tgttttctac tttgtatcaa    126360
     atggtaaggg atactatctc atcctgggag acaagccata tgtatatcat ttttcatcta    126420
     ttgacggcac aattgccgga gttgagaacg gagttctgtt ttatctccgc gacaaatcaa    126480
     ttgagtgcaa aaggatagat ggggagtttc ttgagttcca aagatctgta atacttggga    126540
     aagaatacaa ggtgacggag gggatccgca gtaaggcgat tgcatttttc gagtctctgg    126600
     aaatgcacga gaatgctcta gatctttgca tagacgacaa ccagagattt gagattcttc    126660
     tcaagctgga caggtatgat gaggcatttt caaaagcaaa cagtatagtc aagtatgaca    126720
     agcttggaag atactttctc agggccggag agcttccgaa ggcatctgaa tgctttctta    126780
     agtcgaggaa ctgggtaagc ttgctccttt cagacattct atcttcgaag aaaaatcttt    126840
     ctcttgcagc atccgagtgt aaaaaagagg gaaggctgaa ccatgcattc ttcgcatacc    126900
     tcaagagcgg acagtatatt gagtgtgcca aactgctgga aaaaactcct ttctcgacct    126960
     tgtttgctaa gaactatctt gattaaataa gtcggtggct atgttcttct ttccaggacc    127020
     cgggatacac aaattctgat aggaaggatc cctgatggag aatctagaaa aatggtatcc    127080
     gatagaggtg accacacaca acttgcattt ccatgaggaa gcatccatat tcacaatgca    127140
     tgggaatgaa gagtttatag ccacgggagg aggggataag gatataagac tgtggagggt    127200
     ggaaaaaagt gcatctaaga acaaggattt ttgttatacc acggcagcca actcctctat    127260
     aaagataaga tatcacacag tactttctgg acatcacagg agcgttaatt gtgtcagatt    127320
     tcaaggggat ctattagcat cttgttccga tggtggagaa gtcatcttgt ggagcggaga    127380
     aaagccgcat gtagtccgaa ggattgatgg agatgatgca tatgagcttg tctggggaaa    127440
     tgggcatctc tttgttgggt tttccagcgg aaacatattg gtgtaccagg tgactctgaa    127500
     caacgaatct cttagagggg acgaaaacca ttccaactcg agagcttcaa aggacgagga    127560
     tgagaaaaag aaagattgga gccaggagat atctaccaag ttggtgcaga aggtacaatg    127620
     ccatggagat ataatacagg gattggcatt taaccatcgc tttggagtcc taacatcttt    127680
     aagcaaagac cgcacgggaa ggacgtttgt gtttaccgac aagcttgttg caatagagaa    127740
     aatggaatat gttgatggag agaggctctt tacagcggga agaggcttct ttagaaggtt    127800
     ttcatactct ccagatggga aacttttata tcttgcatgc tgcaaatcca acactgttgc    127860
     tgtacttcac tatccattcc gaatggagca catgtatgga acaatgggac cctttgactc    127920
     ggaacctttg agaataatgt gtgatgaaaa taaggtgttt attgcaacca agaagaactt    127980
     gtatgtgttt gcggatcaga agctggagtt ctgtgtagaa aacatttcct ttatgaccat    128040
     aacagatgga tgggtgtttg atggaatttg ctttctgtgt tccttggacg gatttctgtc    128100
     atcgttgagc atgaaaagat gactgggctt ggatttagtg gcgaatattt gcaaactggt    128160
     tgacaagccc ctagatgggg atccaagaca agattaacga gatagaggcg gagatggcta    128220
     gaacccagaa gaacaagaag accgaacatc atcttgggat tcttaaggca aagcttgcaa    128280
     gatacaggca tgagctggat gcgccgaaga ccaagtctct gaaaaatgat gggtttgagg    128340
     tctcgaaaag tggagatgct agggttgttc ttattgggtt ccctagtgtt ggaaagtcaa    128400
     ctcttctgtc aaagatcaca gggacccata gtaaagcagc agaacacgag tttaccactc    128460
     tagactgcat atctggaaag atgtgcttga atgacacatg gatccaagtg ctagatcttc    128520
     caggaattgt ttcaggggct gcacaaaata gagggagagg acggcaagtg ataagtgttg    128580
     caagaacagc agacttgatc ctaatggttc ttgatccccg aaggcatgag gacaggaaga    128640
     ttcttgaaaa cgaattatat gagatgggca taagattaaa caaggagaag cctgacatat    128700
     ctctcacata tacagcaaat ggaggaataa acatcggggt aacattgcag ctcacaaaga    128760
     caactgaaga tacaataaga gccattctac gggagtacaa aattaacaat tgccagatgt    128820
     ttataagaga ggatgtatgc gatgatgatg tcatagactt gattagcgga tctgccgtct    128880
     atatagattg tttgtatgtg tacaacaaaa tagacgaact ttctctggag gacttcaaca    128940
     agattgcaga atgtcccaac agtacgccca taagctgcca aaaaggctgg aatatcgatg    129000
     cattgcttga agacatctgg tccaagctga agctcacaag ggtttacaca aagaagaagg    129060
     gaataccccc ggctttagac aaccctgtgg tgataaagga aggaggaaca gtgagggatc    129120
     tttgtgttca gatccacaag gattttctgc aaggtttcaa atatgcactg gtctggggaa    129180
     ctagtgcaaa acatagcccg cagaaggtcg ggcttggaca catgctagaa gatgaagatg    129240
     tggttcagat atttctgaag tagtttagtt ctgcatgtat ctatcgagat atatcttcat    129300
     gtcgccatct gccttggaat aagcctggag gaatatggag tagacagcat ccttttctct    129360
     tttcttgtac atcctagcaa cattcttaaa taaatcgttt cttatgaagt acctgtgtgt    129420
     gaatctactg ctgcaagaca cagtatgaag gagtactttg gagacaaaca cttcgtttac    129480
     accatctctg tggtcggaca gaaatatctt cttcatcagc ccagtgttaa tgagaaattc    129540
     tcttgccctg aatccatggt tattaagcag gtacagcaaa aggttctgga aatctggatg    129600
     gtgttccata attccgagga ggttaaaaac ttccgtgtag aatgtatcta gtttttcgga    129660
     cttacataca tccagtaata tgtacagtcc ctcgagtgca tacaaaagac tatcatccaa    129720
     gggctttctg ctaaccagat ccttgatctt ggagaggatg tatttaaagt ctacagcctc    129780
     ggacattttc tctcggaata taaagcagag atagtagaat gtctcaaaaa gatagatgtt    129840
     ttctttaggt ctgtggattc tctcaagata cgtctccaca cttccgatct tatacccgtt    129900
     cccactgcat ctcttgagga ggtcccttat ctcctcatca gacatttctg ttattttgct    129960
     ctcgcttctt gccaattctt gcctgtttat gataatgagg aagtcctcga aggtccttgc    130020
     agtagagcca ccaagattct tttctatgat ttccctataa aatccatatg gggtgactct    130080
     gctcttagaa ggaacctcaa acagttcaaa aaccttctct ccattcttaa gcaacatctt    130140
     aaacagatgg agactctcca tcttcagaag ttccaacact ccatccctac tttcaagcat    130200
     tttttcaaat acagagttgt ctgcgtattt cccgatgccg agaagctctg caaagagatt    130260
     tacctccttt ccaaaggaag tgcattctct ttccctatct aattcctcga ggctccagaa    130320
     ggtcttttcc ataaattcag cgaaactatc tctaatttcc tcaccttcaa aacagatggc    130380
     atattcctca aaatcatcat atacaattgc aacgtttttt tccgatcttc cacagtgctt    130440
     ctggcaaaga gatatttcaa tacacctttc agatctatcg tcctcgacaa agatacaatt    130500
     ctttgcaatg tagagtattg ttcctgtgca taggtcttcc cactcgtcct tcacattttt    130560
     gaagatccta gcctttatga gagccatgag ggatctattg tgtgaaagat attcatcaaa    130620
     aggtacaaat gtttattgta ttttggctct ctttgaagct atcataatcc aaaaccagga    130680
     tcgattttct taagaccttt gtatccaagt agagagagcc cggccagaga aaacatgaga    130740
     tgatataagt caacttcgtc tccaggtcta tcagagaatc ccccactccg tccttggcag    130800
     gacaatatga aattctccaa cctctcttga ttcacacaat tttcttttcc aataagcaca    130860
     agagaagagt atgcccaaaa cgaatagcaa acatcttcct tcttgctcac ccttccagaa    130920
     agacctccag atcttgcctg cttcttgact ataaatctag agatactttc cttgtcgaca    130980
     agctccaaag ccccaagaga ccttagcgtg cttaggcaac agaacacttg tgcagcatga    131040
     gattcagcac cctcaacagc cccaaatccc ccatccagat tgtaacattt ttgaatatat    131100
     tgaacaatag ctttcaaatc aaccccaacc tccgacaaaa acaccttgca cgccggccta    131160
     gacaaacttt cgggatcaaa atctcccctt tccaaaagag acagtaactg cagccccaag    131220
     actccgcagc agctgattcg ggtgtctatc tctccatacc tgtcattgta gaaatatccc    131280
     tccggctgca gcagtcctga tataaataaa gcagtgttcc tgtcacggta agctatgcga    131340
     tagatgtaga gtatttgcag ggcatggaag gtacttgtta tgttggaagg gtatcccttg    131400
     catcctccaa accctccatc gtcattctta cagttcatta catactcgat tattcggtcc    131460
     ttcattctta gcatctcctc ccttcccaac atcgataggg agttcacaga ccagtatata    131520
     gtgctgagtc tgtatggctc cgtcaagtaa tacaggaagt tctttgtgtc tatcatactt    131580
     tggataaaag aacagtgttc atcaaccttt aaactcattc cagggcccaa atttcttgtc    131640
     ttccttaaaa actgctttgc ttaaaagaaa agacacaggt gcagagtctg gtccctcttg    131700
     aatctgttgt agactcaggt acagagattt gataaagatt gaaatgtctt taaaagtatt    131760
     tacattcaat caaaacaaaa acaaagatga atgaagttga aagcaacaat cacactcctc    131820
     ttcatccaga tattcccaca gaggaccaga tagaagagga agctaacagc aggcgaggga    131880
     ttcttcgata tttcagggta gcaaaagtag agtacacaaa attcactgtt ttgggattga    131940
     tgtttggaat aattggtttc atatactcgt tcatgaggat tcttaaggac atgtttgtga    132000
     tggtgagaca ggagcctaca acaatactgt tcatcaagat cttttacatt cttcctgttt    132060
     ccatggccct tgtgttcctc atacaatata tgctggggac aaagacggtg tcgcgaatct    132120
     tctccatctt ttgcggggga tttgcatctc tgttcttttt ctgtggtgtt gtgtttctga    132180
     ttgaggagca agttgctcct tccaagtttc tcttccgtga catgtttgtt gacgggaaga    132240
     tgtccactag aggcctcaat gtcttcaaat cgatgtttct gaccttaaat gagcctcttg    132300
     ccacaatcgt cttcatctcg gccgagatgt ggggaagcct tgtcctgtcc tatcttttcc    132360
     tgagttttct gaatgaatcg tgcacaatca aacagttttc gaggtttatt ccccctctca    132420
     taatcatcac aaacgtgtcg ttgtttcttt ctgcaacagt ggctggagcc tttttcaagc    132480
     ttcgagaaaa actagcctac caacaaaatc agtttctact ctcgggaata ttcatctccc    132540
     aaggccttct tgtggtcttg gtgatcttcc tgaagatata tcttgagaga gtggcaatga    132600
     aaaagccctt gttcatcgtc tcctccggat caagaagaaa gaaagctaag cccaacgtgt    132660
     ctttttcaga gggccttgag atcatgtcgc agtcaaagtt acttcttgcc atgtctctca    132720
     ttgtcttgtt cttcaacatt tcctacaaca tgatcgagtc tacattcaaa gtcggagtta    132780
     aggttgctgc agaatacttc aatgaagaga agggcaagta ctccggaaag ttcaatagaa    132840
     ttgaccagta tcttacctcg acagtggtca tatgtctcaa cttgtcgccc ttttcaagct    132900
     atgttgagac aagaggattt cttcttgttg gggtcataac gccgattgtg acgcttctgg    132960
     ccattactct tttcttgggg tcttcacttt acaacaccag tatggaagag tctggaattg    133020
     gaattgtaaa tagcctcttt ccaagaggaa agccacttta cattcttgaa aattactccg    133080
     ggataatctt catgtccttg ctgaagatca caaagtactc tgcatttgac atctgtaagg    133140
     agaagcttgg gatgagaatc aatcccacat accgggcaag attcaagagt gtgtacgatg    133200
     ggatctttgg aaagcttggg aaatcaatag gatccatata tggattactg atgttcgaag    133260
     ccttagacac cgaggacctt agaaaggcaa cacccataac tgtgggaatc atcttcatct    133320
     ttgttgttat gtggataaaa gcaatcatct atctgtcaag atcctatgat tctgcagtac    133380
     tacacaatag agacgtcgac atcgatatga ctgagaaggc caagaaaagt atggaaacat    133440
     ccgagccttc aaaagctgta gattaaaagc acaattcaag actgttttat tcttcatgat    133500
     tttcaaatat ggccttcggc cttgctagag gagttgaaaa agccatagcg tgcaattctt    133560
     tccatatagg acttgttttc cttatcacga tttcttatcc tgaatgcccc gtagaccgac    133620
     acagataaaa taaacaaaca ggccaaaatg cattggagag ttgcatattc caagaaagat    133680
     atggaagtat acatcttggt tacacatgta gagataaaca tgagtaaaag caaacttctg    133740
     gccatcggta tacttttggc ttcctgcatt tggggtcatt ctctgccgct tcaaatgtga    133800
     aatgcagcag gtagtaacga gtaagaagcg cttacgattc gactgtgagc ctgtatccac    133860
     attcacagga atagaagact gtttggccct cgtcggtaga tctcagctgc actgtattgt    133920
     acatcatttc ttcagcaccg cacccgggac atcgatgctt tatctttgca ccttccactt    133980
     ctatgacttc tatatgagaa tctctttgaa cttcaatttc ggtgaagaca ggctttatca    134040
     tctcgatact attttctctc ttgcatcgga ggcattccac tttgctgctg ttggatttga    134100
     tatagattaa cgttccacaa atacaaaaca tactgggcct agattttgaa gaatcttata    134160
     tggaaagaaa tgaagatttg gtgcagctgg agcagagcgt cagtgcggag tgaaacctac    134220
     ggccagcttc atgtggagga tgcatgaata ggaaaatcta gaaattaata gataccttct    134280
     ggagataaaa tagtggggaa cctgccctaa acatgggggg agttcaaatt ggtgggaaaa    134340
     taggtagaag catggatgga aaaatgaaag agggagatat gaagaaatct agaaatatcc    134400
     acctggactt ggaggaagtg gcaatgtgca gcatagaggc tcttaaagcc aatccctcca    134460
     atgttgaagc tctatatagt ctaggaaaat accatataga aaacaaaaat atagatgaag    134520
     tagagactat tgcaaataag ttgtttgaat tagaggagga atcttacgag gcatgtgtac    134580
     taagtgggca cataggtctg cagacaagtg agctagataa gagctacgag aactttgtga    134640
     aggcatatgg caaggtagaa tacaaagaca agtttctgat atatggaatc tcgctttttt    134700
     acgaagcctt aggagactat gcaagtgaaa gaccctggct tgtacttctg aataagctgg    134760
     gggtagagga gtacaagagc tatgaagttt tgtttagaac aggtgtttgt cttaagaaaa    134820
     tgaacagact tcaagactcg atcaatgtct tccgtgtgat cttgtacgat cccgtatcgg    134880
     atacctatga tccctatgct caaatccaga tggcacacct ttacgagatg cagtccaagc    134940
     atgaccttgc aatcgagatc ttgagcagga taaagaagga aggaaagctc aaccttatgg    135000
     tttcgagact ccatgcatgg atagacttca aggttgggaa ctttcggaga gtaaggaagc    135060
     ggcataaaga agatagtgat actattgacg atccttatct cctgtatcta gccggaagga    135120
     taaagtacat ggagaagaac tacacagatg cactgagaaa gtatatgaag gttattcaaa    135180
     cagattccat ctgtggaatg gtgcacaact ctataggatg catatacctt cggcaaggaa    135240
     atcttgtatc tgcaaagatt gccttcataa atgccctaga ggccaatcca aggttttctg    135300
     aagcatcaat gaatctcaag catatcgaaa aaatcatacc taagaaaaca aaggaaacca    135360
     tcgaaccgct ggaggacatt ctatacaatc cgagagaact acctccatca atcgggagaa    135420
     caagatacct tgactctgga ggggtttttt ctgatccggt gtataacatc caccctcgga    135480
     tgtttagaat tcttcttccg atgaaaacat ctaaactcga gttacttcct ggacgatctt    135540
     aaacagctta ttaaattgaa agatgtacag tcatgtctgt caaggttttc aatgtattcg    135600
     actacacccc atttctccag acgacctgtt ggataagctt caacccagaa tcccgattgg    135660
     tgagctacaa actcaaaaca aaggatcttc cagactaacg atgaggtttc ctaccataac    135720
     agtggataga gaaagagact tcaacacaca ctttgcattc cctcgagaca tatatctcct    135780
     gatggctctt tctctgatga ttgtgatggt taagaatttg atgattctcc ctatggcgtc    135840
     taccttaatc aagagatttg gtatggaaaa gagtttagag tttgagagaa agaagaagtt    135900
     ctctatttct ctttggaagg ctttgtttta ttctttcaca tcgatttatg gatactttgt    135960
     aataaggagt gaaccagaag cttacaccat ggaaaacctc ataggaactt gggggattca    136020
     caggactcct tctaaagtct tattctatta ttatctggag tttacatatt actttgttga    136080
     gctattttat ctctttagtg agcatatgta taaagacttc ctgcagatgg ttgctcacca    136140
     cattgtgact atgcttcttc tgtttctgtc ttatcacaag gacctgctac gcccgggtgt    136200
     tatcatcata gctatacatg acatatcaga cccattttta gaaatcagca aacttataaa    136260
     ctacattcgt tataagcctc tggccacaaa catattcata tgctttgccg gggtcttttt    136320
     tgtttctagg ataggaatct acacacctct tattacattt cctatatgca tcaccatatg    136380
     ggaacatgaa tttggccgag tcctgacctt tatctctgtg ttattacaag gattggtatg    136440
     catgcatgtt atatggttct ggataattct aaagatgata aagaagattg ttcgcaaaga    136500
     agagtttgaa gacattagat ctgtcaagcc ccagggctct tccattcata tcaagtgcaa    136560
     gtaaacacac aagttcaggt tagatattca ggtggggttg cccctcggta gatgatcatg    136620
     gtacttttgg tgtatcagct agtacttgca atagagactt gcaggtttgt gaagtacttc    136680
     tgtgacgagc agggaataaa ggttcccgaa caaataatgg acgattacaa cgaagcagaa    136740
     ggagagtttg gaaacgatcc agagtccttt gatttcatat ttcacaatgg aggcgaaatg    136800
     gacattttcc aatacaagat tggagtagag ctggttgcgt cggtgttcct ggtcagaagg    136860
     acattctaca tgatagtaga tgaagaacct gtggggagaa gtgttgtttt gctttacaca    136920
     atgtatgttt cgaaaaaata tcgaggaaag ggatactcaa aaagaatcct gaaggatgct    136980
     ttagactctc tgaatagcca ttacggaatg aacggagact tcttggtggt cttacatttg    137040
     gatccaaagg atagagatat ggcccttgcc ttttctttat actacaacct caacttcagg    137100
     aatggagggt tttcaatgac aggtccaggg gaaaagcaat atttcctgga ggaaattctt    137160
     gaatatagag atccctgcga cgcagttgat aaatacaatg agaaaagaga taaagggcta    137220
     cacatgataa tgttctgtga atactcaaag ctttttacat gtaagaagat tccatatgag    137280
     cgattaatgg agtatggatc aaggctgaag agcattttga ggagtaataa gccggtggaa    137340
     acccaatcta tgtcatgaaa caaagaacag ggagacatca aacttctgaa acagacaaaa    137400
     aacagaagga tatataacct gagatgagtt aaacaacaat gaaagcaatt ttcttgatta    137460
     tgttgttaat ttatggaatt caagggatag agatagaatg gagtatttcg gagaaggata    137520
     ctgattacga aaagatcata agggaagaga aatgtgttct gttcatcaaa aagttctgcc    137580
     ctttcagtat taaagcaagg gagctgctgt ataataaggg catttcctgt aagattatcc    137640
     cggtagacgg gcggatcaag ccctacaatt tcgcgaagac ctaccagagt acattccctg    137700
     tcttcttctt caatggaacc tttatcgaag gaggctatca aaagctcaaa gatctttcta    137760
     ttcacaaact tcccccattt gaccaatccc ccctgtttac agagggtagt tatgaagctt    137820
     cttttagatc aaagatcaag taaagtcctt tatttttcgt ttgcatcttt gttttctgtt    137880
     tttgtatgct cctccttgta cttttttaaa aagtccacaa cattttcaac cttcttcccg    137940
     tcctcgtaca acaaaggaat ctccccgccg tttttagaaa tcgcagtgct ataaagatcc    138000
     agattctcct ccacgtagaa cggttgataa ggcacgccga ggctcttaag agtatcttct    138060
     aattgtctac tttgattaca gttctgctca agcaccgcaa caattccagg tcccttaagc    138120
     ttctcaccta tggtactcgt ctcaaaccca cctgtacgtt tggcagcttc aaaccccaca    138180
     gctttttgcc ctgtgacttc cattgtcttc gtatatacaa ctcctacact tacaaccagt    138240
     gcaatataat ggaaaaagtg gagagatttc atctttccta ataaggaaat tggggttaaa    138300
     taaattttct catacaatgt tttaatatct aaaacgcaat aaaatcgata agacatctat    138360
     caccttacgg agttgagtca acagataaga aactcctact cttaaacgga tttgatcaga    138420
     ctggtttaat ttattattta atgaatacag gcttcttaag aaatcatgct aaatcctctc    138480
     acgggacaaa tccaagagag cattaactgc aatcacctca aaatcctcca agtctatctc    138540
     gtgctcatct ctttcttttg tttgcatttc tatggcgtcc ttttctcgct cctccgaatt    138600
     tgataccttt tctttacctt ccgatccaat cataaattgt ggaatcttcc caggtctttt    138660
     gtcgaagtgc ctcctaatca aggacgttgc ggctgtgttt gtatcgtgtc tatagtttcc    138720
     tctactcccc gaaagtgttc ttctttcgtc cctgggtcct ccaaagtcgt catagaacac    138780
     atccttatca gaatctaccg atataatttc tctattccgc ttgaagccat cgtgtttcat    138840
     ttggtaatct gatggctttg ctcccaagtt cctttggttt tcctcttggt atatattgga    138900
     ttggtcttga actccgcttc gatgctcatg gagagtccat ccagtcgctc tgtggccatt    138960
     gcctgtttcc tccacaactc ttctgcatct tactctcgac tttccggaat ccgctttgaa    139020
     atttgtaggt ctcttcctcc cgtgtatctt gtagtaaagt ccacatgcat tacagagata    139080
     gcttccatcc tctgccctcc tccataaagg tgtagctgtg gtgttacagt tgctgcaaaa    139140
     gccttgtttg gataacattc ttagggtgac atctattcta tctgttttag agagggatcg    139200
     aggaaagatt catcaggaca tccctagcac atttgggttt tcttcttata ttaacttgtt    139260
     ttagaatatc aaagtttgac agctcggtgg gcgttattta atccacacat ccggcttaca    139320
     gcagacgcct gtacgttaaa ttggaaatca tacactaaat tagaattaca agatatgaac    139380
     tcttcgtcgt tcacgtcttt ctcgagaatg gcctgtagat atcctgcttc ggcagatagg    139440
     acaggccaag ttcctgagaa accatttgtc aacacattcc ttgtggaatg catggccaca    139500
     gccaagattc cgaacatatc ccccttcttc gaagtcctct aagcaaataa tgcagccttt    139560
     gttgatgaac tcttggctgg agtagggaca taacagtatt ttttctattt ctttgctgga    139620
     gagtccttct acttcttcta ttccaaaaga taaaaacaaa tagaacacta ttgcagccac    139680
     cagaacaatt ggtatgtgaa gaaagacctg aattgcaaga gggatcttaa cctcaatgct    139740
     cttgatcttt atttctggag aatggcctag gtttctttgg ctatcctggc tcagaattgc    139800
     cttaagcata gaaaagtcaa aggacatggt tccaaaagtg atgtttttcg acatctcttc    139860
     ggtccttgaa tttatattct ctttgtcttc gatccggtat atctctagac tatccatcca    139920
     atagtccttt ccctctccct cctgctttgc taagtgtcca aacaatttgg ggatggctcg    139980
     ggtctctatc ttgacatctt tcagagtcag cttctctccc aagcaacttc cctcatcaat    140040
     tgcataaagc ggcatgtaca cacttacgtc gaacatctgg agaatcacat atgcacttat    140100
     tctatagaca ctcatctgta aacacatcca aaactctttt atttagtctc tgatacccgg    140160
     tttcatccgc cagagttcta taccggattt ctgtggcaga ggaagcccta gataatagtt    140220
     ctctatacag tatggaagta ctgcttgcat caccaaacaa agaggtacaa aataaaaccc    140280
     ataagaaatc cgatggcaag gctggtgtac tcggcatctt ccaagaggat atcatgggaa    140340
     acagagtctg gtgttgctac gctttgctgt gtaggaacta cagataaaaa gcccgactca    140400
     aaacagattg aattccagac aatcttggga attctccagg tggagaaaaa cgaatactgc    140460
     gaggagttcc ttgcatgtgt tactaaaagc acactcaccg gtttgtacga tgggatcgaa    140520
     atatacaaga ttgacaaaat caggtttctg aatatcaatg agcctgacag ggcagatgag    140580
     attatgtccc aagttaaggg gtttatgcag tcccatgatt tttattactt ttcggcatct    140640
     ttattcatag aagatgaatt tgtgtggaac aaacacatga aagacaatct cctgaaatac    140700
     tttgggccaa atcctcaccg atggatcctt tcacaccggc ccgaaagaca gtctcttaat    140760
     ctcgggatct caacactttt ctgtgggttt tttgcagcca aggcattcaa ggtgtcggaa    140820
     gatttctatc atatgaagct tctctcgctg gtgtcctcaa gtagagttgg gacaaggtat    140880
     ttatgtagag gtattgacaa tgaaggaaat gcatctcttt ttgtaaagac acatttttta    140940
     acaaagagga acaatattac aatatttgat ttcaccataa tcagagggtc ggttccaatc    141000
     ttctggaatc agatggagta tggaatctcc acaaaaataa acatttatgg agacgaggat    141060
     ggagtgcgaa aggcatttgc aaagcatttc aagaagctca agagggaata tggaaaagta    141120
     catgtaatca atcttctagg agaaaaaaaa catgaaaagc agcttacctt gcacttcaat    141180
     agactcttag acctcgagga catcccacat acaacgtttg atttaaatgc tcatgcaaac    141240
     aactacgacg atctgaagtt tcttctttac ttcaagctgc aaagtatcga tatgaaggat    141300
     acagtcttcc gagtaaactg cttggattgt ttggatagga caaacgttgc acagtctttg    141360
     atatgcatgt tctatttcga aaaagtcgta aggagcgagg aagtcctgaa gaagatgcag    141420
     gaatgctggg cagacaatgg aaattcacta agcaacttat atacggggtc tgatgcaatg    141480
     aagagagaac tggctcttaa gggcaggaga tcgtttattg gatacatgga tgattttgtc    141540
     atttctgcaa cacggcttat aaatggaagg tttaccgata gacaaaagca cagcattatc    141600
     aatgttttat tggaaaagaa ggaggactca gaagagatag gggctcttag ccttgatatg    141660
     gaaatcatta ataggcctat atcttgatta aaccctctta aagatgctgc tttacatatt    141720
     caatggccct ctcaagaacg tttatgtcga ctccactcag tccgccaaca aagattgtcc    141780
     tcagaatccc agacctaaac attccataca tacgtaccca tgaccctata tccagctgct    141840
     tctcggtggc catgatgatg ctcctctcct tgaataccac cttgtatctc ccacttccaa    141900
     gcctactctc aacctttcca aaggagtata tggtttttcc ctctataggt ctgtccaaaa    141960
     ggctcaacat ctgaaagttt caaaataagg tgattggttc caaaatgttc aaatagaagc    142020
     catcccttta acaggaaaat gagcatcaaa gcccatgagt cttgttccga tcagcttaga    142080
     acaaggtttg tgatgttttt gcatatcaaa atgtacatag gaaccttgat gtattgcctg    142140
     ctacttgtca aaacgtttta tggatccctg tgtcttgtgc tcttggttgt ggccaactct    142200
     ttgtcgtttc tgaaggcgtg tctgaacgac ccgggaagag tgaataaaaa gacatatcat    142260
     aagtacctgc cggatgtggt tgcatttgaa aagaacatct cgacgcagat atgcaccaac    142320
     aagaatgggg attggataag agccataagg atcaacggaa ccgagtatga ggaaaagtat    142380
     tgtttggaat gtaatttatt tcgtattgga gggatgtccc attgtagaga atgcaacaga    142440
     tgcatcttag acatggacca tcattgccta tggtttggaa attgcatagg cagaaataat    142500
     ataaggcact tccatatcta tctgtacact ttggttgctg ttatcttggt gaatgcagca    142560
     ttgctgtata gcttgatagc catatatccc tggagaaata ctccacccgg gctagcactc    142620
     aaaaccttct tatttctcct tgcagtgtta tataccttgt ttttctgtgt tatctttcta    142680
     ttcacggcct tcaacatata tgtggccttg aattcttcaa catcaaagga cttcatcaag    142740
     aacggcctga aaaacaaaag gttcgatctt aagagagcct gcagaaatct ctcgagaatc    142800
     aggccagaga tgtcttcttc tcagccatcg gtgtaagttg tggtttaaat ctcattgaag    142860
     gcccatttgt agtcccaaat gtataaaaag attttcttgg atttctaggc aacacttgaa    142920
     tcattttctg tttctgtatc attgggtcta ccatcggcct ggtaatctcg cttgtagaag    142980
     agttctctgg acgtaagaag catcgagtcc tttgacttga actcgctaca gttgttaagg    143040
     tgttcaaatt ccactctgaa gattgtccat acaaatctcc gggttatttc caggaatact    143100
     atccagaaca ctgggatctc aaaccaataa aagaataccc acgaaaatct acacagcaca    143160
     ttgaatacta ttccgcagct atacgtacat ctcggatata tcatcttgct tcggataatg    143220
     ccccagtcca taaatagatc ccaagtggca gagtatatcg atgagatggt gataaccatc    143280
     atcttataga caaacaattc ccatgttctt tttgtcgcat ataaaggaat agaaaatcca    143340
     gtcaggatgg caaaggagta cttaagggca tttgcaatgt gcggaaactt aagacgggtg    143400
     tctctataac gcctaataca ttgcaagaac cttattattg caaagaaaga gttggcatac    143460
     ccctctacct tccaattgag atgcctcccg cagaagaata tcttcttgaa gcaaggcgta    143520
     aagctctggc caacatctgc aaagtagaaa tgcctgaatc tgacaaacga cataggaaac    143580
     acaattattc taaacacgat aagaagaaga tagaacctcg actcgtagtg gagtacttta    143640
     aatggaatca aaattataag gagatggccc agaagtagat aatatggatt aagatgcaaa    143700
     aaggaaatat tgatccatgt tccaaccaca ttagcaaata tcgagaggga aaccagaaat    143760
     agatacttat ctgaagtcag tgacgagcac atatcgaagt tgaaaataaa cttgtagttt    143820
     atgtggaatc ttttgaatat aacgagagat gttccaaaaa gaaatgcccc gtactgtaga    143880
     agtaccatag aaaaaaacag ctccttatcc atctggctct tcccaaagtt aattagcccc    143940
     atcatcccaa gagatatccc tcccagtgca ccagacacat aagagataag ggggtctgct    144000
     ttggtcttga cccttaattt cttgaatacc gtctttgctt tggctgggtt gtctttcgca    144060
     aacacgcttc tgtagagttc ttttacagac ctgtatatgt cgtcaatccg cgaggatttg    144120
     ttgaagtacg actcattaac atttctagaa aaatgctcat gaaatctttc ctgaggatac    144180
     gccttgtcgt atttctttga tagcttcatt agccctgtgt agttcaactc cctaaacctt    144240
     ttgatgctga tcaccgcatg aagaaactct tgtatattct tctcccttct tcttctttcc    144300
     aaacgcttgg agatcttgaa tatctctcca atgccctttt cgtctgttcc tttccttacc    144360
     ttcttaatca aatactcaaa tctactgttc ctatcttccg aggatgtgct cgaccctttg    144420
     gaatcctcat catctccttc ctcatcaagc tccatcttca tatccgactt gacccttagc    144480
     cgatcctgct ggtcatccct ccccatgcca tagtcgtcac ttaaacacat ggctttcttt    144540
     tgtgaatccc ttattctcac tccagggtcc tttggagact tttcctcagg ggataccccg    144600
     gcatcggcaa atatctcctc cttttcaagc atagccttct tttccagtag aaaaaagaaa    144660
     tcgtttatct tccgaagctc accattaatc cgagttttga actcctctct atcctggctc    144720
     aacaggggtt tgagggtttc ataggataca taattatcct tccactcatc gacttggttt    144780
     gccctcaaag tgttggaaaa tctcatcctt ttatgggtga catattttct ccaattcaag    144840
     tccaattgga aagaatcgaa agacagatgg aaaagctttg cactggaata gggaggatgg    144900
     tggagcagca ttccaagata ggaaggtttc taatagccca ggaaaagata ttaaccagaa    144960
     gaacacagac cctccaaaac ggagaggcgc tttgaatcca gctccaagtt ccatcaagtt    145020
     tttatctagc ttccaaatga cgtcccaccc catatggaag acagcggatc caaagaaact    145080
     attcaagaag agtctacaac aattatcaag aacgaacgaa cattcttcaa tcctgcacaa    145140
     aaattcaatc gggacatatc tgtagagatt atcagggaat gcttcaagga ctccacttct    145200
     attcgaattt tggatgcaat gtctgctacg gggctacgcg gaataagata tctcaaggag    145260
     atagaaaact ccagagttta tctgaatgac atctcccaat cttctgtcga gacaatcaag    145320
     gcaaacattc ttctgaatgg aatcgaggat gtagagtgct ttgaatctgt cttccagaat    145380
     attaagacaa gtaaagatgt aagagccact attacaaagt ctgactgcaa cgttttaatg    145440
     gcttctctcc cctgtttctt cgatgtcatc gacatagatc cctttggaag ctgttctgaa    145500
     tacattgaca gtgcgctacg agcgattaga cacagaggga tcatatgcct tactgcaaca    145560
     gacaagggag ttctgtgttc taacgagagg aagtgcctca tcaagtattc cacaagtatc    145620
     atgaaaggag tggggacaaa cgaagttccg ttaagaacaa ttatatccct agtgtcaagg    145680
     caagcatcta aattcgattg tagtgtggag ccagtggcat ctctaagcat tgatttctat    145740
     gttagaatat ttcttcgaat agtaaggaga aatccaaggt ccgtgattga aaaaaacagc    145800
     cttttctgga tgtgcacctg ccacaacatc tttgaagtta gaaatggcga ggacattagc    145860
     aacaaatgtg ataactgcag cagaagaatg aagttgtgcg gcccgttctg gaatggccct    145920
     ctgaacgata taaatgtcat ccagggagtc ttgaacagag caaaggagga taacaagaga    145980
     ttgattggag tgctaaggca tctagagcaa gagctaccaa caatgtttta ttacgagatt    146040
     cctcgtctgt gttcaatact aggaatcagc tctgtcaaac aattgagggt gatgcatgcg    146100
     ctagcaaata tggggtatcg ggtgtcttac acacattcgg agctgaatgc tatcaagaca    146160
     gatgcgccga ttggcttgat aaacaaagtg ctgttgctga gcgatgggag taaccaagaa    146220
     aaggcagagg tgcttggtct aaagtttgag gggaataaaa atatagaggc tcttgagacc    146280
     atagagtttt tcaagggcct tatcaagtcg gggatggggc ctctctctct tcctaagaaa    146340
     cattaaagtc ttttaagcat acgggttttt ctttttccga tttccagtcc atgggtatat    146400
     ctcggctcta tgtattgagt aggctaaaca aaaccctctg ttatatgtcc tggaagttcc    146460
     tcaatgtgtt gaaggagaga acaggagtgg aaagcattac taaagaacag gtaaaaggaa    146520
     tcaaggagct tgtaaggaaa gcacacgagt gggatgagaa aaaggcccgg gagcatatga    146580
     atttggtact gaagatgccc gaggaggagt actcgaagct ttggaaaata gacttatact    146640
     ctataagcga ctgcgataag gaaaaactca agaacctcga ccaaaagacg gtgttcaaca    146700
     atatcatgtg gctgtcacgc aacgtagaga aaatagattc aagtatgagg aagtttcttg    146760
     gaatgcatgt ctgggtggta aactactgga ttaaaacggt tgggtcgtca acagtccgaa    146820
     aattcctaag agaaaacaac tatagtggag agtttgtgta cttcctgtat aaatacttta    146880
     atctctaaac acctgtcctt tccagtttat ggccgcgtct ttttctccgt cttgactaac    146940
     aaatagaatg aagttcacca caaagtcgat aaactcgatc ttacttccct ctgcaagcgt    147000
     gagagtgcat gtagtaaatg gaatcttctc ggaaagctct atcttcacca atagtccatt    147060
     ggaatgatgg acggtatatc cagacttctt tctaaaggtt acttttggaa atgccgacag    147120
     ggaacgttca atgaggattc tagacatctc caaactcaaa tttatgtccc tcttcacagc    147180
     atacattttt cttctgttcc atagaaaagg tagaaagcat ccccccctta taggcttcat    147240
     tccacggagt atttcatgtc tccatgtcct cctttggtgg gtctgggccg ctttttcatc    147300
     aaccataaag ctgaggtcga caatgctgta aggacggcaa agacagactt ctccagggac    147360
     aaggaggagg tttcccgaca ataactttct gttaaccaag cagtaggccg agtactctct    147420
     ggagtttttg tctgtgatat tattgagaac atcttctttt ctgaatccta tttcaatcag    147480
     cctttcgata actttgccgt caataaaaat tatccttttt ctgtgatcct ctcttgtaac    147540
     atttatccaa ggatgcttca ttatctgatc tatttctatt ctcatggacc tgtcaggttc    147600
     tataatcctt cttattaggt cctttaattc atcggacaga gacccatcaa tcttcatctt    147660
     cgacaaaatt gcattcctcc ccatgagact tatgtccgca tcttcaaaag gcagtcttcc    147720
     atggaccatt gcatagagaa tcacacctag acaccaaata tcaacctcag ggccaacgta    147780
     tgggattccc ctcatgattt ctggaggtgc gcattgggga gttccgcagt aatcctttag    147840
     cacggaagat ctgtcgtaga atgccgaaag cccaaaatca catatcttga ccgactcccc    147900
     actgatcatg atattttcta gctttaagtc tcgatgcaca atagagtggc tgtggagata    147960
     atccactcca tacaacatct ggacaaacag agaccttgca tgtgtctcgc tcagtctccc    148020
     gtttcttctt atatacttgt gaagatcaat tcctctcact aactctagaa ccagtaccag    148080
     gtttctcgat gtgctgatac atccataaag cttgcatatg ttttcatggt ctaggatcaa    148140
     ttgtatcttc ggttcaaaac tattcttcca ttggtccaca tcctttttgg caaattttat    148200
     ggccacatcc atcccggtaa ttttgtcaac ggccgataat acatctccat agcttcccga    148260
     gccaagcact ccagttatat caaagttcaa aaactttctt tgaaggtgca tatgctctgt    148320
     tatttcctcg gagagtattt caaaaagtgt ttcatattat gaagcattgc ttttgtcttg    148380
     aatattcaat acatgagtat tggaaagtac cgcttgggag atgcaaacac agacagacgt    148440
     ttcggaaatt ctggcctcga tgagtataaa attctaataa ataatggaag acaaagttat    148500
     gctatttatc tatctagcat taacatatgc tatggaagag atgggatata tattttctga    148560
     gggaaaacag cgattcctga cacggaatgg agtgaacata gttgtaggaa gatcaaaaga    148620
     caagccgctc aagtttcgaa tggtggaaat ggatggcaag aattcccaca acatgcttct    148680
     ttttcctgtt ccaaagatgg gtggcaataa ggttgcagat cttgcactga atggcagcag    148740
     gaaatggcat ttctatccaa agcatggaaa ttggaatcaa agaacgaagt ttattctgtt    148800
     acctggaaac gctttgaaaa tcgttgttgg gtcggaatgt attggagtta gagaagacaa    148860
     ccaagtggtt ggagaaacct gtagaaataa cggagaagat ctttttcaaa tctttagctg    148920
     gattcctata agccaaaaga aaaaagtaaa agcatggttc cataggaaca gatatgagca    148980
     agaagaagaa aatcagaact ttcccgaaga cgacagagac tcgggctcgg aagataagaa    149040
     ctatggacca gataactcgc cctacgatag tgaaacaagt tcttctgatt attggagagg    149100
     ggaaaggcaa ttctatgatt tcgactatga tgggggatta ggaggaggat atggttcgtt    149160
     tgggcttgga atgggatccc ttggaggaag aagaagaaga tataggcgtg acgaagacca    149220
     tcttaaattc accgaggacg gagaagaaga cacatacaag agcgatggag gcaaagacta    149280
     tcgcgaagaa aggatgtttc ggagaaagag gatgggaaac tattccggac atagaaaagg    149340
     aagacatcat aaaggaagta aagaattgga tggaggtttt ctgcagggaa gagatatgat    149400
     gtttggagat cttagcagct ctgagatgat ggactacttc ggaaaccttc aggaatatga    149460
     caggaaaaat agggcactta ggggaaatcc tcctaatggg tgtgggaatt tggacgggat    149520
     agtatttgca gaaggttcca acaattgcaa tacaggaggg cctggggaga acgaaatatg    149580
     taggataaac aaaacaacga cggccttccg taagatggtt ggcattccta tttaaggcct    149640
     gtaccatgaa taaagatttt gccaatatca agttttattt gtgctttttt gatccacaaa    149700
     gctttggctt ctgtacatag gttcaagtag gcgtgggctg attgaagtgt ctgcaaaaag    149760
     gagaaaaaag tttaaaaggc aactggaaga gagagctatg gaagcctgga agatgataaa    149820
     taaacttgtg gcatacatag agcttcttat tgtaaccttt gttatccttt tgtatcttct    149880
     aggactttac gaggctgcca ttgtttctgg tgtatcgttc cgcatatatt tgcttctgac    149940
     ttcgttttac tactacgtgg ggtgcctggc gaagtctcct ggacagctcc tcgactttgg    150000
     aaatgcaaat gtaaaaggaa tatgcaatag atgcaacagg atagtgggga caaaaacagt    150060
     ccactgcgag atatgtaaca aatgctatca taaacgagac caccattgcc caataatagg    150120
     aagatgtgtt gcatccaata acctcaagga tctgtatttg gcggttttct tcatgagtct    150180
     tcattccctg gctgcagttc tgagaggttc gacgaagttc gcttacatga tgtccatcca    150240
     caagtatctg cttgctatgt cgagtgcatt tacatgctgg ctaacactcc ttatactcac    150300
     aggcaaaaca acaaaggaac tgaccagagc caagggcaat ataaccagcg aaatgaagat    150360
     ttccaggctg aaagacatgt tccgtaacgg gctgatggat acgctggtcc cctatctaaa    150420
     gtggaagaca cacattgtaa gataatcaag atttatttgg aacttcgagc tcccaagcct    150480
     ccattataaa cgtgttttta gactaactat tttctcttct tcgaaaaatg ttggcaagcc    150540
     tgttagcctc atttttctcg atattgttct ttctttgtct cctaagtgca gacacagtta    150600
     tttctccatc cttcactgct gccttcagaa tcctattttt cttgctgtgg ggcccgtatc    150660
     gaggaatata ttctcctatc tcctcgtcgt acacaagaga tcctttcttt cttcttttta    150720
     ttcccttggc ccttgcgaat ctctcccatc tcgtctcaac atgctctttt aagtattgct    150780
     tgggaaggac tattctgggc tctgggagga caaatacaag gtctgagccc ctccttgccg    150840
     actggcaggt ctttatctcc tttacaatcc ccttcaataa attagatgtt tcctgattca    150900
     gatccgagct tctaaccgca ttactgtcca ctatcgttag aaacttcaaa tgattcattt    150960
     ctctgaaggg ctgcccaacc aaataaaaaa tcatcggaca acaaacagat ggtccattgc    151020
     atcccgtcta ttctggacaa tgcattcggc aacccatagt atgttcttta tttcctgttc    151080
     cttcatcttg aagtacgaat acacacagct aaggtctcca tacattctaa acgactcttg    151140
     gtacttttga agctcggcct ttataaggac attcgagatg tcggagtcaa agtcataagt    151200
     ctcgctcaag atggatttta tgtcatccag actttcaaca tgggacaaga gctctcgagt    151260
     ctttagactc atggaatgaa cgtcgggaaa taatctcatt ctcttttttc ccactacatc    151320
     ctttgaattg agcgtgttta ctgtaatctc tattatctgc cggtctcctt caagcttcag    151380
     tatctccctc atatggtcca tgtcgtcatt aaggtttcta aatgtctcct caatatggaa    151440
     cttgaaaaac aatgtctgaa gaatttggaa gttgtttgca gaaaactcct tcttgaactt    151500
     gacctttctc tcaaatttcc ttagaaagct gttttctatg caatatctct ggacatcgtc    151560
     catatcgttg gaaaacttga ttgttctcaa tgcactgaag tctcctattt ctatcttctc    151620
     gaagcttttc tcaaggtttg gatcttggag tttacactga agaagataaa agaagttctg    151680
     tatcttatgg aagtccatgt agtaatcgag gattgttctt atacctttat cctctgcatc    151740
     gtggtaataa ttgaagtctg attttaaggc ttctaatagc ttcttcttca gctcaggctt    151800
     tgtataggca attccctccg agagtccacg gtatgtcctc gacagcttga ttgccacttc    151860
     ttccaggctc tcacacctct taagggcatt gtaatcttct tccttcagca tctcttcctt    151920
     tttcccattg atttcagata ttatgtatcc atacttctcc acatggttga attgtttttc    151980
     catgagtggg gaaatatgcc aaaataaata tggtatctgt cggttcatta tgcccatgcc    152040
     tctcaggatg aacgaagaac atgttctctg catggtggag agcatggtgg gtgccaatca    152100
     aggagaaatg tatgaaaaca aggtctattc agtaagtgat ggaagcaaag gaaagataga    152160
     caaggcagca ttaaagaata ggcttccaca aggagactgg aactctcctt acacagagat    152220
     aatggtgaga gtagaggacg acgtgaagat atcggtgcag aatagcccaa tatatatcta    152280
     tggagagtac acaaagatgg atagaaacat gacacaatcg cctttagtag tagaaggacg    152340
     actcaaatgc aataggagcg tgtcggattt taagtcccaa gtcaaggagt tctttctagc    152400
     agatgatgtt atctttactc ctgcaggaag agaagacttt gatgttcgaa tggttgaagg    152460
     aaggcccttt ctcctttctg taaaaaaccc ccgaagaaac ctcagctttg agaggttgaa    152520
     tctggctctt tataaagaag tcgaaataag aaacctgagc gtggtgagga aggaatgcaa    152580
     gagcgtgatc tttgggggag agaaccaatc aaacaaaaca tactctatat ttctgtgctg    152640
     taaaaaggag cttgccctgc aaaactatta catagtggaa cagaggacac cactgagggt    152700
     tctacacaga agagccaatc tggccaggat aaagaaggct tggattctcg aatcggaaaa    152760
     gagagaggtt gaagggtgga tatattaccg gattgttctt gaagccagtg ctggaatgta    152820
     catcaaggag tttgtgaatg gagactttgg aaggacagtc ccatctcttg gaagtaaaga    152880
     aaactactgt gatttgcttg agttggatgt cctaagggta gagaagaaaa gcatagaaga    152940
     ctttttggtg aggaatattg agctagatgt tactagatgc tgacccacca tagaacaaat    153000
     attttgaata aaaatcttaa ccgtaaatgt cggaactgaa tggtcttgag gagaataagc    153060
     ttgacggaag tttgaaagaa aaagatgttg gcaacgacaa ctctgagagc ggaaagactt    153120
     ataagagcac taagaagaga atactgtcga tgagagacga gagtaaagag aatcccaaac    153180
     aagttaggat gagttcatat tatgaaaaaa aggctgaaga gtctgggatt cgaggtgggg    153240
     acgaaaaagg cgggaagaat ggtatactga agcaagcaat atggagaagg gatctgtcat    153300
     acatcagtga gtttctgttg agaaaggaca gaggtctaat gctgaaaaca ttgtcgtatg    153360
     aagacaaaga ggtgctaggg gagatactcc ttgaatttgt tgaccagccg ttgcggatcg    153420
     aggcactgga gactatgaga gagattgttt cgagcataaa gaatgtcgga ttatttatta    153480
     gaaagctgaa ggagagagcc attgatttct caaagctgat ttatttgaaa ggtaagatcg    153540
     actacctaag atttacagca ggaaatcaag aggagaagga gcctgaaata actgtcaagg    153600
     gataactttt gctcggcctt atctagtgag gggtgaaaca cagtaaaaag tccaatggcg    153660
     acgtttatga tatgaaacac gtctggatct gaaagtactg gattggttac atgtgttaca    153720
     gaataaatat aaaagaagca ttctcatctg tataacaata tggctgactc agcaaacgaa    153780
     aacaacactt ctggagacag tggaaacaac aaagccaaga gaaacacaat aatcggaatt    153840
     attgtatgtg tggttgttat cacaattatt cttgccatcg gtgccaagag aggatggttt    153900
     ggaggaagca atggcggagc tggaggttct cctaagggag gaaaggttgg agatttgtct    153960
     gaatcatcca agtctaagct atctgaatcc aataaaaaga actcagccaa gagcagtgga    154020
     aaggaagatg aagaaaacag taccagcggt ggtatggggc agtcttccaa tctttatgga    154080
     taattgaagg atgggagaca attaaattga atcttcttta atttctgttg aggtatttcg    154140
     tatcataagt cgttaaacgg cggaatgttg aatctctttt tgattgttat tctttccttt    154200
     gagaacttat cttcgattgt gaattttgca ggatgagcac tgaagctgtc ttcttcactc    154260
     agtgtataga ctctttcgcc gtccttcagg cgataaaaca tctggggtat tggagaaaag    154320
     ggtaaaatag gcagtgccct ttagagagct tctcatggct gctaagaaga tgtggaacat    154380
     gttcctcctc ggtttgatat cgaccaatga aaagaagagg aagtttctgg atcggatgct    154440
     cttcctccct ggaaggctta cgaggattct cacagctatc aagtcgtttg atcagtcgaa    154500
     aatattctta agaagggttt tgaagaaaga cgcaccgaac tattacgagg taataaagaa    154560
     accgatggac ttaagcattg ttcagaagaa aatagggaag tataggtcct ttgaggagtt    154620
     caaggccgat cttaacttga tttgggataa ctgcctcaag tttaatcagg agaagtacta    154680
     tcgggattgt gctttcaaga tgagggaggt ggtgagtact ttcgagatag aagtggttcc    154740
     tgtgaaaatg gattcggagt ttgcaatggg ctcgaatgtc tgggagggcg aggaaaacca    154800
     agggcctgct atcaagtgga tgattagaag aatgattgga agagtccttc ttctttctgg    154860
     atatgggttt gtttctaaaa cagcactctg ggtgttttgc gatgtctttc agcacaaaat    154920
     tctggagata gtaaaagaag agtgcaaaga gaatggtaag tagatggatc ggaatgaagg    154980
     ccaagtcctt tagcccagaa gcttctattt taagctagga aaaattttaa ccctcgaaat    155040
     gggaagaagg ccaggaaggt gctacagata tctgtcgaag aaggcatatc cgaagtcaag    155100
     gtttaacaga ggagttccgg actccaaaat acagattttc gaccttggaa ggcgtaaagc    155160
     aggagtcctt gaatttccac tactggtcaa ctgcatctca aatgagagag agaacctgtc    155220
     tgcagaggca ttggaggcag cccgtatatg tgccaacaag tatatggtaa agcatgcagg    155280
     aaaggacaac ttccatctga gagtccgtgt ttatccgttt catgttctta ggatcaataa    155340
     gatgttgagc tgtgcaggag ccgatagact tcagacagga atgagaggat cctttggaaa    155400
     gccttatgga agggctgcaa gggttgtctt taaccagcct attctcagca taagaacaaa    155460
     ggacactttc aaagatgtgg ccattgaagc attaaggaga gcaaagaaca aattccctgg    155520
     acatcagaag atccaggtta gctcgaagtt tggattcaca aacatgttac gggatgaatt    155580
     tacttctcta aacgagaatg ggaagatcat cctaagggga gggtcttttt ctgtggtcaa    155640
     agagaaaggg agcattgaca acttcaagaa aaatctcgaa caagttgcca acaattaaaa    155700
     caacaacttt ctgtgtgctt ttcctgtttt tcaattccct agagcaagga taaacaaaat    155760
     gattgggaag gacccatgga tttcagtcgt gaaaagcctg tgactttgtt ttccaacgaa    155820
     gggaatctag gccagtgtga caatgccctc cgagctgcaa ttaatgggag tttgtcgatt    155880
     ggagcaagcg caggagatgg agctgttctg atatccttta aggatgtgcc tcctcttgct    155940
     ataaaggagg aggttaagaa ggtgttcaag atatgcgata caataggatg cacttattcg    156000
     gggcttcaac ctgactgcag aatacaggtt aacatgggat gccggatagc ggaagagtac    156060
     tacgacgtgt atggaagata tcctgatgta gatgtattta ctgcacactt ctcttccgtt    156120
     gtgcaagagt acacacagaa gagtggatac cgtccatttg gaacgcttat gatatttgca    156180
     ggtcctgtga aaggggttcc aagactatac caggtagatc ccagtgggtc ttaccaaacg    156240
     gcagatgtat gttcttctgg gatgggatat agcgaagcga agaagtttgt taagagaagg    156300
     ctggagagtc ttgatgacaa catggtcaac tgtgtgtcct ctgtgaggga atttgcgggg    156360
     aaagaagtgg gtcctgagga tattgacata ggagtgtatt acaaggacaa gaatgtattt    156420
     aagacattca ctcttgatga agttaaggaa gtgttcgact ctctgggcaa gaactaataa    156480
     ctttttgaaa taaacttctc tgagtatctg ggtttttaat attcacggct gttatgctcc    156540
     acgaggccag ggcccatatg gaaagggtcg agaaagagat ttctagaaag atagatttgt    156600
     gtctttacgg cgaagcactt caactaatcc attctttccc tttgtcatat gaatctggaa    156660
     taagtatcta tccctacaaa gggtatgttc tatatcttca aagaagatac gaagaatctg    156720
     ttacttttct aaaagatctt ctgaagaggt ttccatctaa tatcaaggcc aagagattct    156780
     tgtatctagg acttctaact ctaggagact tcggttcatc ttttagaatt gcaaaagaat    156840
     gctggattga tggggattat agaaggtcta cactcatccg gatactggca cattcttttg    156900
     tgctcaagga ttttgatttc cttgggaggc tcgacatgca ctgcgatgag cctctactcc    156960
     tgtcaatggg ttatatatac tctggagagt tagagcgggc agtggagtta atgagaaaga    157020
     tcaacgattc ccacggctcg gaaatatatc ttgactcgct gatttctgcc aagactaggt    157080
     ctgtatatat gctggattat gtaaggtact tggatgagga gattttcatc aaggcaatag    157140
     agagtcttga aaacaaactg aaggtatttg aaggagtcga aggagaggga tgtgattatg    157200
     tggacagtaa agtattacgt atagcgaaga aggtgctaag tagaggggag tacgaagttg    157260
     tagagaaaaa tatttaccat ggaaagaaaa tgaaacattg ctgccaaaag gaatgtgtaa    157320
     taggaaaact tagagccaga gcagaagagg atatgctact ccctaaaaag ggttttcgga    157380
     aaccaaaagg gagatactcc gagctagaag gtatatttga agagataaga aatggaaaca    157440
     tagaacatgg attggagagc ttgaaaagaa catatgggaa agaaacgatt ggcgatctcg    157500
     agaaacactt aaaagatggg caaaacatac ttgtcctgaa cgaagtaaaa gagtcctatt    157560
     tgaggtacag aaagaaagag aaggcattac attatgccaa gcttgagaaa gaagcacagt    157620
     cgttgcgtgt gcgagacaca attgaatgtc tggagaagct catggacgaa agcatggtta    157680
     gagagattat tgaatttctt gaattagatt tatttgataa gtaaatctcg tgcttatcca    157740
     ccgcctggga agatagtagg acatcgatta tttcttctca aggaacacag aaggtaccgg    157800
     cattccatcg acaataaggt ggcatatgta tctagcaaag ctttcatctg cacagtcatt    157860
     aagaaacaat tctatgcctt cgtcgttgga atagctaagc ttttctatct tacaataggg    157920
     acccatcatg gaagaaagat atacccactt gtctgtgtcg aggagttcct tgttcaactt    157980
     tgcaaggtag aatgtgacaa ggggatagat gtacacaagg caggagaata tggactctat    158040
     agccgggcga gggcccttat caatggagat aagcttgatg caggcatcat gaaatctatc    158100
     taaaaaccca gcatctataa gcatagagaa cttggactgg tctttgattg ctgatgagag    158160
     aaatattgta agggaaatca agagaggtat atgatccggg tttccaaaga acaggtctat    158220
     aagtgtgaaa taaacttctt tttggaatat ctcatccata aggagatcca gctgtcccac    158280
     cattagtctt atgtagagga ctagcttgga gtccactctt ttgaattcgg gaacttctag    158340
     cttagggcat ctccgagaac aatttaggat ctcaattatg tcgtatattt gcttgaattc    158400
     cgaatacgac tcctctttaa ggaacataga aatgagcttt tctcccccag acactatctc    158460
     gtcgtggaag aaatcttctt catcgctgga catcgacccg ctgtcgtcgc ctatccagtc    158520
     tgcaagaagc aacatcttta atgcaacata acactttctt tcgataagga cagacacagg    158580
     acgtgagtcc ttcagcagca tggccagctt ctgcatgtta aggcccttca gcccaagcag    158640
     aatcgaaaag agattcaatg ccggttcaaa ccaaagtaaa cccagaaagg agttgacaaa    158700
     gcgaccatca agagcctctg tcatgtaatg gggatggatc cgaaagtgaa aagctagaac    158760
     ctcaaaaaag tatgcaagaa cctttgacgt ggagttgaaa acaaaatatt ccaaatcttc    158820
     ctcatctccg aagtattcgc tgatttcgaa atttctgaga atttcccttg tctttgttct    158880
     atcatctgaa tcttctgtat ccgaagtgtt ttcccggaat tctccaacag atccaaataa    158940
     agcatccttg cttcttctta tccattcctc tttcgtcata ggatacacgc attcggaaga    159000
     gcatcccaag gaacggctcg aggcatcttc aattgagaga tctcctctat tcccctcgtc    159060
     cccaccagag ccattgcttc caaagtcaat tatccgtatg aaaacactca tcttctgata    159120
     gaacgcaaag ttgaatcggc tattttctgt gcataagcat tcgctaacaa gagcaatgtc    159180
     tcggaaatag cagaagttaa acacaagata gtccaagtgg tagatcatgt aatttgtaat    159240
     cattggcttt ttaagcttga actgtgttaa agatctttgg agaatgttat ggaatcgctt    159300
     ctggtccacg tcaggataca tcgaactatt ccccatcaat tccaaatttg atgggctttt    159360
     ccttctcaca ataaaacata actagcatat ctcttcatct tcgggctctt ctcttcttaa    159420
     tatcaaatat cttaccttct cttcttcaca tatttccttg aacttaggga agcactcgct    159480
     tcttataatc acgtagccat catgcacttc tccattcctc ctagcaaact ccataatctt    159540
     atcatttcct ccaacactga ctcttattcc aaccctttca aatcctatct tctccagctt    159600
     gctcagtatc tcttgggact gcttcttact atttccgatg tatatgttgt gcactttgtt    159660
     tatcgcctcc ctcaaagaag cctcattaag atgccttccc cctctagtca ctttgttccg    159720
     aagaaactca ataatctccc gctccgtctt ttcttgctcg taagccctag tcacttcact    159780
     cttctgttcg tgtccactat tcaatatttc aagaactatc tcttcgtgcg tcttattaaa    159840
     taagtccaga tccgcttgct tagctatctc tccctttgac acactccgat aaatcgtatc    159900
     cgtaagaaga atctcgctca aaggtgttgc cattccattt ctatattcgt aaagcttgtt    159960
     ggggtaaact cctagttcat acttcctccc aaactttcta agagcaatga cactaacatt    160020
     caccagcttc ttttggttca gcggtgtgaa catcgtgggc agagggtcgc ccagacacaa    160080
     aactttagaa aaactaaaca ctgaaaagct ttatcaagag aggaatcttc caaaccaaga    160140
     tctaagtaaa catatctatg acttccttag cattgagcct ctttttgtag ttcatgtcaa    160200
     gcatcagctt gcatactcgg tcaagtttga ctcctcgaaa gtcgtttctt cgaagcctca    160260
     tccagttgtc tccgctcttc ggaagaatga tctcggcaat aacttccaag tatatcaatc    160320
     caagactata tatatcacta gcttttgtac atacatcctg cagcacctcc ggtgccatat    160380
     accgcttgtc tccatcgtca tctatgtctt ctccttcgta tctgcttatg ttgaagtcgg    160440
     agatcttgaa tacaaacgac ccaggatccg tgggaaacat acattggcat ctttccgggc    160500
     acttctccct cgaaataaca ctcttcatca ggatattctc tggctttagg tcgagatgca    160560
     ctattccaca tgaatgaatc acttccaatc cgcttgctag ctcgtacatc atcttctttg    160620
     ttatcccggg agaaaacttg gactttctga gaaaatatac ctcatgaata taatccctta    160680
     gagtcccaat attacaatac tctaactcta taaatagata tcccctgctc tcccagaagt    160740
     catagtactt gaccacgtat tccgactcga ttcccttcag catctctatc tccctcattc    160800
     tgttttttct atcaagctct ccggaaatcc ttttcttgct tttctttaca atcgtgtagt    160860
     cggtatcgta cacacagagt tttctacttt tgtaaagcat caccggctcc tccaaatgat    160920
     gatttgcttc tcctcgccca tccctctgat ttacaaacac ttcgtaaaat gccccctctc    160980
     cggttttaca aataaagttg cacgtgcttt ctttgcctgt gtcagaacct gtgtccttgt    161040
     ctgtgcatcc aaatacatca cacgaggctg gatcgtcggt agttagggaa gagtcttgga    161100
     catctgttac gaaaggcatt gacggtataa acatatcttt atatggaatc cttttcgaag    161160
     gtgtcttggg agagctaaac attgcctctt ctctttcacg cttcagcatg tatatcttct    161220
     ttaaataggt catcctaggt tactcagggc taattcattt ggtaacgaaa taaccatcct    161280
     agcgccacca gggaattagc aaaattttct gtcgatacaa ctttgaacaa acgcacaata    161340
     actttaatgg cctgataaca tcacctgtta ggctttctat agctgtaagg aacctttcca    161400
     tactcaaaat cctcttcgat aaactcctca tctcccgagc ctctacctcc aatctgtcta    161460
     tcacccaatg cttcagagct atggatccat gccccatccc ctgtcttttg tactgtcctg    161520
     ccataagctc ctgtaaacga agatggacta tcttggatat caaactcgtc ttctggtttg    161580
     gaatattttc tgtttatatt ctttccatat ccccattcat tcttctgtct atactcactg    161640
     tcctttccct taggataggg aggctctctt acaaatcctc gtgggtctct ttctccatat    161700
     ccccccttat gccctccata gctccctcta tctccagcct tgcttccttg agcccatcct    161760
     gccctggtgt taggctctcc agagccccat ccgtgccctt tgtctctata tcccctgtcc    161820
     ccagtagagt actgccgtgg agatccagaa gatactcctg tccaattacc atcgcctctc    161880
     cgagaatctt tctgcaaaga tcccgcccct tgctccctca tctgccttat cgtgttcagc    161940
     accctgctta catcaaacgg tgacataaag acatcaggat tttctctagg atccacatat    162000
     ctattggaca ccgactcaat tcgggcatca ctttcgagaa aatccatttc cgcacacaga    162060
     gtcatataat tccctatcca gaaattatca agaacctctt tcatgtctcc gcacatcagc    162120
     gcgaaccgca cctcttccgg cgaaatctcc atcagatcaa gccctctgta agaggaataa    162180
     atccattgag gcggatctac caaagaagtg taccgaacgt ggtcatactt acacttcgac    162240
     ccaaacttac actttccctc aatgaagaag cggcatacat tcttcatctc tgcgttaggt    162300
     tataaggggt ctttgttttt tgcctaaata ctccacctca gctctcttct taagggaggc    162360
     ccctaaatga cgtttgcaaa atcaaccgag gagacaaaat actttattaa tttatatcac    162420
     ctccatcaaa ggttacagaa agctactcat ctcgcacatc ctctccaaca ttaatactct    162480
     tgatgtacat atctatttcc tctacaacat ggtccggaat cgttctcatg tccacttcga    162540
     tctcatcgtt ctccacaaac tccccggctc cattcttcag aactatcttt gcaacgcttt    162600
     cggtttggtc cttactcatg ttcaatatag catttccaat actaaccctc tcactcaacg    162660
     agtaagctct gcttgcagac gtctctccag tctgctcagc tagcttcgat tcaagcatcc    162720
     taatctcccg agtgtaggac atgatctttc gtttcaactc agatatcctg cccttgatgt    162780
     cgccaggtgg agatttctgc atatgagcct tcactgcctt ttcaaactct tgcccacatt    162840
     catatacctc cgtcccaggc gcattgaatt tcttacaatt ctccacaata agctcaagat    162900
     ccctttcaaa ctcatctgta ctctggtatt ttctttgttc cagcttgatt cttatagtct    162960
     gcatatccat gggctcctta attatagaat agtatccagg aacaagttct gcatcaacag    163020
     gctctagaaa tggccagttg tatgccttgt gcttaggcct cattagatct gcaagcacct    163080
     ccgaacagaa ctcatagtcc tccgtcttca tccctccatc aactggcttt acactccttt    163140
     ttggttgttt cggccttcct gaaacaggtg tctctgtctt cttccgcttc ttggggactt    163200
     cctggggcat tccctccatc agcccgttat acaccgtctc aagtgccttt cccatgtcgt    163260
     ggacaacagt tccaggagga ttatatgtat agcagttgtt gaacatcagc ttcatatctc    163320
     catcaaagcc ctccactcct tcatattcct tgtgatccaa tttctttcta atagtagaca    163380
     aatccatggg atgctttatc ttttccggat aatcaggaat ccccagcttc acaggatcca    163440
     caggctctag aaatggaggt gcattcgaat tccgcttaag cctggtcagt atctgcgagc    163500
     aatacttgag ctggtactca atcaagatat tcccagagtt tacttcgtct tcctccattc    163560
     ttttcagggg gtaagaaaaa ttttaaaaac aaaaatatct tatcctgtgt attatactat    163620
     aagaaccata ccttatactt ccagatctac accttgttac agctataatc ttggaatcgc    163680
     ctacttcgca tccttcctca tcacattaga cggtataggg aagcccttct aataacagat    163740
     gatttagaac ctaccatcag ctagtggtag tagtagcgct agaggaggtg gaggttagta    163800
     actttttgat ctcatccttg tttggcccag aaatatatga ggaaaatgat aggagagata    163860
     taaaaataat aggaaacaaa gttaggtttt tgtttccaga ataccggaaa aatggcacca    163920
     tgtattgcaa tatggtggtt gacactctaa gtataacaaa agtgggtgta agggttttct    163980
     tcatgtagct ggatcctcct cgaatgaatc cccaaataat aaaaattaac ataaaaacta    164040
     cctccggaag agtaattaca ggcattttag aaaacggttc cttatctgct ccatgtagtt    164100
     cctttcctga atcttcaaat atgatcacaa cgcctgcact gtttgagtat gtttcacgcc    164160
     tttggaagcc gacaatatac tcatatccct gccgaaagag attataaagg gaatacagga    164220
     gagatagaag actgtataat cctgaagagc agaacaaact tttggcgatg gccccgaagt    164280
     cctgattatc gctaggaagt gaagttatgt ttatccagat cgaagatatc atgacagaaa    164340
     ttgcaaaaat catcagaaaa attccaaaga aatctataac ttcatttatc ttgttcccaa    164400
     tcaaagctct acgaaacctc tctaaccatc tgattattct tgattcggat gctttctttc    164460
     ttgtctttat taggtaggtt gtaggaattt tgtgaagccc atctactact cccattgcaa    164520
     tcaagataca tgaaacatac ttgaacaatt cactttttat aggatcataa gaatgtatta    164580
     aacaaatgat tcctacgaat gaatatagga agcattccag gaagtttagg gctatagatg    164640
     ccatgtatcg gaaatcttct aattttttcc ctgctaattt gatcatcgag gaaatctttt    164700
     tctctatatc cataagggta atgtgggaaa actttaagat aaatttgtcc actatgggat    164760
     aggagcaagc gctagttttc accaataaag ataaatccca ttttatatag gggtatatgg    164820
     aagagaagtt taaaggaact ctaagcggaa agctccgtgc atgtctggga tgctctcaga    164880
     taaagacctt gaatgggttt agaaaagatg gatgtgaaaa ctgcccaatg cttgagatga    164940
     agggaaacct ttcgaatgtc aatgaatgca ccacaagcaa cttcagaggt gttgtagcac    165000
     ttctacagcc ttccaacagt tgggttggaa agtggcaaag aataggagag ttcaaaaaag    165060
     gactctatgc aatggttgtt gaaggagttc tctcggaaga ctttgttaag gacatcgagc    165120
     aggatggaag aatatactat gaaagaacag agtctttcaa gctgtaagaa aattaaaaat    165180
     ggaaatcttc gttaacaaga tttttgtggt acccttcatg gaaaaaattg atcttgaaaa    165240
     tgctgacgat gccatattga gagagaagtt gtttgtgaag gtagcaacca agcatctgcg    165300
     tactttagaa ttcaagatgg ttgaagaagg gtatgatgga gagctgatga ggtctcgaaa    165360
     ggaaatcgag gagggagaaa aggatagaca acgaaaagca gagaagatga tcaagaggca    165420
     tagtgagatg agattgaaga agaaatccag agatagagag ctggattcgg acgacatcga    165480
     gggagaagaa ttcattgcac ctatgttaag cagaaaagaa accagaagga aaaataaagg    165540
     taagcatttt ggaaagaagt cgtttaagag aaaacagatg aagaaaagac agaaaagaca    165600
     cagacactag ccatcgcaaa tacagagggg tgttgtttga ttaaaaattg gcaataaaca    165660
     tcgttagagt ttatgttttg taacagattt ccggaataga gatggttggt tacgtctctg    165720
     aaacctaaga ttctaggttg agacacaaat ggggagagtt gcctccttta aaacaaatga    165780
     taaggaatag atgttgagtc caaggctcat gagcatggat tacagagaac acatgccgat    165840
     gaacgataca acactgtcga gattcagaca atttcttgga acaagcatac acgacggata    165900
     taccagacat agaatatgta agagcttgaa aaaaagtcat acaaacctat acacaatttt    165960
     gaccgcaaag agtctttttg acaagatgaa aagagatctg ccaaaccaca tcgaaagaat    166020
     gaacaaaaga tcttcatggg atgtgaataa atttgcgtcc aacaggagag gaagagagtt    166080
     ggagaaaatg cttgggaatg aatatctcct atttatcgga tgtataataa tatcgtcaaa    166140
     aatatacatg gatctttcgt acaccaactt ctcatggatc gaaatatgcc atcacgggat    166200
     cgaccaaata aacgctacag agaaactaat cctacaagtc ctggactatg acgttagtct    166260
     tcaatggata gagctgaaaa aaatgtacga cgaattcggc accatgcctg gggaaattct    166320
     ctccggtcaa atagagatga agcaaagaaa aggatttttc aagtgggcat ttggctcttt    166380
     atttcgtctg atttcatgtg tagatacatg aacagcagtc aaggctaagt agatgtcaac    166440
     aataaattga tctgtgctct atgaatcttc aaatatttac tctgtcaaca agatctctta    166500
     cattttggaa acatcccctt gctcggaaga aaagttgtcc tcgctacgct tctgcacctt    166560
     caatgctcca aaaccaagct tcctgacatc cgaccctcta tcctcgacgt tgaatccctc    166620
     tgtttgggag gtctggagag acggaaacga gtttttcctg atggctacag gtttgtttat    166680
     cttatctcta ggttcccttg ggaggtctgg ctgtttctcg ctcattgtgt tcttttcttc    166740
     cacatacttt gcattggagt ccgaaaactt aggcattttc ttctcctcta ccttccgagg    166800
     ctctaaagcc ctttcgcttc tcttggtcag attttcaatg aaagagatcc ctggctcatc    166860
     ctccttgttt ttctcagaca gctcactaac agcatcggaa taccatttgg cttttgtgta    166920
     cttggctcga aggtctgtgt cttttccaag cttcggagca ttggagtttc cagacacata    166980
     cactcttcga agctcggaaa gactccatgt atccagaata gtagatttca ccttggttat    167040
     cccaactcca agctccctat gttttgcagc gcattctgtg catatgaaga atccataggt    167100
     cacagtcacc catatagggg atgagttgct gcagtccgca catcttttgt tgttggattg    167160
     cattcttgca tacttaaaga acttgtttac aagagacttg tcgagcactt catccccaga    167220
     catcagggct cttttaagga atgtttttga cttatgtcct cctctattaa tccaagaaca    167280
     cacagatcga acctaaaaga ctagaagaca tttaatttac acaataatct gttcaggata    167340
     cttctaatag gtgaaatatg gcgattcatg gagagagtag tgatggtggt gatgccttct    167400
     tcttggagaa aaatcggaat tagagtcaga atcggatgaa tggctattct ttcgcttttt    167460
     ctcggacttt tcgttgaata tgaatatttg gggagcctga ggatttggat ttccggcatt    167520
     gagctcggca ataatatctt ctgcactcga agcctttact tcagcaactg gagaaggagg    167580
     cttatactcg ggatcgtcgg gtgaatagac aatatcaaat gtctgttggg cgcttgatga    167640
     gcaagtggtt ccatatatat ttccactggc atcatactcc aagcatttgg tgccattctt    167700
     aatggtaaaa ccggtgcctt cacttccttc aatactgaac ttctgcgtgc ttccattatt    167760
     ccgcccatga aaaataagtt ttgattgccc acttcttgga ttatggaggt ctagaacatc    167820
     gttggatcca cttactttta tgaccttgat tccagaggat aagttttcgg tcttaaattc    167880
     aaccggtgtt ccagatgcag acatggctgc tagttgatag tctaggttgt aatctggact    167940
     acgccatatt ccccccttta ctaaatgttt cctctgtcca tcctttgtaa agattgtaaa    168000
     tccagaaata acctttacaa gctgaaatac tacaaatata cttttcatgg aatcggaata    168060
     gcatttttcc ttataaacct aatccaaaac agatctcgca tgctgtaacg cttctaataa    168120
     atcaaattga gaataaaaga ttttgtaaaa cacttgaaat tttatttatc caataaggcc    168180
     actatcatac aacaaagaag aatcttcaga agattgggag cgatgatgat tatcatgtga    168240
     tttggagcta gacggtttcc cagtgttaaa tataagtatt tggggctgag ggggtgctgg    168300
     attttcaacc ggaacaggaa cctcaacagg aacttcgacg ggtggtttgt attggggttc    168360
     tcctggtgtg tagataatac taaacctctg ctcagatttg ttggaacagg tggttcggta    168420
     catttttcct gaagcgtcgt actctagaca cttattttca cttttgatgt aatagcctcc    168480
     ttcattattt ttaacaatgg aaaacctttg atttgctcct ccatgtttac cccagaatat    168540
     tacatttgaa cctcctcctt gcatatccaa aaccttacca gtgcttttat ctgtaataat    168600
     atcaactcca ggagatactt cagtagaggt gaattccgct ggctttcctg tagtggtcat    168660
     gacagctttt ccactactgt tggaaacgaa ttttttttcg tcattctccg aggtaatcat    168720
     aaaggcaaag gctgtactga ttatgcatcc aaaagaaatt actttcatta aatataaagc    168780
     tagtagagct ttcccttata ttataattct aatacagaaa cagtttcatc tcttgataca    168840
     taacttccga attaaatctt aaattttacc acacataata cttcagttag gtgatgtttt    168900
     gaaaaggcct ttggatcaaa cagggtactg tagtttaagt atggctatat tcttctttgc    168960
     attcccaaac atttaacgat accccggcat gactaaagcc agagacgaaa agagtgaagt    169020
     gtttgaagaa gtctctgaag taggtggtaa ggtcgaaagc cgaaggccaa ggaaagaaac    169080
     attctacaga aaaagaacaa aaatagattt tgagagcatg tgctctgacg atgtggagag    169140
     actgataggg aacgtagata tcctaaagga cgaagatgcc gacgatagat acacggctct    169200
     caacagatcg tttcttattt cgtgcatggc attgaaggat catgaagcaa gcttatcgcc    169260
     gctgttttcc caatacaaga agtttttagc ctttatcaaa agatctgatg attcaactgg    169320
     agatccaaaa ggcgaaggcg ttggtatgtt tagtttttca ctgtacgact tcgggccttt    169380
     tgaagaggaa agggtgcccg gggatagaaa caacagtcag cacaaatgct ctcaagggga    169440
     aatatacaag ttcctgacaa ggtattttgg agtggagtgc ccaaacgcag ggacaacgac    169500
     gagttcatga attctctgga aacattcaag aggatggaaa agatggccga gtttccattt    169560
     agcaagccgt tgaagtttag gaaggggcct ggaatgtcgt tttccatgtc gaggagagag    169620
     gacataggaa atcacaatag gaaggttttt gaggccataa cggcgttgag aaaagacccc    169680
     aatgctctaa cgtatgtgaa aaaccctgat ttctttgaag acagttctga agaggaggaa    169740
     cgctctgaaa acaggtatgt agttagagag accatcaaat gcaaatacta tgacgatgga    169800
     aaatacaact tctttggaaa tcttgtcctt cgaggatttt caagaagtgg cctgaattac    169860
     attaatatga gagaaggagg aaatattatt ttcaaagacc tcgagaagag ccagatgaag    169920
     ttagcctata gtaaaggaga agattcgatc tacatgctga tggagaagac catgatgatt    169980
     tacaaaattg tttgtaggca tcctatgatt gcatcaagta tatacaaaca tctaatggga    170040
     gatgagtctg atagttaaac tacttaaaga tttaatttat taatttttcc taggacaaat    170100
     atcttgatgg taatcccact caaatgaaaa cgagatttgg cttgaagccg tttatatttt    170160
     tatctgtatt ttcgtcttcg aatatgatgt ttgcagccaa actgggatta gcaatgctag    170220
     ggatcgttta tccatgcatg tatggactga ttaccctaat atgcctagtg ttgatacaga    170280
     aaaatacagt ctataaactt atcggtattg gattaattgt gttatatttg aagatgttac    170340
     ttggtccttc ctttggactg gaggagtctt taaaagaatg catttccgct cctgacagta    170400
     aagccaatag ccaagatgtg gatgaatata gctcgtcgag cgaggatttt attgagggag    170460
     atggcaaaat agacagccat ggatgtacaa gggagaatga acaaacatcc cagacacttg    170520
     attcgttgtc caacatcctg aataatcata atgcacgctg ccgcttctgc tccggagtta    170580
     ctttctaagg tgagtaagac aaggtttttg gaaaacgaat ctagaattga ttgacatttc    170640
     tgtgcaacaa accatattat tttacttaga ggaataaact tattatttga gatgtcaaga    170700
     gaggactaca taaaaggaga aaaggggctt tagcttcgat ataaaacata gtgggttcca    170760
     cagaaatccg atgaaagaca agggttctta caatcagggt ttggaaagcc aatccacaga    170820
     gatgcttctg tcgatactgg aacattatga tacgaacttt attgaggaac gtattattga    170880
     cgaatatgca gggatggact cctctaagaa aatggcccag agtccctggg gttcggagga    170940
     tccgggaaaa tgtaatcctt tccaagagaa ggaggaggaa tcagagtatc tggagtctca    171000
     aatgatatgc aatttcctaa atagttatgg catggatgtg ccggaagatt cttatggaag    171060
     agaagaagga aagtcagttg cacaggaatt agggaaagag aatgagggtt tagacggccc    171120
     ttcccaagga atactccaag gttccactgt tgatctctca gaacttcgaa atctcacaga    171180
     ccctatatca cttgaaaagg ctttagaatt tgaaagatta tctatacaca aggaggagct    171240
     ggtaagaaat gcagaatccc aaaagaaaat tatcgaggca ttccgctcga ttccaggatt    171300
     ggccataaag gaaaacttgc ttaacgacat caagataaat aaagtgtatg ttgaatctag    171360
     aattcatata aggaaggaga atggaaagga tattagagaa aaaagaaaca taataaaggg    171420
     tgagagagaa agagaaggag gaaaggaaac catagtattc aatgactatg tctcttctgg    171480
     atgggaatca ggaagcgaat caagctcaga tattgcagca aaagaaaagg catttaaggt    171540
     cataaaggag gctgagagaa gagcaacagg aaaagatcta ctgtgcaatg cagatatgca    171600
     gctgcgtaag tttgttgtgg accaggaaga gaggtaccta agaatagaaa aggttatgaa    171660
     actaaacgac cttaagtaca agaatctgat ggggaaaatc tacaagaaag gaaagaatgg    171720
     aaagtaccaa tacaattggt tcacgttgaa aaagaacttc tttacatgct ataacggaaa    171780
     agggaccaaa acaacatccg aggacttccc ctacgagaag gagtgggatt tcaagaatcc    171840
     cgaagacgag gattttttct ttaagagaaa gtacactata gaccttctta atgcgggggt    171900
     gtatcttgta aagcaccctg tttgcatagg atgtgtaaaa tggggatgcg ggactgatga    171960
     agacctgatt gatatttcgg aggacacaaa gataatgaga attacaccgg ccaagagcca    172020
     ctttctgatt tcccttaaga agaatcttgt aaagacagaa atcaagatga ccactcttga    172080
     ctttgcattg aaggctaatg gagagaccta cttctatagg atgaaggacc tagatggttt    172140
     tctgggatgg ttagttgcgt ttgcattccg gcaaggtaag ataaaatgta atatcggctg    172200
     aaataatgtt tggtgttgta gtaatgaaga acagaaagga gggtccttcc aaatatctct    172260
     tgatggaaga atattagaaa taaacttcaa gtgatgaaat attgtaaaca gcccatgata    172320
     aaagactttg acatggttga gtgcccgttc aaggccgaga ggtgcgtact ccctcttgta    172380
     aaaacagaag cggggtatga gatgaggatc tgcgataggc ctgatgccaa gaaggtggtt    172440
     gcaacgaagg ataaaagccc taaaggatat ttccacttgg aaatatctgg ggataagtgt    172500
     aatataattg gatacacaga gaacatatat tccttcacaa caccagcaga cttctatctt    172560
     cctgttccca agcaaacgaa ggaattttat tctgaaattt actcaaaaat ggtttatggg    172620
     gacatgagcc agtgcatgga gattgccgag atgtttgata agtcatatgg ggacaatgaa    172680
     atccccatgt acccggttcc gattatatcc acagttgaaa gctttgaaaa ttataatttc    172740
     aaggacttca agggaggaaa agacaaaacc ggagatacag ttcatgtggg atacgaagac    172800
     gaagttcctt tgtgtccagc ccctggtttg cttgaaagac tgaagaaact ccacggagta    172860
     gatgcgatga ggttacagga agatttattc aaccgtttat tttccctgca tccaattcta    172920
     aggatatcta acatcataaa gatgttcagg gcagatgaaa gagttgcaga aatgggattc    172980
     agcgactgga aaataaagaa gtttctgcct ctgcatgcat actttattga ttcgggaccc    173040
     tggagaggat gctgggcaaa attcggcttc gaccctaaag aggaccagag caactttaga    173100
     taccagatat atgacagccg gaaatcgggt agaacttttc aagtctttga ggcagaaaat    173160
     gttgttcacg aggttgagag aaacaagtca tggtatctgg ttggcaagcc gagcttcaga    173220
     atgggatttc acaccaaggc tcttttaaat ctccttaggt ttcgatatga gttagatttc    173280
     catcctaacg aggaggatga agacgaactg gagttcgagg tatttgactg agatgaagaa    173340
     aatagcttcc agcccttccc aacgaactgg gaaactagac aaaagaggaa aaaatttatc    173400
     cctcaaaatg gtaagtggac cttgaagtaa tttcagtcta ttaaagaagt tagagtcata    173460
     ccggatgaag caggattgta catgccggac gatattccac aatttgttga gaagtacaaa    173520
     gcaaaaacag cccgcaagcc aagggctagg agaagcgact tgagcaaggg aatggttgtc    173580
     gttgttctgg aaggggtttt tgcatctcga agagtagtct atttgaaggc gctggaagac    173640
     aatctcgctc tctgtgctgg accaaagtca gttagcggag taccattttt caagattgac    173700
     gagagatatc ttctggcaac atcgactatt ttgagtattg gtgtggatgt gaatgtcgac    173760
     gaaaagaaca ttatcttatc agagagagac gtttatgatg tgcctatgga tgttgagatg    173820
     acagatgcag agaagaagat tgatgaagag attgcaaaag ccgtcaagga gatcaaatac    173880
     atgaggacct atctttctga gccatttgag atcgacacta caagaaattt ctactccctg    173940
     aagtattaaa ggctatccat tggtttttat ttgtacttac catgtttctg tggccagata    174000
     cttccaaaag agaaccccct ttgtccttag ggtcttttca tttcttttct ctcttttgta    174060
     tagagttcat gggactcttc aaggtttagt gggatatagg tgtttttata gctggagatg    174120
     atggggaagt gcctggaatt tgccacagac aatctcttcc tacttgttag gcagagaaac    174180
     cccgaaagaa cctttagctc ttcctcgtca aacagattcc catacttctc tccaattata    174240
     acttgagcgt ctttggtttt ggagtaaatt tccacatcaa gcaaatcaga ccacttgtat    174300
     ctgtcctgag gggcccccaa ctcctcgaat atcagcttta tttgtgacac ttcgtcattt    174360
     cctctgtatg gcggtctccc aagtctcatt tccagcatta tacatccaac agaccatgca    174420
     tctatcttga agttatagga tgtctccccg agtaacaact ccggtgctct gtaccagagt    174480
     gtgcacactc tgtttgtcat catccccgaa atctctctgg ttaatccaaa atctgtaagc    174540
     tttagcattc catgatggtc tattaggata ttgctaggct ttatgtccct gtgtaccaat    174600
     cctaactcat gcatcgaact tacagcctct atgagctgcg atatgataga tcttgtgtgt    174660
     tcgttactga gcttggtccc cgacgcaaga agccctgtta gatcatatgg catgtactcg    174720
     agaacaacaa atataaagcc ttcctcgaat acaatttcgt tgagccttat tatgtgctta    174780
     ttaattacac tcttgcagag ctttatttcc cgtatggccg tgaacgggaa gcctgtttct    174840
     ctatctacag gcatcttctt aattgcaaac acggttccat cggctatcct tctggattta    174900
     tacacctgcc caaacgctcc ttcccccact tgcttaatat tttcatactt ctccatcagg    174960
     gtcaatccgt gagtatgtct cttgtttgga tttgggccga agtcctttcg ggcaaattca    175020
     aaagttcggg agataaaaaa tcatttgagt ttattgttat caatccctag cagatgatat    175080
     attatcttcg cttccttcgc tatcgaccaa ctcggaatca atgagattgg attttttctt    175140
     ttccttctta tctgaaggct tccccccttt cttttcttca ggatttcctc cttcatcccc    175200
     tcccttgttt ccctttccat cgcctttgtc ttggtctttt ggcttttcgc tggcaccaga    175260
     atttttatct ttagagtcct ttccgtcctt tccatccttt ccctttttgc catcatcttc    175320
     ttttggttct tccattgagc tactattgtt tccactccag agtttagagc gatgagtaag    175380
     agaagaagag tttccatcct tgccaccctt cccatctttc tttccatcct tgtcaccttt    175440
     ctttccatcc ttctcgtcct tgccatcttt ctttccatcc ttctcgtcct tctttccatt    175500
     cttgtcatct ttatttccat ccttctcgtc cttgccatct ttcttcccgt ccttgtcatc    175560
     accgttccca tctttgacat tagaagaaga tagacttgat tgtcttagac ggtgtcttct    175620
     caaatttgtt aggtttgagc catgatgccc aattccatgt atccttttaa gggcctttgc    175680
     catgagaagt cctgagacaa gtattagctt cttcatgttt attttccgtt ccttagtatt    175740
     tatatttgat tctaaaacat gtttcacaac ctcaaaatcc gtttttgatc atcttgtaac    175800
     ctgttttaag tgtctatctt ctagaaagat ttgttgtaac attccctatt tctcactaag    175860
     aagaaattat cgatcttagc aggccaaaga gtgaatcttt gtatattaac tttttatcaa    175920
     cggcttggat atcccggtat tttcgattat ttcaaggtac tcgtcatatg tcatttctac    175980
     agcaagatgc cctatttccc cttcttccga agttttagaa atggcatata gaatcccatc    176040
     gtcatattcc atggatacaa atccagacct tagggaaagt gacagataga atatgttctc    176100
     aatagtcttt gagaatgact ctggattaat tacaagcctg aagtattcta ttctgtccct    176160
     ttccgaaacc aatctcctga tttgcatgag aatccctgac tcttctgtag aatccttttc    176220
     ccgagtaatt agtactggaa tttctgcagc aggaaggtgt tgtcttgatc tttgaacctg    176280
     ggatcttttt ctactcgggg cttcttcaga aaaaactaga gaaaaacaat ttagaaactt    176340
     cattcctgca ttacatttca tggcatatct gtagaagtcg tcgagaaggc tctttctaaa    176400
     caactcgaca aatgtactcg atgtaatgtc ctccaaatcg atgtcttttt ccatcctcgt    176460
     ccatgccagc tttgtccaca gagcattcat ctttgcatcg agcttaagct cagaagatgt    176520
     tttgatcttc ctaaacagca tgttggatgt gtttattaac tcctccaatc tagacttgtc    176580
     ctcgagaagg tcttctctct gaagtcttat tttctggaga agatccaaat aatcgtttcg    176640
     cactccacct tcgtctggag aaagctcacc accgttcata gccctaggat gtttttccgg    176700
     taatttcatt aaagaccatc gggcaagact gtataattta tactttcaaa aggacttgaa    176760
     aagtcattaa cattcttaaa tctattgtct tttctacctc catatcttct taccactatt    176820
     cccgtagagt tctgaagaaa cactcctgta agtgtgtagg cctcaagctc aacattcctg    176880
     catccattca ttcttatctg atgtgcactg caagacactt tacaatcctt aacattgtta    176940
     agaactaccg acttttcaca gcaaaagtgc tcaaacaccg cgttggtgca gtcttcaatg    177000
     acaacctcca cacagtcttc aatggttaca agttcgtctc tggaaccttt gatatatctc    177060
     ttgtctttga taccatctac cttgttttct cgcctttcaa atgaagttaa gctcctgaac    177120
     ggaatggtac caatttccgc tcgattgtga tcattataaa tcttctttaa ccttgccacc    177180
     ttctccaaca agactctcct gccatataga gatggttcaa tacgaatccc atcttccatt    177240
     tccaaaataa tctttcgagc tccttcaaag tccccttctt tgatcttttt aacagcatcc    177300
     tcctccatca gggcgaacaa ttactgctca atatactcca cggcttaaca cagtaagaag    177360
     gtttaattcc tatctaaata tctttttcta ccagacttgt cttcaaaatc ctcatgtaaa    177420
     acacaatccc ttctcttcct atctcctccg gatgaggagt aacctcatat ttatctatgg    177480
     aaattctctt cttaaacata ggacagtcaa gtattatgct ttcgtattct cctccttctc    177540
     cacagaagtt cacttccaga ccctggaccg cctccagacg gtcataaatt tcatcaagtc    177600
     ccatgtttat acattctctt cctaagagag acgatgcaac cttcactatt cttccctcca    177660
     tcccattaga tatcatctcc ccaagtagct tcttctgatc catttcccag agaggagaca    177720
     gacacctaag agacaacctt ttacacacat cctcaactct gttcttttgg tatttggaca    177780
     aaatagcccc agaagatacg ccttcgaagt atatcttttc ttttgccgag gcaatggctt    177840
     cataaagatc ttcaacttca tcaccttctt cctttttata ttgaagattc tgatttatac    177900
     tcttgcattt cgtctcgtaa ataaaaatag gaatcccgag acattctcca agcagatcgg    177960
     ccacctcgga tccaacagtt tggtacataa aagaatcttg atatccatct ccgcatctca    178020
     tgtgaagcag gcctacaacc tgatgccctt cgcgctgaag aacatgcata gcatatagac    178080
     tgtccttccc cccactggcc agtgcaaggt atttcatctt tcgaggatta aaaatttccc    178140
     aagtaaagag aagcaattca agcacaatta ctctctaatg atctttaatt tttctgatca    178200
     tttcttcagc ctcctcaggc atgtcgatcc cctttgaata gtaaaacaaa gtttcctctt    178260
     tgtcggtgga caatatggga tcaaacacct tccataaaag ttctacctcg tctaagttca    178320
     cactgttaag acttttgttc cttataagac tgtcaaaaat gatttcataa tctcggtatc    178380
     ccccgtaact ctcatgcatc aaatcgttga ttcttttttt atcatgcaga acatgcttga    178440
     cggaatctcc tccaacaaga acctcgagaa acacctcgca ctctggatag atgttgaaca    178500
     ccagccttac cacatctatc tcgttgatat gaacagtttt gttagaaagc ttcttttcct    178560
     cgcagaaaag ctcaatgcat tttgaaaata catctctttt aaactcaata gatatctcag    178620
     ttctcttttc attcatccct tttcctgcga caatgataaa gggaacttta gaccatcgag    178680
     gagtgtttac attgatagga actatacaga atgtctcagt gctcgaatcc ttgtggatct    178740
     ccttgctata gtcatcgtat tggccataaa tacacttctc cgcatcaata gtacatgcat    178800
     caaagatctt ggccctttct aacgcttcca tagtcctcga tggttctgta acgtccgatg    178860
     caacaacccc aagaagttcg gccatgtggt tctgaactat atcctttacg attccgtttt    178920
     tgtcaaagta attccttccc tcccctccaa gaacctcctt ggaaattatc tcaacacttt    178980
     tgacatgcct attattcatc gtctccttca tagcacttga cccccttata attcctggca    179040
     ttgctatgac caatggtttc agaagatagt ggtcgataaa ctgaaccttg cttaggtcaa    179100
     actttttcat ctgtgcaaaa gactcgatgc tctctccata tggcttttcg atacatatta    179160
     ccttgtactt aagcttcgaa gcctccttaa gtatactggt gtacacagaa ggtggcacag    179220
     aaaagtaaag cactgtttct gggtcggcta tatctttaag cctcgaaagg tcgtcatagg    179280
     atcccctgac gtattgaacc ttcgaaagga actccggaga gtaattccca acctcttgaa    179340
     gaacttcgga gtattcaaca tcatacttgg ttcttgcata tccaacaact tcaacatcct    179400
     tgagatttat cctggaaagc gcaggaaaaa gttttctttt tgcaaggtcg ccactggatc    179460
     caaagataac gaccttcatt ggggcactct gtcttatgct taaataatat tttttgtaat    179520
     cccaaagtaa tcaataagat ttctgcaatt gccttaagtc aattttccgt caattagaga    179580
     gaagaagagt gactaataaa taacgctgga agcagaatcc gtttcttttc tcttcagaat    179640
     cctaacaaaa tccacctcga caattttctt gtccttcttg tggaaatcat gtcttcttgg    179700
     aagttcatac ttaatctttg ccaaaacctc ggcacttgga tatctcgcaa ctatatattc    179760
     tctagtgctt gtcttatgga gggaatatac aacgtcacag agttctaagg ccttgtcaac    179820
     agcctttatg tcggcatgtt ttatctttgt gccaaatgga ggattgatta ctgctgtgtc    179880
     aaacttctca ttgatgaagg taagatcgtc tatagagcac cttaaaagat ctacattagc    179940
     tttaaactta agattgttct gtttgaatac cgacagagcc aaaggacata agtcaactcc    180000
     aaggatgtat gatggtgaga agtagctgca agcaaaagat agcattccgg tcccacagca    180060
     taggtccaaa atggactttc cctcaatgtc atcatatgta gagtggatga tgctaatcat    180120
     ggatgcggct atgtctggtg gcgtcatata ttgctctagt ccaacactca ttttggaaaa    180180
     atcttcaact ttggaaagct ccatctttaa tttcttgact ttcatgcaaa gtacagaaca    180240
     cggggcattc atacagcgat ggtttggctg tggcaaaaag ccaccactgg gattcgaacc    180300
     caggaccctt agcttacaaa gctaaagctc tacctactga gctataatgg ctcgctctct    180360
     aaggaaaata cacacatcct gggtagagat gctccattaa aagaagctgc atcatcaagt    180420
     gcaagcttta aaaaggattc aacaaaaatt ttactctttg ttaaagtcgt tgacatcata    180480
     ggaccccacc ttggtccatc cttcctcatt catgtagtaa aggttgatga atcctccaga    180540
     aaaggcgtct cgatgggctg catggaaaat agcctccttt cccaagttca aggcttcttc    180600
     cttactcatg tcgaacctat agcatgaaga aagaattcca taagctattg tggatccgct    180660
     tcctacagag aacaagttgc ccttaattct ttttccagcg tcgtcaacat aaaaaataca    180720
     tggctcactt ccgtcatatc cacagagcat agtccccatc gagagaccat accccttgta    180780
     tttgtataca cagttgctta ggtacatgct tgctgcagac actgttattc ttcttccgtt    180840
     tgtgagctca tagttctttg catacagacc cacaagcttt tcccagtaaa agcagtctgc    180900
     tgctcctcca gccatcgttc caagcaagtt cttgtttatc tcaattacct tctttacggt    180960
     ctgagaagct atatatggcc cagatgttgc cctcgagtcc accgcaatga ccattccctc    181020
     tttaaacaca aaggcaagag tcgttgttcc atagtacggc tttataaaag acttgattag    181080
     ctgctgatca atgcaggtgg tatcaattct tctgatgtct ctcttcaatg tttcttccat    181140
     ccaaggggtt tcaaaatgcg agaaggagat agtatggtca attataaaga aagccccgag    181200
     agaatggagg atttgaaaga aaagatcttt caatttggaa tatatggagc aaagctggaa    181260
     aaactgagta aagacgaagt agaaatcgct attggagaac cgtgggtgga aatactaaaa    181320
     gtcgaaacaa tagaaaatct gaaaagaaac ttcatcaccg attgcttgag aacagaaacg    181380
     aatggatata tggtagataa cttccactgg gacaagctgt atgtaagaat ggggacactt    181440
     gcctggaagg attatctaac tgctgggaca tttaatttca catcgaaaga gtactttcta    181500
     ataatgagtc ttcttataga gaccaagaag tatgtggaca atgtggagct caggaagttg    181560
     cggcttgatc ccaagaaaac ccactactgc attaaaaggc ttgtgagaaa aggatttata    181620
     gaatacagaa catccgaaga aacagagaaa aaaaacttta tatacaaaat taaggcaatt    181680
     ctggatgaaa gaggatttat aacgcggaaa gtagcacaac cattaacaga ctcggggcgg    181740
     attgatgtgg ttggaagaag acgcctgttt gaataccgaa tcgaaattgg actatacgac    181800
     aacgttcggg aaatgatctt gagctctgag ggaggaataa ttacaaagga cttaaaagac    181860
     aagcttggag ttagctcaaa aataggatac aagcttctca ataagatcta caacgaagaa    181920
     aaggggattt tcaaaaggat tgaggaattc cagggccgta ttaggagata cagataccat    181980
     gcggcttgca aagagctttc ctaccaagtc cctgaggaag ccggaactgt agaatatata    182040
     acctcggaag aaagagtaag agctatcaaa aagcttatgt ccatgagttc tgttcttcag    182100
     cttgataagc agacctatga aaaacttcag gagataacag gatggaaata cgagttcgac    182160
     agaagaacca taatcagatc ggctatactt gcagggttta agatatacaa gcaaaagaag    182220
     ggaagggaag gaaagtgcag cagatatatg ataataagaa acgaggtctc tgaatcggat    182280
     attgaggcct tggatgtgcc aagcaatgtc atccaagaag acatgtccga attccaaaga    182340
     aagatataca acatctttgt taattcacca aagcttgtgg agatggacaa cggatacatt    182400
     cctcagaggg aggaaagact acagctgttc tataggtttc ttgtggaata tatggccttc    182460
     caaggagtaa aatcgctaag atttgactgg gaggtggtaa aagaaatgga atttagcctt    182520
     ttgctatcga tagttccctt cggcagaatt ggattccgag agtctctctg ccaattcata    182580
     gactcaggag agacagatag taatgcgttc agagcaaaag aatgcatttt atctggaaag    182640
     gcagaacctt caaacatcac ttctcttgcc ggaaagaggg tctccgatgt tgttgatatg    182700
     aagctacccc agagcataag aaagcttatc agattaaaaa taggagtagg aaactttgta    182760
     tccttactca agcagatgaa agacctccaa gttctcgaca ttgagatatc aagcaagaag    182820
     ataatgataa aagaaaactc catggatctc tcttcgggga taagggcttt tgagagggta    182880
     aagagatcca agagcagtgg aaagtatgtt tccctggaaa agaggcttga attctacaaa    182940
     aagatacgca atgtcgagga gaagagattc tatgacgagg catacagaac catctacacg    183000
     gaattcaagg gcgatgagtt tgaggctatg tttgatagat tgaaaatgtt cggagatgaa    183060
     gggatagatg atataaagca aacctcgttg gaaagactgt atatagaatt caagaaaaac    183120
     ataatcgaac taggatggat aggagcacta gatttcaatt catactccgt ttcggaagcc    183180
     aaaaaagtac taaaagcact ttctcgagac aagataatag caaactataa gggcataaag    183240
     aaagtggagt ttgtcacgcc gcacgagagc tttctccggg taattaacaa gaagtacgat    183300
     gtgttcaagt tcaaaggata taatcagtac aaaggaacgg ggtacttctc gcattacttt    183360
     gatctagtct attacacctt agcaacatct ggatccttgg aagttaccga attaatttct    183420
     cgtgtcagat tcatagctga tttcgagatg gaaatgtttc tttctgagta taaaaaagtt    183480
     tttaaggtct ctaatgtcaa taataccaga attatctctc tcggcatatt catggatccg    183540
     tttgaataga gttagttctt ttctttttca agtctaagaa gttaagattc cgataaaata    183600
     aaaaagtaca ccatgtttta ccacctttat ttgtaacttt tgttttttgt ttccttgtca    183660
     cgtttactta tcatatagac tggattttct ataaaataaa tttttccctt tatctttttt    183720
     cagtcctcgt ttccttcgcc agagcctcca cctccttcct ttatcatctc atccttcagc    183780
     tggttagctc cttgaacaac ttgttcagct ttttcactca cagcttgatt aaaaagaggc    183840
     cgaagtaaat ttctagtagg atcccctcct ccagaagcac taatcttccc aagcatgcgt    183900
     atggaaacca aaaacgagct caatcctatt tttccaagct tcatgttact ctagagattt    183960
     tgatcttata tactttttcg tctccttttt cctcctttct ccttggtttt attggagtgg    184020
     atttggattg taaaggagag ctgctttcga aggattgaag aaggaaagaa caggaggtgg    184080
     agttcaaaac atgatgtttt taacgatatt tgtattttgg ataatagtcg gtagctcgaa    184140
     cgctgacgag gagctgaagg agtttataaa aaagtctata aaagaagaag ttacgaagga    184200
     gatgtatgaa attgtggaaa agaccacaaa agatatgaag gaagatatgg aaaagaagat    184260
     tgacgaattt atgtcagaaa aaatcccgga gcacgaggaa aaggttgtgt tagaggagga    184320
     aaaggttgta ttagaggagg ggcaggattt ggaagaggaa gaagagtctt ctgcaatgac    184380
     tattttgaag aaggctgggg aagcccttgc cattgtagtt atatgcatat tgattgtgtt    184440
     tttggtctca aagattttgg aatactaccg aaggttaaag gactgctctg aatgacagtt    184500
     gcggaagcca aaactatatc aacctcaata aataaagact ctaaaatttt gtctgttatg    184560
     attttggatt ttatctaggg gtgagatgaa acataagaag caaaaaacgg gcgaggccag    184620
     agttggatcg ttagagaagt ttgaaagact agcccgagaa gctgtagatc tcaaggttcc    184680
     ggttggagtg tatggggagg ttggaagatc ctcattggta agtaggcttc attcagggat    184740
     ttatagcaaa ggtggacggt tggttgagat tgattctcga gaaataactg atgcaagaac    184800
     attaggaggt ttctatgcag tcaaggaagg agatgttgag tacatgaagg gattactgat    184860
     tgagtctatg gagagaggag attgggtttt gttcaaaaga attgataaga accatgggct    184920
     gatgcaatat ctttttacgg tagtaaagta cagaaggctg ctgggaaacg atgggaggga    184980
     ggttcttgca catgaagatt ttaggatatt ctttacttcc aatgatatat tggatatgga    185040
     tgacattgtg tttgtagggc cacttgggtt tatgtttgaa gaagcaatga tgatgtttga    185100
     gatagcatgt gttagacagc ttcttatgaa agttttcgaa gttatttcta ctcactggaa    185160
     ggggtgttcg aaggagaaag gagaggaatg ccagagaagt tgccttaaaa ttgcatgcaa    185220
     gaacaacgga tggtgtttgt ttaaggaatc cacagtttgt ggagcccatt tccgatctct    185280
     ccagagaatt aagaagagac ttgaaggcag taacggaact aaaacagagg agcgagtaaa    185340
     ggtatatcaa tcagtatgca atgtattgct tagacacgat tcggattctt taagatatct    185400
     tcttgcattg actgatattc cagatatttc acttcatgga ttagactttg ctaaaactag    185460
     ttctgttgaa tggggcatct tcaatcttct atggaacatt aaaaacagag accacacctt    185520
     attaattgga gatacagggg tgggaaagac ctcaatgatt cagtatctca gctcgaagtc    185580
     ccatttcttc ttgggagtag cgaccaagtt aagggttgta aacatgtcgg cagactttga    185640
     tggaacggat ttaattggag gatatgggac tctagacatc aacaaggcta tagagaggat    185700
     atgtaatcag gaacggctaa gcacaccagt ctgttatgga aacaaagaga agctcgaata    185760
     tctgagggag aagctttctc ttcgaaaaga agatgggtta aaacatgaag gggctatcaa    185820
     aaagattgat gatcttctca aactactaga aaaaaaggtg cattttgtct ataaaaaggg    185880
     aattcttaca gaatgtatgg aaaacggaga atggctgctt cttgatgaaa tcaacctttc    185940
     ctctgaagag acacttgacc tgatagacgg ggtcttgggt aagaaggaaa tactcctcta    186000
     cgaaagtgga gacttgaggc cacttgaaat tcatccggga tttatgctat ttggatgtat    186060
     gaatcctggg ggagattttg gaaagaagaa gtatgagggg gttgaattta atagcgtgca    186120
     tattcatgat ttcagtactt cgttgaagga tattaatctt gtgattcatt ctgtgcttaa    186180
     gtatgagatc tccgaagaaa gaaagagcaa gataggggaa ttctttttgg aattgaagaa    186240
     caaggttaga aagggagagc ttgggaatat agttgagccc ttgataagcg gaagaagcct    186300
     tgttcgagtt ttaaacttta tcagaagaag agcagagaag gggtttgagc agtctgtatg    186360
     ggagggattt gatttgtttg tgttcacaca gctggacttt gttagccgtt ctattgcaat    186420
     ttctctcctg tcgaagtact ttgcaaccca atccttgagt gttgaaagga caaaagttaa    186480
     agatggattt gttctaacac acaggattca aacatatctg agaataatgg agctaggggt    186540
     tctatctaac tgcccattgc ttctacaggg ggatacatct acagggaaga caagcatggt    186600
     tttgtttcta tccaaggaga tgaataagcg tgttatcagg ataaacaacc acgaacatac    186660
     ggaggcttct gattacattg gtagctttac ttgcaccagc agaggagttg aatttcaaga    186720
     aggagttctt gtgacagcaa tgagaagagg atattgggtt attcttgacg aactaaatct    186780
     tgcatctagt gatgtacttg aggtgttgaa cagactttta gatgacaata agcagatata    186840
     cattcctgaa atagatgagg ttgttgttcc tcatgaaaac ttccgagtgt tcgctacgca    186900
     gaacataggg tatggaggta gaaaaggatt gagcaaagca tttagaaatc ggtttgttga    186960
     aatgtttttc aatgaaggag gggaagaaga gatactagag attcttcatg gaggatcggg    187020
     gcttcctaag agcttctgta agaagatggt tgaagtttat agtggactta gatcgaaaag    187080
     aagtgttaat gctctagtga cccttcgaga tcttttcaag tggtctggaa gagtgcccag    187140
     aagcttaagc gaggtatgtt ttctaggaat gagtataata tatgaaagac aaagagaaga    187200
     aaaagacaga agatgggtat tccaggtttt ttctgagtct ttcggggaag tagaagtgga    187260
     aaggtatgga aggattatca caggaaaaga agataaggaa gagatagtaa ttggtaaaaa    187320
     gggaaccaac ttgaaggatt tatccctagc agccgaagaa ctttatggaa agaagctcgt    187380
     gtttaccgat acattcagga aaatgattag tctgacggtt ctagcatggg aaagtaaaga    187440
     accaattttg attgttggag agactggaat agggaagaca aaaatatgcg atgtggtcag    187500
     ctcgttgttc aagacaaagc tgattacttt aagcatgcat agaggtatag agagctctga    187560
     cttcatcggg aattttgttt ttgagaattc aaaggtggta tggaaggatg ggcctcttgt    187620
     cagagcaatg aagaacggag aagcattcct gattgacgaa atcaatttgg cggaggattc    187680
     tgtgcttgaa cgactcaaca gtgttttgga accacagcgc accctataca taacggagac    187740
     aggaaaagag gtggttgcac acgaaggatt tcgaatactg gcgactatga atccaggagg    187800
     ggattttgga aaaagagagt taagcccagc acttagaaat agattttcgg agatgtactt    187860
     tgaagtctcc tcggatgaga ttcctctggt atttgatcat ctcatagata aacggcttga    187920
     agaagtaggt atgccaaagg agagcagaga tatgttcaag tctttggcga ggtcacttga    187980
     tacgtctatc aggaagcttg aacttgtggt tgattttata tacaggcgct atactgggag    188040
     atttgaagag gttgtttgca tggagatgtt tgatgcaata agtgcatgga gagaagcact    188100
     agaaattatc gaggcgaaca gttctgaaat agagacgaga tacattgaaa acgaaaagat    188160
     gtttggggcg tttccatacc tagtaggata caaaaaccca tcctcatttg attttgaatc    188220
     taaaacacct actttaaatc ttaggagagt actccgagcg atgggattgg gaagaggaat    188280
     tatgctggag ggagatcctg gaataggaaa gacaagtata gtgcaggaga tagcgcgaaa    188340
     gatggggaaa aagtgtatta gagtgaatct aagcgagcaa acggagctat gcgatctgat    188400
     cggaagttat ctcccaattg acggggaaat ccgctttgta gaaagtgagt tactacacag    188460
     tcttaggaac ggaggatgga taattcttga cgagattaat ctttgtactc agagtgtgat    188520
     tgaaggattg aattctgtgc tagactacag aagaaagctc tttatacctg aagtcacagt    188580
     tgatgttcat agggacaccc gaatatttgc aactctcaat ccatgcagct ctataaatgg    188640
     acgaaagatg cttccaaaaa gctttcttga taggtttgta agaatcaaga tggacgggta    188700
     cacggcggac gacattgcac aaatcctcca caagatgttt ccaagacctg tgatagtgag    188760
     ttcggccagt ctaagagaaa atatccgagc aaatcaaatg gggagtttgg aatctaagaa    188820
     tattaactat tttatagatg agtctattgt taggattgga tctgctcaca tccaaagaaa    188880
     gggaggaaac ctggattttg tactagttca ttcgcaactc cagcagatgg aaatgatcat    188940
     gaaatgtgtg gagatgaata ttccacttgt tatatctaga ggagtgggga gagattcatt    189000
     acttcggttt gtatcttctg tgtttgggca ggaaatgatg ctcttcaact gccataagga    189060
     tacggacgtg tgtgatcttc tcgggcaata ccaaaagatg gaaaatggaa tgtttgaatg    189120
     gcgtgattct gcaattgtgc aagggataaa aagaggaatg attgttgtct ttacgggagt    189180
     tgagtttgta gagaaatctg tttttgaccg gttaaatcct ttgtttgaat cggaaagaat    189240
     attgaatata tatgagagag ggattgacac aaatgttgta gttaatccat cgacacgatt    189300
     aattctgtta gtaaaagagc ccagtatgct atcaccggca ctacttgata gatgtatgca    189360
     tgtggaattg agtgatagac tcgactatat tgatttgtgg aagttgtttg taaggcaatc    189420
     caactctagt tctgtctttc atgaagactt ttatggtctc tctatggacc gcagccaaat    189480
     tgattttgga ttggatttaa agagattgag gttgttggag gtatggccta gttttctcgg    189540
     cagacatctt tgtggtgtat ggaatgcttt ggaggaatct aggattgacg agatgttcca    189600
     attccaaaga aaaaacatag aaaattatga gatagatttt gaaattcttc atttctacaa    189660
     caagatccga ctttatgttg aaacaccaga cgacgatgtg tccaaaatta acctacttaa    189720
     aagcatttct accatgagct ctgaagatcg gaaagcagtg gcatttatca agtctgcaga    189780
     tctctcgatc tttagccgtt ttcatgatca aggagggtgt tctcttaact tcccgaaatc    189840
     atccagagat ctaaaagtaa aggccatcag gtgccttcga gataagaagt tttctgatta    189900
     caaaaagtta agaatgattg tggagcagct tccggatgtg gaatggcttc tccattccga    189960
     cttcgatatg tttttctttg agtttatcga aagatgctta aatgatcctc tggagatggt    190020
     aaggaaagga ttgatagcag agatgaatga gtttgaaaac aaaagccttt cggagatata    190080
     tggtactatg aagaatatgt acaaatatgg aaagggatct atagagaaga tggtggatag    190140
     atatgaaaag ggtatccagg aatataaggc caaaatccag gagattgaag gaaggatgaa    190200
     cagagactac ctgaagttta ggaattcctt aagaggccta gacttttgct catatatgtg    190260
     cggagataag gccttatact cagaattcga tgatattttg gactattatt tgatatactt    190320
     gttttatagg tggtcaaacg gagaaggatg ctcgggaatg tgtaaaatca agcgcatagg    190380
     ggtagattgt acgaaatacg gggacagaaa tagtgttgaa gaagaatctg gagactatgc    190440
     gagctatggt atcctgtgct taaacttaat tgaccgcggt ttggagattc ttccactctt    190500
     agggaagatt gactgcaagt ctttaggaca tgaattttca agatatctaa actcgttgta    190560
     ctactcgagg tcggtggaca gacatagttt gattttggag ggaattatat tcgacagaag    190620
     gatacatgtc aaggaagccg attggattga tcatctgtta gagtttaagg aaaaagatct    190680
     gaacaggtgc ctaatgttag tgttcaaagt caagggaagg gctcagatta ttgaaaggga    190740
     aacaacccgt ttggaaatag aagagaagtt ggtcgacctt atggatcaag aaatgctaga    190800
     gctccctata ttcacaagca ttgggtatct catggaatat ggaaggaaaa aagtagattc    190860
     tgaagactac gaagctcttc tacagaagga cataagtaac gcagactcag actcggataa    190920
     gatcttggaa tcgacaatag ttatatcagg acatcgggac aagagaaatt ccagtgctga    190980
     taaagagttt ggactccatt ccataatgga agccttagag agattttata aggatacgtc    191040
     tgtctgtgac atagagagaa actacaagta ctttctgtac ctaatcacaa cgccatttga    191100
     ctttgagatg gctgaaagat attttctgga ctgttctgtt tatgagtttg tggacaggat    191160
     tagacatgca cgggaaatgg cagttaagaa tgaagacccc gttttctaca atgtgacttt    191220
     gaagtacgtt tcatttgaag tagaaagtgc ttatgaagat agaattcgag atgctaagtc    191280
     gaaattaagg aaggaaccca agctatttag aaagaccctg gaggatttga agaagttcct    191340
     tatattacct gtcacaaatg ttctaaatct taagtttcct caaccgtatc ctctttgcca    191400
     gggatatcat cccaatgtat gtgcaagcct ccttagggag agatcggatt gcgaatgtga    191460
     ggattggatt gagttttcaa agaagtttga ccgaaaagaa gttgaaagaa tttttgaaaa    191520
     caacaaagtg aaaaagaaag atgtacttgg gcgcttcctt aacaggatgc ctgaaaagat    191580
     gttttctaac tccgaagtat gcctaggtaa gattgttaat caaatgacag aggacagagc    191640
     aataatgggt cttactcttg catgtatcga gaatccatac atcccactta tgtatttcac    191700
     atttatattt gggcgtcgag aagaagaggt ttccgaggag gaaacaggaa tgaagagcgg    191760
     aacgggaaat gtcaatgtga gtgaccaaat taaacatgaa gatgagatag atgatgagta    191820
     tggagagcga gagaaagtaa gtgaaagtga tgggatagat tttgacaatg atggaagtgt    191880
     ctcgacggtt tccgagtctg aggaagaaga atatgaaagc ggagtagatg gatacaatga    191940
     agaagagagt gaaaaagatg aaaatgaaaa cgaagaagaa ctcaagaatg aacaagatac    192000
     agaaatggat gttgaagacg agggctttgg atcggagaaa agtgaagatg gaggagaaga    192060
     acaattgggt ccagatgtct cagaagaaga tacagatgct agtaatgtct tggacagcac    192120
     ggaatcagaa agtgaaggag aggcaaagtc acaaaatgaa gaagattcca acttccacaa    192180
     cgagcctaaa acaagcgaat accaatttaa agaaggaatt cttaacaaga atcagacgtg    192240
     tgaggttgca gacaattacg acagatatgt tgcagggaat aaccaagagg atcgagcact    192300
     ttgtcaagga gaggggaatg aaaagatttc aggagatgaa gattctggaa gtggagatgc    192360
     atttgaatct actgtaagaa ttagaataga ggaagaggat tgtactaagt tgacgaatat    192420
     gctcaagata attatggagt caagaaaggg aagcaagtac aaaggagact ttaagagtgg    192480
     aaagaagctg aacatgaaga ggttggttcc gtatatagcc agtggattca gaagagatag    192540
     gatttggatg aggcgccaaa gaaatgataa gaaggattat atccttcgct tatttattga    192600
     caacagtaag agtatgtata accaggagat gattgacact cttttgtctc tatattcgaa    192660
     gataaacaaa tccttctctc tgcttgggat accggttgaa gtttatagat ttggcgaact    192720
     cctggaaaga agtacggtag aagaaatgag attcagtgac tcccaaacca tgatcgactg    192780
     gatcgacgag tttgatgatg gaatcaacat tattttgacc gacggtctct tccagaatgt    192840
     aggacatcat caccccaact tcctagtcct gctgatcgac aaatgcaacg tcaagagaat    192900
     gtctaaagta actgtttcgg aaggatccgt gtttgtccag agatacctag ataccttccc    192960
     tcttaaatat tgcattattt caagtgtaga tgaacttgag tctacattcg tgatggcatt    193020
     aagcgaactt attagttcct aaggattaca acgggttttg aaccaaataa aaacttcttt    193080
     agaaaattaa gacctttgaa atctagacaa gtattgagca ttgtaggatc tccatagaga    193140
     aacaggattg agaataattt aattcagatt gcacctattt tagaggcgat ttgaatggcg    193200
     tctccctctt tgtcaaatcg gacatatgcc ttcttcccat gcttgttgat caaggtgttg    193260
     accttcttga ctttgcatcc atagagctgg gtaacggcat ctctaatttc cggcttggtc    193320
     gaggtcttct ccacatagaa gaccaggatg ttgaactgct ccatgcacct tgcagccttc    193380
     tctgtggtga gtgcatagag tattatgtcg tgtggggtgt ttcttggcat ctttgagacg    193440
     aggttcctag gatgcttaaa gttcctcttc ggtgtatcca tgggggcaag gaggaagagg    193500
     gtttttgtta gattgttgtt cggatgttgg aaacagtttg tggggtgtat gtggaagcac    193560
     agcctctgta gcgcagtggt taacgcgttc ggctgttaac cgaaaggtcg agagttcgag    193620
     tctctccagg ggcgtttttt gcccttggaa atcaggtcgt ctcaggtatt ttgttcgttt    193680
     tctatggagt caaatttacc gtctttttta tcccaaatga cagagtcttt tcagaagctg    193740
     gagaagatcg gagagggaac ttacggagtt gtctacaaag caagagaaag aaatacaaac    193800
     agaatagttg cattaaagaa gataaggctt gaaaacgaga acgaaggaat tcctgctact    193860
     acaataaggg aaatattact cttaaaaaac ctaaagcatt caactattgt cgagctgagt    193920
     gacgtaatct ataataacaa caaaatgtat cttgtatttg aatatgtaga actagatctc    193980
     agaagatacc tggacaaaat gaatgacgaa ggacgacctg ttgacaagaa cttcgttaga    194040
     aaaatgtcct ttcagctgtt aaccgcaatg gaatattgcc attcaagaaa catttttcat    194100
     agagatttaa agcctcagaa cattcttata gatcctcagg aaaatatcaa gcttgccgat    194160
     tttggacttg gaagagctgc aggtgttcct ctaagaacct atacaacaga agtggtaaca    194220
     ctttggtaca ggcctccgga actacttttg ggatgtaaat attatgatgc atctgtagat    194280
     gtatggagtg ctgcttgcat tatatccgaa gttgttctta tgaagccttt tttcccagga    194340
     gactcggaaa tagaccaatt atttagaata ttcaaggtcc ttgggactcc aaacaactcg    194400
     aggtggtcga atgtagagaa ctttccaaac tataaagtag aatttccgat ttggaaccct    194460
     gtcgatttaa agacgatttt caaggcagat cccgacttca tcgaccttat ttcgaatatg    194520
     cttgagtacg atccaagaat gagaatgact gctaaaagtg gtttgtctca cagatacttc    194580
     aaaaacatgg tgcctatact tggatgagat tatccccagc agttacttag atactatctt    194640
     tggaattagt ttctcgatag ctaagacttt agagaagtca gatataaacc tttaatctta    194700
     taggacctct gttctgggca tcttctcaag ctccttgttc agccatctga atgcatcgat    194760
     gatttctctt ccgttctcat cgttggccga agtcatcgat cccgcctgaa gaacacttat    194820
     cggcacaaca agtgatggcc cgctgtactt ctcaaggcca aactcgttct tgatactcct    194880
     catcacctca ctcctctcat gttctttcac caggtcaatc ttgtttgcaa gcaccagcag    194940
     cggcctgggg ctgttcagga tgttcagtat cctccacaat tcctcgctcg actttccaaa    195000
     cctctgcgga tctgcacaat caaccatgta tatgatccca catccctcgt tgatgtactg    195060
     atgccagaac ctcatgaatg agttctgtcc tccgatatcc cacacttgga acttcatgct    195120
     ccccagactg acattttcgc agttgaaccc aagtgttggg acggtttggt ggacttctcc    195180
     agtctgcaga tacagtaaaa gagttgtctt cccggcaccg tctaggccta tcatggttat    195240
     cgacctctca gactgtccag agaatattgc tcggagcctt gtgtacaata tattgtttac    195300
     cttggagatc actgctccca ttgtttaccc ccgatatttt tgttttttat atggcctgtt    195360
     ttaattcctc atggctttat cttggagtgt gcatgggaac aagggagagg aaagatcaaa    195420
     caaattcaat acacattctc ggaatgaaac aaggaaacaa tataagagag ataagcttta    195480
     gagggccatg agaagaacat taggagcggt attaattttt gccttgaaga tggcatgcga    195540
     cgtgataagg cttgttccaa catgtgatgc ggagtgcatg aggggaagac tcttggcctc    195600
     atattactca agtcctgccg gcgtgaatct tctgcagacg gcagccaaaa atgcgccagc    195660
     caagaatctt gtagggggca aggtgacggt ggtgggtttg agcagccgca gtgcaagtaa    195720
     gcctccggcc ccaaggacgc ctggaggagg gcaaataact gtaacagcca ctgttgtgaa    195780
     gactgtgccg atggagatac ctcgaagtgt gcaaccgcct gttgtggtgc tacagcccag    195840
     atatcttgta cagccaatgc ctattccggt gaatgcaatg agtgtggcta cagtaccaaa    195900
     gaggaatgca aagccactcc ctgcaaggca tgttgtggaa gagaagcctc atggggagaa    195960
     tgagatgatc aacaggatag gaaggaaggt gaacctaata tataccatgt taagtactct    196020
     aggacagaga tatcttcaga tgcctccgca gacgccaagg gttgtgttgg ttgcacctgt    196080
     ttctacaagg acagtcttca agacagtgtc gtctcctgcg ccggcgagaa gcagcgctcc    196140
     tgcttcgaca caatctgcct cggtaatcac tcttacaaaa tgcattttct tgcctcctca    196200
     gaccgagaaa aaaccccaag cacagacttc cagcaccagc actagcacca gccccgtgtc    196260
     ctctgcaaag gagactctgg ggggaaataa gacggtgggc cctagaagaa ttcccaagaa    196320
     gccgcggaat atagatttcg gagagagcag cagctcggaa agctccatgt ccgagcaaag    196380
     ggaggagaag cctctgtaca tgttgaagtc cacagggcct gggcgaaaga agaggagaag    196440
     aggagatcca tttattgatt gttatttgaa aggagatcca tccaccagat gcacgtcgga    196500
     cagttccgag gggaggccgg acataggcga tgcagttatc tacaggagcg atctcgacag    196560
     cggcgacgag atcatatatc ttagtgagct gttgcaagga tgacggcaac acacaccaaa    196620
     tattattaaa gcatgtgttt tctatgcagg gtcccgatgt gttttcaagc cgtcgaagaa    196680
     tggatggttg agggcgtctg gagcagtgat cctggttgaa gagcagagat caagcatcct    196740
     gtagagcagg tcgtatccct cggagccgac ctcggcccac gggttaagcg actcgataat    196800
     tgtctcgaag gggattctct cctcgggaat tgtgtctatg ttcgacctcc acagtcttcc    196860
     gtagaacttt gcagcctttc tcatttctgc gtgtccaaag atcgttgcaa tctcgacaat    196920
     ggcgtcgata tcctcggacg agtagaagaa gggatattgt gcagtcagga tcgtcaagaa    196980
     aatcaccccc acaaaccaca tgtctatggc tctggtctgg tgagggtagc ggaacaggac    197040
     ctctggtgct cggaacccac gtgtcccggc ccgaggagcc ttcatctgcg gcctggagtc    197100
     tctctcgtag tatcccggag gctttgtctt cgacacaatc gagttgaaga agagcagggg    197160
     tgtctggggc ttgctactgt cctttggaag atgttcctcc ctgcggtctt cgtactgggc    197220
     aagcccaaag tctatgagca tccctcttcc agtctcctta ttgtacagaa agttccctgg    197280
     cttcaggtct ctgtgtatta tgccattgcc atgcacatgg tctatcgctt ccaacaggtt    197340
     gtacagatac tgcttgatgt cattcaggcc tgcattggaa ataaactccc ggaagtcgat    197400
     gggcttgaag tacggaaaga cagcaatcac ctggtcttcg ttccggaaaa ccccgagaag    197460
     ccccatgcag ttcctctttc cctcaagtgc cttcagaaac gtcagttcct cgagaaccct    197520
     tgctggagag ctggttcttg ttattacctt cagagcgaca tgtctcccgg cctctgcatc    197580
     aagggccttg tacacaacac tgaacgaccc ttcgcctatt ttttctatgg gcgtgtactt    197640
     tggtatgatg aaggacagat gcttgaggtc ggactctggg atcttttcct cttccatccc    197700
     cctttccagg ttttttattt taagattggg tgtggctctg ccataccgat tgtctttcat    197760
     ggctggaagg ggatggagat aaagggtggg aagggtagcc ctttaatgtg tggaggactc    197820
     aaggccgatc tgtttgttag atacaaacaa atggaaagaa agctcaagct tctcgagata    197880
     agggaggcgt atgtgcgcaa ggaagtggag acgctgagga gggaagagag acacagcaaa    197940
     gaggagctgg atagagtcaa gagtgttccg ttgataatga ggcagtttct ggagcctatc    198000
     gacaactcga cagcaattgt ggggtcgaca gcagggagca actttgttgt ccgaatactg    198060
     tctactgtgg accgagagct gctgaagcca aacactacag ttgcgctgca cagacactcg    198120
     agtgcgattg tggatgtgct ccctccggaa gtggacagca cgattcctgt aatgggggag    198180
     tctgagaggc cggaggtgac gtatgcagat gtgggagggc tggatgtgca gaagcaggag    198240
     ataagggaga cggttgagct tcctctgctg caatctgagt tgtacagaca gataggaatt    198300
     gatcctccgc aaggggtgct gctgtacggg ccgcctggaa cggggaagac gatgcttgtg    198360
     aaggctgtgg cgaaccatac aaaggctaca tttataaagg tcaacgggtc tgagtttgtg    198420
     cagaagtatc ttggagaggg cccgcggatg gtgcgggatg tgttcaggct tgcaagggag    198480
     aaggcgccgt cgattgtgtt tatcgacgag gtggactcga tagcaacaaa gagatttgat    198540
     gcgtcgacat ctgcagaccg ggaggtgcag cgggtgctta ttgagctgct gaaccagatg    198600
     gacggatttg accagacggc aaatgtcaag gtgatcatgg ccacaaacag ggcagacaca    198660
     atcgaccctg cactgctcag gccgggacgg ttggacagga agatagagtt tccgcttccc    198720
     gaccggaggc agaagaggct tgtgttcaat gccatcacat cgaagatgag cctcaaggac    198780
     gaggttgaca ttgagagcct tgtgtgcagg cccgagagga taagctgtgc agacatcaat    198840
     tcgatctgcc aggaggcggg aatgcttgca gtgcgggcca gcagatacat ggttacgcaa    198900
     aaggactttg aagaggcata ctcaaaggtt gttgagagaa gcgacacaag gcctgcattc    198960
     tacaattaaa tagtttgtgt tttcccgact aagaggcctg ggctggatct aaagatgtga    199020
     acatcaaaga aggtatttaa ttgctcttat cccgacttcc cttccgtttc ggaagagtgc    199080
     cttatctcct ccttacacaa taggattcac ctttctttgc ggtagtttgt tcttgttttt    199140
     aaagataaga agcttccccc taatcttttt ctttacaaga agccttagct tgccttcaag    199200
     agaagaggca atcttgcgtg ctttagaaat ttctttcttg cctccttctt tggtggtgga    199260
     agcatcctct tcttggataa tgtactcgtc ttctccctct tcatcttcct tttcttcagc    199320
     agcatcttca ctttcacctt gctcctcttg cttttcctcg gcaacatctt cctcttcttc    199380
     ctgcttttct tcaacagcat cttcactttc accttgttcc tccggctttt cctcggcaac    199440
     atcttcctct tcatcttcct tttcttcagc agcatcttca ctttcacctt gctcctcttg    199500
     cttgtcctcg acagtgtcct tgctttcttc ctcttccttt tccccgacgg aagaaatatc    199560
     cttctctttg tcttcaagag gaagaagatc tgtttccttc tttattagca acttcctaag    199620
     aagctttacc ttctcttcat ttccctcctt tggaagattg gaacagagaa cagcagttaa    199680
     aactagttga agcaccacaa tagatctgta tttcatattt tgtaaggttc aaaaaatttc    199740
     ttttttatac ttttgtgccg attattaatt ccttcattta aatgtaagtc tttaatacag    199800
     aatataagaa gcattatgtt ctcccaatta tttccataga acagttgaat gttatcatta    199860
     aattaagaat caatccagta tatcaaggtt ttaaatggga gttttatata cattattaaa    199920
     agttggggac gagtgagtta tattaaagta agaattcaaa tttctagtct ttgtattttc    199980
     tgttagtgga cctaaggaaa gctaatgaat ggatggtttt tatttcatta aatcaaattg    200040
     aattgacctg acggagaata ttttaatatt actttgcaaa tgtaaaaaag tcaacaagta    200100
     ctatcaaaac tgttagaaaa ccaggagtcc agagcttctc aggatataaa tccttccttt    200160
     atggttgcaa acatggatat tcaggaggaa aagctaagtc ggattatgga ggagagtaga    200220
     gtggaataag attataagag gaaggttaga ccttatccat atttaaggct gaaagtggac    200280
     tgaacatatg atttataata aaaagacaga ggttaataaa ctttggaatc ttcttaataa    200340
     ggtatacatt atatttaaac aatccaaaaa atcttgctgg taggaaacag gataaatgtg    200400
     aactttggaa tttcattatt ctttcctaag taatggtctt ttaaggtctt aaaaagaaga    200460
     ttctgcctca aaaagagatt ttttgaaaac tctaaaggtt aaagaggtat aaactctaga    200520
     tggtcccttt gataaaatgg gaaggtgttg aataaagtta tgatgtgcat acctagagaa    200580
     gaatgcaaaa tatagagtga attggatagc ccgaagataa aaccataaga ggcatatgat    200640
     gctaactttg aaattgcata gaagtcgatt ctgaaaatag aagattaaac aatatctttc    200700
     cttaggccat taaagatgtt tgtttcgtat cccattacag atggatgatt tgaaggaaaa    200760
     gttggattct ttgaccaggg aggcccggag tcttaacaaa gagttggaga aagggtatga    200820
     agaaataaag aagttaaggg caaaggttag agaactgaag gaagagataa ttgaaaagga    200880
     tgggaaactt gaggaattga cgtcctgcat atcaaggtta agaaaaaaaa tagaggaaaa    200940
     aagtaaggaa gttggtaaca gggaaaaggc tattatgaat gagtgccgga gaaaagagtt    201000
     acttaacgga agaatacttg ggagctctag aagccaagaa aactattaca ttagtttaga    201060
     gatgaagatg cttaacgaaa ggattgaagt aatgagaaga tttattcttg caattgcgga    201120
     aaggtttgga tttgattttg aggtttttga tgatcttaca aaaatatctg aaagccttga    201180
     agatcccgtc atatctgcac ttttggacag catctctcca agaaagagag agctttcaaa    201240
     taaggagaaa gaatagtatt taggatcata tttgaaacaa tttatggttt gtattcatgg    201300
     taaatattca cagtgacttg ggccgagaga caaatttttc aaaatcccaa gccctcagct    201360
     aatggcagaa caaaaagtcg tggatccaga tacaaagtat atcaagctgc aagtagttgg    201420
     tggagaagtt cctggagcaa ctcttgctca gagggttggc ccacttggtc tttcatcaaa    201480
     ggtggttggg gaagacataa aaaaagcaac cgcagattat aagagcttaa aggtccatgt    201540
     agagcttgcg ataaaggata ggaaggcaac agtggaagtc cagcctagta ttgcaacgct    201600
     gataatcaag tctttgaagg agcccccacg ggatcgaaag aaggaaaaga atattcttca    201660
     caacggaagc cttaggatga ccgaggtggt cgaaatagca aggattgctc gatctaccag    201720
     atcatactct aaaagtcttt ctggaacagt taaggaagtt cttggaacat gcaagtccat    201780
     cggatgtaaa attgatggga agtgtcctaa ggaggtcact caagagatca atgccggaga    201840
     gatcaggcta cccgaggaat aaatatttat tatgaatgtt tcccacctta accgattgtc    201900
     gtttttatac agagctgata gcttagatag aggctgaaac aaatgcttca gtatggcatc    201960
     ttaatttgtt aaaatctgat caatgtgaaa ctccaaaaca tataaatttt atcttatctt    202020
     aatagtcatg agacttttgg ttttctgtat gacttcgttg gtaatgggaa gtagaatggt    202080
     tagaattact ccaaggaccc atccagactt tgttgtagca attgtgcccc caaagctcgg    202140
     gggaaagggt actattaaag tgattagtac cagagaagat agaaaggtgg aggagtctgg    202200
     gaaagcgact ttcaagatca gtaagggaat gacagaaatc tcgcaagggg gatctaaaat    202260
     ctgcaaaaac gaaaaaaatg atagtatcga agtgtgcacg ggagaagatg aactctattc    202320
     aaagtggaaa ttagtttctg aggatggagg agttaggttc cggactgaaa acgatgtctg    202380
     tctagaagca gtcgaggaga agggaaaggc agacccagta agattgatcg ggaaggaatg    202440
     taagttaaac acaaagagtc agctttttga tttaacattt gttgacgagg agaaccagga    202500
     ttccgatgag gttgaattca acaaaagttc tcagaaagac ttgcccctgg aggatcttct    202560
     tccctatttg ctctatggta aagagccaat agcaaatcaa cgcataattc tatatgacgg    202620
     tgaaggtaaa aagaaggctt cgttcaaggg gtctgtaagt ccgcttctta ttgccagcct    202680
     aagctctgga attctgccgc actctaacaa agtaacctca ccgtattctt cttatagacc    202740
     actgtcaggg tctaaactag aggaggaggt tgcaatcacg ccaaactatg cagattatgg    202800
     aaagctttat taattaaacg atgtatttat tgtctctctg ttgctctgag actattttat    202860
     tttaaaactt tgcttcattt ctgtattcga gtatgctggt gttctattga gtggttctga    202920
     aactaaaaaa aataaatgaa gatatcaaga taaaacggaa tgaaactaac aattgtattg    202980
     atgatatcct ttgctttttg tatctctgat ccgataaaag tcaagatagt ctctaaggta    203040
     gacccaaaga aatatctgtc tctgtttagc ggagaagtaa ggcttgcaac caagaaaaaa    203100
     ataaaagata ataagggatg ctcaaagttc attgtcgacg aggtccgaac agagatattg    203160
     caggggaata ggcgtttatg tagaaaattt ggattttcaa aagtcatgtc gtgtaaccat    203220
     gaaagtaaga attcgatatg ggaagttatt attagcaaag gatccagatt tgtaagtttc    203280
     aaaatggagg gggaaaatca atgtcttaca gctaatgggc cagaatctgc agatctctta    203340
     ggagatattc taagtatggg ggaatgcgac gatggtctgg atacccaaaa gttttggatt    203400
     aagttgatag tcgatagaaa agcgaaagct acatagagat agatggagtt tttttgtaag    203460
     gtatcaaata aatacttttt tgtaataccg ctattatgga agaagaagtt gtgtacttta    203520
     ataatggaag aaaggaattc aataagattg ctgacgaaaa tcccgggtat aaaaggatat    203580
     acttaaatat aaaaaataag gagagaatta cggaaataac tctttcgaaa gaaagaggtg    203640
     acattctata tattctaagc agcatagaaa agaaaaaata cactgattat ttcaaaagga    203700
     aggcaaaaaa tgaagtggtt tccgcagcca aagggaagaa agaagataaa gatcaacctc    203760
     ccaaaaggac aaagcaaaca acgctgtttg atttcattaa gaagtaacta aaacataatg    203820
     agaatcttaa agtaggaagc cttcttctgt tcttcagaaa aaggaatggg aaatttggtt    203880
     atataaggtt tgatccatag aagccaaaac caagtaattt attttgaggt tatttcagaa    203940
     agtctattgt ttttagttta ttatttttga tcgtatattc aaacctatta atccataaat    204000
     ggatatttca agaagaagga tggaaagaag gatgaagacc ctccatgaag tagaagggtc    204060
     tttgcattca gccgagggga agaagtattc ccttaacgat ctaaccaaga taagagtaca    204120
     agaaacgatt gaaaaataag agcaacattt caattcatcc ttcagaagca ttattagatt    204180
     tgcaatagag cataagagta tagctagatc aaaaaagatg gtaatgccag agtcggtaaa    204240
     tgaaattaat tccggagtaa aggtacagga ggtggaaagc aaatatgcaa aagccacaaa    204300
     cgaggaaggt gtaaagatgg aatagctctt aaaatcatca taccaaaagt tgtcccactc    204360
     ggtgaatcca aatataatag ctgaaagaac cgagacaagg gatattgagg caaaaaggat    204420
     acacagtaac aaataaaaca cggcttctaa tagagatagt gatttccagc tagacttcca    204480
     gttgtcccat agaagagtga aatgctccat tgcagaatac aaaaaaggag gaaacattgc    204540
     gccgagcttc agaagagggt aatctttatc caattcattt ttctctcgca agtagtacag    204600
     aatggcagga agtacaatag ccaaacatgc tagtaaaccc atatcccgtt tttgtctttt    204660
     ttggtttttc tttggaaatg atctttggat tttaagctga cttaagtttt tcgttacgtt    204720
     cattaaggga aaaatatatt tccattattg atggataaaa ggaggaaggg agtatcatag    204780
     aatattaaac attgaagaca aagaagaaaa gatccacttc atttaaagag aataagcttg    204840
     atttctcaga tgtagactct ttctaatggt ttgggattat attttatcat aaataattct    204900
     cctttagtat                                                           204910
//

If you have problems or comments...

PBIL Back to PBIL home page