(data stored in SCRATCH zone)

HOGENOMDNA: EUBLK_1

ID   EUBLK_1; SV 1; empty ; DNA; empty ; PRO; 4276902 BP.
XX
AC   NC_014624;
XX
PR   Project:59777;
XX
DE   Eubacterium limosum KIST612 chromosome, complete genome.
XX
OS   Eubacterium limosum KIST612
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Eubacteriaceae;
OC   Eubacterium.
XX
RN   [1]
RP   1-4276902
RX   PUBMED; 21036996.
RA   Roh,H., Ko,H.J., Kim,D., Choi,D.G., Park,S., Kim,S., Chang,I.S. and
RA   Choi,I.G.;
RT   "Complete Genome Sequence of a Carbon Monoxide-Utilizing Acetogen,
RT   Eubacterium limosum KIST612";
RL   J. Bacteriol. 193 (1), 307-308 (2011)
XX
RN   [2]
RP   1-4276902
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (22-OCT-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4276902
RA   Roh,H., Ko,H.-J., Kim,D., Choi,D.G., Park,S., Kim,S., Kim,K.H., Chang,I.S.
RA   and Choi,I.-G.;
RT   "Direct Submission";
RL   Submitted (27-SEP-2010) Computational and Synthetic Biology Laboratory,
RL   Korea University, Anam Campus, Anam-Dong 5-Ga, Seongbuk-Gu, Seoul 136-713,
RL   The Republic of Korea
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review.
CC   Source DNA is available from In Seop Chang
CC   (E-mail:ischang@gist.ac.kr, Gwangju Institute of Science and
CC   Technology 261 Cheomdan-gwagiro, Buk-gu, Gwangju 500-712 Korea).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4276902
FT                   /strain="KIST612"
FT                   /mol_type="genomic DNA"
FT                   /organism="Eubacterium limosum KIST612"
FT                   /db_xref="taxon:903814"
FT   gene            complement(95..229)
FT                   /db_xref="GeneID:9886303"
FT                   /locus_tag="ELI_0001"
FT   CDS_pept        complement(95..229)
FT                   /locus_tag="ELI_0001"
FT                   /gene_family="HOG000111572" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L34"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825632"
FT                   /db_xref="GeneID:9886303"
FT                   /translation="MKRTFQPKVRQRKKEHGFRKRMSTTSGRVILKKRRSKGRAKLSA"
FT                   /protein_id="YP_003957989.1"
FT   gene            complement(338..457)
FT                   /db_xref="GeneID:9881903"
FT                   /locus_tag="ELI_0002"
FT   CDS_pept        complement(338..457)
FT                   /locus_tag="ELI_0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825633"
FT                   /db_xref="GeneID:9881903"
FT                   /translation="MDNSIRLKEIVDKKMGFYQIRTKNTIIKAMKKTKENMPF"
FT                   /protein_id="YP_003957990.1"
FT   gene            741..2090
FT                   /db_xref="GeneID:9881904"
FT                   /locus_tag="ELI_0003"
FT   CDS_pept        741..2090
FT                   /locus_tag="ELI_0003"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825634"
FT                   /db_xref="GeneID:9881904"
FT                   /translation="MDDSIVKIWEKALSLIKEEMSELSYNTWFTNTKPLKIIGGTFYLI
FT                   SDNDFERGMLETRYKALITNALSQVMEQECKVQIVLSEKEVPDTAEQSAPMPKNEGNTK
FT                   SSNNGGSMNPKYTFEKFVIGENNRFAHAACVAVSEAPSERYNPLFIYGGVGLGKTHLMQ
FT                   AIGNYILSYAPTKKVVYVSCEKFTNEFIDAIQNQNNIDFRNKYRNVDILLIDDIQFLAG
FT                   KDGTQEEFFHTFNALHEENKQIVISSDRPPKEIPKLEERLRSRFEMGLITDISAPNFET
FT                   RIAILRKKAESYKEEIPNDVLSFIADSIHSNIRELEGALTTVVAYSKLHGEPICLETAK
FT                   DALKDIFKAKENIVINSTYIKEMTAKYFNVTIEDIDSKKRTKAISLPRQVAMYLTRDLT
FT                   DLSLPKIGEEFGGRDHSTVIHACQKINEEMEANTDFKNLIIRIQKEITGN"
FT                   /protein_id="YP_003957991.1"
FT   gene            complement(2193..2351)
FT                   /db_xref="GeneID:9881905"
FT                   /locus_tag="ELI_0004"
FT   CDS_pept        complement(2193..2351)
FT                   /locus_tag="ELI_0004"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825635"
FT                   /db_xref="GeneID:9881905"
FT                   /translation="MDNSENSERPLKFEVTYSGQGVDKQRHILLRKNGLSTGVKDRILT
FT                   KKSSEGY"
FT                   /protein_id="YP_003957992.1"
FT   gene            2448..3563
FT                   /db_xref="GeneID:9881906"
FT                   /locus_tag="ELI_0005"
FT   CDS_pept        2448..3563
FT                   /locus_tag="ELI_0005"
FT                   /gene_family="HOG000071792" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase III subunit beta"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825636"
FT                   /db_xref="GeneID:9881906"
FT                   /translation="MKFSCSRDALINALSIAQKGVSNKTTLPVLEGILFQVYNNQLVLT
FT                   STDLEIGVQTSIPANVDMDGEIILSSNLITEVIRKLSGEEVFFQKDDSNQVKIECLLSN
FT                   FTIKGFPTDEFPEFPEVIEEHSFVIEAGVLKEMIRGTIFSVAVSENIPVLTGLKMEIEN
FT                   DAISLIALDGYRLSLKRGKLKEAIDGSISVIIPGKSMNELNKLLSGYNENVIVKFSKTQ
FT                   IFFEMGNTQFTSRLLEGEFINYKHIIPTEKATQVKVSRKLLLESSERAALLAREGKNNL
FT                   IKMDFNIDQLILTSNAEIGDVFEVIPIENQGDPIKIAFNSKFFIDALKVIDRDEMSIEL
FT                   TTSVGPAVIVPADGSDEFIYLILPVRIAEEA"
FT                   /protein_id="YP_003957993.1"
FT   gene            3585..3767
FT                   /db_xref="GeneID:9881907"
FT                   /locus_tag="ELI_0006"
FT   CDS_pept        3585..3767
FT                   /locus_tag="ELI_0006"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825637"
FT                   /db_xref="GeneID:9881907"
FT                   /translation="MRKICIIIKKNHDFKGFVYKSFFICGILSYVCYFYCCFLSVFPIL
FT                   RGKREKNYFLKGLQT"
FT                   /protein_id="YP_003957994.1"
FT   gene            3780..3998
FT                   /db_xref="GeneID:9881908"
FT                   /locus_tag="ELI_0007"
FT   CDS_pept        3780..3998
FT                   /locus_tag="ELI_0007"
FT                   /gene_family="HOG000074028" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="S4 domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825638"
FT                   /db_xref="GeneID:9881908"
FT                   /translation="MEIIEINTEFIKLDQLLKFAGLVGNGSDAKMVIQDEMVRVNGEIC
FT                   TMRGKKLRPGDVVEVEDAGSFEVAAAQ"
FT                   /protein_id="YP_003957995.1"
FT   gene            3995..5110
FT                   /db_xref="GeneID:9881909"
FT                   /locus_tag="ELI_0008"
FT   CDS_pept        3995..5110
FT                   /locus_tag="ELI_0008"
FT                   /gene_family="HOG000269559" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825639"
FT                   /db_xref="GeneID:9881909"
FT                   /translation="MILTRLHLVHYRNYRDETLEFSPGINVICGQNAQGKTNLVESIHL
FT                   LSRGYSHKTGTLMDMVGFDESGFFVQADIVKEDTSHTLSIKMQDKKKTVLLNGKKETRR
FT                   DAVLGVLTTILFEPDDLKIVKEGPEKRRRFMNNEISGFKPNYPYILKNYAKIHNQRNAL
FT                   LKEIKYDSTLALTLDSWDEQLVKYGSMLMRYRIDYLRRLNVKARELHRELSGGQEELVL
FT                   FYQNNVLENPQEFSDLERIFREKLQASRQEDIARGSTTYGPHVDDIMIHLNGKDAKKYG
FT                   SQGQQRTAAISLKLSQIEIYRESTGDYPVVLLDDILSELDDRRQRNILSILGKTQAFIT
FT                   CTDPSFIEHYSELPSKILKIEDGRQLKQIEN"
FT                   /protein_id="YP_003957996.1"
FT   gene            5241..7163
FT                   /db_xref="GeneID:9881910"
FT                   /locus_tag="ELI_0009"
FT   CDS_pept        5241..7163
FT                   /locus_tag="ELI_0009"
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825640"
FT                   /db_xref="GeneID:9881910"
FT                   /translation="MSDNLKNEKNDYTADQIQVLEGLEAVQKRPGMYIGSTGKQGLHHL
FT                   VYEVVDNSIDEALAGYCKNIVVTIDKNNGITVVDDGRGIPTDMNHKMKKTGVELALTVL
FT                   HAGGKFGGGGYKVSGGLHGVGVSVVNALSSELTVEVKQNKKIYHQTFAKGKKTSELEVT
FT                   GNTNRTGTTVHFQPDPDIFDELVYDFDVLEHRLRELAFLNKGVSITLADEREAEKRKET
FT                   YCYEGGIRSYIEYMNKNKDPLYEQIAYYEKEMDDYSLEIAFQYTAGYSENIYSYANNIY
FT                   TPEGGSHLNGFKSALTRTINTYARKNNYIKGNDKNLTGEDVREGLTAIISIKLLDPQFE
FT                   GQTKTKLGNPEVKGIVETIVGDELSAFLEENPTIAKTVIEKTLSASRAREAAKKARELT
FT                   RRKSALDTTALPGKLADCREKDPSMSEIFIVEGDSAGGSAKSGRDSRIQAILPLRGKIL
FT                   NVEKSRLDRILTADTLKSMITAFGTGVGEDFNVEKARYHKIIIMTDADVDGAHIRTLLL
FT                   TFFYRYMRGLIEEGYVYIAQPPLFKVARGQHVEYVYNEKALDKMFEDKDRSKYTIQRYK
FT                   GLGEMDAHQLWETTMDPSVRILNRVNIEDAAYADEVFTILMGDKVQPRKEFIERNAAKV
FT                   KNLDI"
FT                   /protein_id="YP_003957997.1"
FT   gene            7334..9838
FT                   /db_xref="GeneID:9881911"
FT                   /locus_tag="ELI_0010"
FT   CDS_pept        7334..9838
FT                   /locus_tag="ELI_0010"
FT                   /gene_family="HOG000076278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA gyrase subunit A"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825641"
FT                   /db_xref="GeneID:9881911"
FT                   /translation="MDEIIEYDRIKEVNIEEEMKSCYVDYAMSVIIGRALPDVRDGLKP
FT                   VHRRILYAMSELGMTPDKPTRKSARIVGEVLGKYHPHGDTAVYDAMVRMAQEFSTRYMT
FT                   IYGQGNFGSIDGDGAAAMRYTEAKMSKIALEMLRDINKDTVDFIPNFDESEMEPEVLPA
FT                   RVPHLLVNGSAGIAVGMATNIPPHNLGEVVDGTIAYIDNPDITIDELMVHIKGPDFPTA
FT                   GILLGKSGIKEAYRTGRGRIKIRSKVEMETTKKGRKQIVVTEIPYMVNKSKLVEKIAEL
FT                   VKEKRVEGIADLRDETDLKKGIRIVIELKRDANETIILNQLYKHTQLQDTFGVIMLALV
FT                   GNEYDKKKLEPKVLNLKQVLHYYVEHQKEIITRRTIFDLKKAEARAHILEGLRIALDNI
FT                   DEVIALIRAAKDGKEAKVQLMERFALTEIQAQAILDMRLQRLTGLEREKIEEEYAELQK
FT                   MIAEYKAILADEQLVLNIIKDELTEIKEKYGDERRTSFDIDVEDFDVEDLIEEEEVVIT
FT                   MTHIGYVKRISADTYRSQKRGGKGITALSTRENDFVEHLFTTTTHHFLLFFSNKGKVYR
FT                   LKAFEVPEGGRTARGTAIVNILQLDPDEKITTMIPVKEFTADKCLIMATKQGIIKKTDL
FT                   TEYDSSRKNGIIGINLREGDELINVRLVEENEDIVMGTQKGYAIRFTSKEVRPLKRTSI
FT                   GVRGIELRDDDVVVGMDIVSDDLFVLCVSDNGYGKLTSGDQYRSQKRGGKGVQTYKVTK
FT                   KTGELVGFCVISRDGEIMMINNQGVVIKLEGNDISTVGRNTQGVRLMKLQAGEQIATIS
FT                   KVYKEDPEEDIEDGQVSILDEK"
FT                   /protein_id="YP_003957998.1"
FT   gene            9843..10298
FT                   /db_xref="GeneID:9881912"
FT                   /locus_tag="ELI_0011"
FT   CDS_pept        9843..10298
FT                   /locus_tag="ELI_0011"
FT                   /gene_family="HOG000227562" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PTS system protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825642"
FT                   /db_xref="GeneID:9881912"
FT                   /translation="MLINQKYIQINVEAADCFQAIEAAASPLLRDNRIDEGYITAACER
FT                   EKIFPTGLPTPVGVAIPHAEPDNVLEEAVSLITLKNPVVFHGMGAPEECIDVSIVFLLA
FT                   IKDGEKQIETLQKIVLMIQDEMVLQKIAGAKNPEWIYNLVKDIDGLD"
FT                   /protein_id="YP_003957999.1"
FT   gene            10319..11008
FT                   /db_xref="GeneID:9881913"
FT                   /locus_tag="ELI_0012"
FT   CDS_pept        10319..11008
FT                   /locus_tag="ELI_0012"
FT                   /gene_family="HOG000259347" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825643"
FT                   /db_xref="GeneID:9881913"
FT                   /translation="MIINKREVLIMNYKISPSMLSADFANLDRDLKSVEAGGADWLHVD
FT                   VMDGHFVPNITIGPDQVKCLRKTIGLPFDVHLMISEPLKYIERFADAGADIITVHVEVE
FT                   DDTQECIDLIKKSGCKASLVISPDTPIDVLAPFIDDISMILVMGVYPGFGGQKYIPETT
FT                   ERLKGIRAMIGGRDVDLEIDGGVNFETLSTVVEAGANVIVSGSCLFSGDMKENISHFRK
FT                   IMDGAKK"
FT                   /protein_id="YP_003958000.1"
FT   gene            11005..11289
FT                   /db_xref="GeneID:9881914"
FT                   /locus_tag="ELI_0013"
FT   CDS_pept        11005..11289
FT                   /locus_tag="ELI_0013"
FT                   /gene_family="HOG000230475" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825644"
FT                   /db_xref="GeneID:9881914"
FT                   /translation="MKTVLVACGAAVATSTVVAKKIEKIASENGVELKTVQAKASEVAQ
FT                   KAAEIKPDIIVCTCQLEGDVDIPVMNGRSFLTGINLQKTTGELLEILRG"
FT                   /protein_id="YP_003958001.1"
FT   gene            11443..12087
FT                   /db_xref="GeneID:9881915"
FT                   /locus_tag="ELI_0014"
FT   CDS_pept        11443..12087
FT                   /locus_tag="ELI_0014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF1638"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825645"
FT                   /db_xref="GeneID:9881915"
FT                   /translation="MKKVVIGCSVLRREIEAGLEDPSDFKFNWLEDQLHNVPETLHEKV
FT                   QSAIDAETGADRIYLLYGHCGQAMTGIQAKNCPVVLPKVEDCIDVLLCHNPNTAELRRT
FT                   SYFVSQGWLWGEEGLGYEYDRMKEKYGEKRALRVIKAMYKNYKYLMFVKTGVEDQNVRE
FT                   KCAGVVEKLDLELQETEGDVKLVIEMLNGSSDERFIVIPPGETIREEMFRP"
FT                   /protein_id="YP_003958002.1"
FT   gene            complement(12077..12652)
FT                   /db_xref="GeneID:9881916"
FT                   /locus_tag="ELI_0015"
FT   CDS_pept        complement(12077..12652)
FT                   /locus_tag="ELI_0015"
FT                   /gene_family="HOG000257338" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825646"
FT                   /db_xref="GeneID:9881916"
FT                   /translation="MTYLQLFISFFQIGLFSIGGGYAALPLIQEQVVNLHGWMDMTQFI
FT                   DIITISQMTPGPIAINAATFVGIKTAGIGGAVIATVGCVTPSCIIVLILAAVYYRFRNL
FT                   NTIKGVLSGLRPAVVALIASAGLSIVIVAFFKNGLVQFAADNIDFVAVVLFAVSLFILR
FT                   KFKLNPIYVMLGCGVIGMGIYAALNFMA"
FT                   /protein_id="YP_003958003.1"
FT   gene            complement(12662..13228)
FT                   /db_xref="GeneID:9881917"
FT                   /locus_tag="ELI_0016"
FT   CDS_pept        complement(12662..13228)
FT                   /locus_tag="ELI_0016"
FT                   /gene_family="HOG000257338" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromate transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825647"
FT                   /db_xref="GeneID:9881917"
FT                   /translation="MDAKKLFKLFISTFSLSMFTFGGGYVIVPLMRKKFVKELGWIEEQ
FT                   EMLDLTAIAQSSPGAMAVNASILVGYRVAGVTGAFVAIVGTVLPPLIILSVISLFYTAF
FT                   RDNLYVGFLLKAMQAGVSAVIVDVVIDMGGDVFKSRKALPVIMMFVVFILSAFVKMNVI
FT                   ILILICGLIGALVTFTARRTGKNLL"
FT                   /protein_id="YP_003958004.1"
FT   gene            complement(13325..14218)
FT                   /db_xref="GeneID:9881918"
FT                   /locus_tag="ELI_0017"
FT   CDS_pept        complement(13325..14218)
FT                   /locus_tag="ELI_0017"
FT                   /gene_family="HOG000010554" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825648"
FT                   /db_xref="GeneID:9881918"
FT                   /translation="MIRYYLCVDDTDDLTKKTSTGKIAEHIKKEAESLGSVIDYGITRH
FT                   QLLLDDAIAYTSHNSSMCFSGSLSEGQLSRLWEKAAEIIMAEKAETADPGLCLCRLDQL
FT                   KFPEKLLTFGKKAQRSVIKKEEAYDLARSVGGTRLEEFGGTGIGVIGALAGAGLRLSGN
FT                   DGSIRGKSGIGTCQTTLSAAEMQNRLGVSHIIERSGAVLPPDTPVYIEDYAKIVLLGHQ
FT                   LVAVAKRNEADGFELCKKSDLYTGDKKTGGWELGCAFFKRDNDEEECLDDLDKTCCNCL
FT                   YRRWTKEGYRCSIEKR"
FT                   /protein_id="YP_003958005.1"
FT   gene            complement(14230..15333)
FT                   /db_xref="GeneID:9881919"
FT                   /locus_tag="ELI_0018"
FT   CDS_pept        complement(14230..15333)
FT                   /locus_tag="ELI_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferrichrome-binding periplasmic protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825649"
FT                   /db_xref="GeneID:9881919"
FT                   /translation="MKKIKGYVRITLALFFITMLLSGCSQPGITASDNTPTHTITDSAG
FT                   RQVEIPTEIKKAAVLDAFMTEAIVMSQGGEQIVSCPAGTKRNVLLKEIYPEIENAVTVT
FT                   SSGVINAEALMELKPDVVLIKREIYQSEAEAQKLDKLGIPYVVVSYDNMAEQIEALRLI
FT                   ASVMGGRVAQNMETLCQEYERVITLCEERSARIPESERVKVYHSITEAVRTDGENSLGS
FT                   DWIKTVGCTDVSVGSELKSEGDDYYASIEQIFVWDPDVVICNDASTAEYFKTNEKFQGL
FT                   RAVRENQVYNIPIGFTRWGHQGSCETFFGMPWLGTTVYPEVYGDIDLRAEVTDFYQNVA
FT                   GIQVDDALWDKILSGRDIRQGGKNSGK"
FT                   /protein_id="YP_003958006.1"
FT   gene            complement(15346..16140)
FT                   /db_xref="GeneID:9881920"
FT                   /locus_tag="ELI_0019"
FT   CDS_pept        complement(15346..16140)
FT                   /locus_tag="ELI_0019"
FT                   /codon_start="1"
FT                   /product="iron(III) ABC transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825650"
FT                   /db_xref="GeneID:9881920"
FT                   /translation="MSVLKITDAAFAYGEQLIFQDITLETRPGEIFCLMGRNGCGKSTL
FT                   LDCILGIHPLKKGTIQISDKSVDAYKPAELAKKMAYLPQSHEHSFPYKVLQVVLMGRTA
FT                   YMSRFGSPTQEDKVIVKNLLNKIGITHLSDRPYTQLSGGELQMVMLARSLAQEAPLILM
FT                   DEPTAHLDYYNELLFLETIASLVKDGRQTIFMATHSPNQAFYLENRGIPVRVGLMCNGK
FT                   LIETGPPAKTLTSANLGQVYNIEARILDSGETKQVMPVGTLK"
FT                   /protein_id="YP_003958007.1"
FT   gene            complement(16137..17180)
FT                   /db_xref="GeneID:9881921"
FT                   /locus_tag="ELI_0020"
FT   CDS_pept        complement(16137..17180)
FT                   /locus_tag="ELI_0020"
FT                   /gene_family="HOG000045407" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="iron(III) ABC transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825651"
FT                   /db_xref="GeneID:9881921"
FT                   /translation="MKTETALQDHRHFIKKVIFILLLLVIPLAFIFTALFIGRYSVSVS
FT                   EVLRSLASPFAGGAGISPQTLTVVLQLRLPRAIAAAFVGAGLSASGTAFQGVFRNPLVD
FT                   SGFLGVNSGAGFGAGLAILLFGTSLATYGFAFAFGVLAVIFSYLIAKIYKAVPTIMLIL
FT                   GGTIVSSVFSALLTLLKSIADVNSELPAIVYWLMGSVASVSYKDFWAVLVILAGIVGLA
FT                   FFSWQINVISMGEKEARTMGVNVVFSKRMIIACATLATAGAVCISGIIGWVGLIIPHIG
FT                   RMLIGNDTRKLLPVSMSLGAVFMVTIDTISRSVTTSEIPLGVLTALVGAPFFVFLLKKT
FT                   KGGGWQM"
FT                   /protein_id="YP_003958008.1"
FT   gene            complement(17170..18567)
FT                   /db_xref="GeneID:9881922"
FT                   /locus_tag="ELI_0021"
FT   CDS_pept        complement(17170..18567)
FT                   /locus_tag="ELI_0021"
FT                   /gene_family="HOG000060029" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sarcosine oxidase alpha subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825652"
FT                   /db_xref="GeneID:9881922"
FT                   /translation="MHYDCAIIGGGAGGMAAALSASQRGVEKIVLLERDPAVGGILRQC
FT                   VHDGFGTLYLKKSLTGPEYAAHFKNQLKNTPVTIKTSASVLELSGEYGAFSVKYLSKTE
FT                   GPARLTADTVILAMGCRERTLGQLRIPGSRPSGIYTAGTAQYMMNIQNLIPGKNVVILG
FT                   SGDIGLIMARRLTLEGARVSLVLGEKATGLARNHLQCIQDFNLPIRFGFTVVSVHGYKR
FT                   LKGVSIAPVLADGRPELSKKTYVPCDTLLVAAGLIPETDILDSDFVRLDKNGGINVYDN
FT                   GQTSVPGLFACGNVTGVHDLVDKVSMAGKQAGESAASFLAGKPAASGEKLPDAYLEKEP
FT                   TCEVLNSLKENERLCVLCPKGCILSFDTACEPPEITGYRCRRGLHHGREEWKTPRRMLT
FT                   TTVKTAAGGLVPVKSSVPLPQRSLLKAMKKIRKITLTSSVAPGTIICKNILNSGADIIT
FT                   TGEAHEN"
FT                   /protein_id="YP_003958009.1"
FT   gene            complement(18569..20008)
FT                   /db_xref="GeneID:9881923"
FT                   /locus_tag="ELI_0022"
FT   CDS_pept        complement(18569..20008)
FT                   /locus_tag="ELI_0022"
FT                   /gene_family="HOG000060323" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825653"
FT                   /db_xref="GeneID:9881923"
FT                   /translation="MLDVIIIGGGILGVTTARLLSRFNLDTLVLEKGADLGEGASKANS
FT                   AVLAAGFHPRGGSLKGISCVRGNAMYPQICKELGVEIAYPGSLFVAFHREGEEMIREKY
FT                   KKGLKNNVPDMEILSGSESRALEPGLSDRVTMALYARTTGIIELFSLLLRTAQSAEKNG
FT                   VHFAFDEEVQEIIEHENHFEVVTGRRSLNARYVVNTAGGMAMAVESGVRPQDLIIKPRC
FT                   GQFLVFDRQGKDGIRHVLYQAQETDEKGCLLAPSTEGNIIAGPTSQDVPDYKNVETTDW
FT                   GIHHIEKTAKKILPDLDMGKVITSFAGVRANIKNVVKEEKDFIIRRSVPRMVSALGIKN
FT                   PGMTAAPYLCQMILDLLIEDGLCTAPNPDYCPVLDLPKPFLKQTENIQKKWYEQDHRYG
FT                   NLVCRCEGITEGDILRVLREPLPPKNMNGLKKRLRTTMGRCQGSFCTPRILEILSREWS
FT                   VPPEKIMKEAPGSPFVKGRVK"
FT                   /protein_id="YP_003958010.1"
FT   gene            complement(20008..20640)
FT                   /db_xref="GeneID:9881924"
FT                   /locus_tag="ELI_0023"
FT   CDS_pept        complement(20008..20640)
FT                   /locus_tag="ELI_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825654"
FT                   /db_xref="GeneID:9881924"
FT                   /translation="MKRKFKLASILVALLLALSFGNTALAAGGNGGGGGGGNGSGGGNG
FT                   GGSDETLTIVSSTPADGETSASVSDPIKLEFSKNVVNAEVKDGNMAAVVLYKNGTPVAA
FT                   EVTMTDDQVEPDLRNFITITPSSPLEPGTEYQVKIAGTLTAKSGAALGEEKTLRFKTAG
FT                   TAPAAASEEKTTAEKPASNNTTLYILLGVAAVVIIAIVVVVFVKKKK"
FT                   /protein_id="YP_003958011.1"
FT   gene            complement(20788..22146)
FT                   /db_xref="GeneID:9881925"
FT                   /locus_tag="ELI_0024"
FT   CDS_pept        complement(20788..22146)
FT                   /locus_tag="ELI_0024"
FT                   /gene_family="HOG000237009" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Radical SAM domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825655"
FT                   /db_xref="GeneID:9881925"
FT                   /translation="MASNMSLSENIKSFGMKQVIKYLDADPDKNIPRVIEWVEKFDKDQ
FT                   TIAGQMKVVKEALADENNNWNRLVKSLWTDIDPGVRKRLFNNFIVNSVIIGCKRQNINK
FT                   EKYDCNIPWAILMDPTSACNLHCTGCWAAEYGDKMSMDFDTLDSIIEQGKAFGTYMYIY
FT                   SGGEPLVRKKDIIRLCEKHDDCAFLSFTNATLIDEDFADEMLRVQNFIPAISVEGFEEE
FT                   TDMRRGKGTYAAVVKAMDILKAKKLPFGFSTCYHRQNTDVIGSEAYFDAMIEKGCKFGW
FT                   FFTYMPVGVDAVPELMATADQREYMYHQIRSFRATKPLFTLDFWNDGEYVKGCIAGGRN
FT                   YLHINAGGDIEPCAFIHYSDSNIHEQTLLEAYRRPLFMQYHRNQPFNQNHLRPCPLLDN
FT                   PGRLTSMVELSGAHSTDLTHPEDVKALSDKCLDAAKAWKVNADRLWNESHPNH"
FT                   /protein_id="YP_003958012.1"
FT   gene            complement(22325..23116)
FT                   /db_xref="GeneID:9881926"
FT                   /locus_tag="ELI_0025"
FT   CDS_pept        complement(22325..23116)
FT                   /locus_tag="ELI_0025"
FT                   /gene_family="HOG000068105" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825656"
FT                   /db_xref="GeneID:9881926"
FT                   /translation="MNEALKETLDSIKGFICDMDGVIYHGNRLLPGVPEFVDWLYREDK
FT                   NFLFLTNSSERSPLELKEKLSRLGLDIDESHFYTSALATAKFLSTQSPGCSAYVIGEPG
FT                   LINALYSAGITMNDMNPDYVVVGESYNYNYDTILKAVRFVLNGAKLIGTNPDLTGPAEG
FT                   GLVPACRAFTAPIELATGKSAYFVGKPNPLMVRTGIRMLGVHSEDAAIVGDRMDTDIIS
FT                   GIESGMHTILVLSGVSTPETVQEFPYRPQFILNGVGEIPTN"
FT                   /protein_id="YP_003958013.1"
FT   gene            23321..23695
FT                   /db_xref="GeneID:9881927"
FT                   /locus_tag="ELI_0026"
FT   CDS_pept        23321..23695
FT                   /locus_tag="ELI_0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825657"
FT                   /db_xref="GeneID:9881927"
FT                   /translation="MEKKKLAIGIVAVAVLSLVLALLTTGISTKVKTGSEAAKDEKLIL
FT                   GAWADDSGVNIEFVDNNVFRMFGDDVATYTMDTKEKNVDMKYAQAYGGQTTHMSYVIDG
FT                   DTLTLTDRDTGDVHVYKKTQ"
FT                   /protein_id="YP_003958014.1"
FT   gene            23673..23756
FT                   /db_xref="GeneID:9881928"
FT                   /locus_tag="ELI_0027"
FT   CDS_pept        23673..23756
FT                   /locus_tag="ELI_0027"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825658"
FT                   /db_xref="GeneID:9881928"
FT                   /translation="MFIKRPSNTGSASAKNGESAVFLFYEN"
FT                   /protein_id="YP_003958015.1"
FT   gene            23865..25145
FT                   /db_xref="GeneID:9881929"
FT                   /locus_tag="ELI_0028"
FT   CDS_pept        23865..25145
FT                   /locus_tag="ELI_0028"
FT                   /gene_family="HOG000166272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825659"
FT                   /db_xref="GeneID:9881929"
FT                   /translation="MGCKNFKDINKETVKDYLKECTDYFAPDARLSVYEIGESEEDGDG
FT                   FINFLYRVWDENGKSVIVKQAKTYYKAFEEGVGPFVQDRNALEADVMRIKGAITPEYIP
FT                   KVYQVDLDNHIYLCEDCSDLKILRFELMKGKKFPEFPKKIGEFIAKSNFYTSEYYLDAT
FT                   VYKELQAKFLNPSMRLVFEIGLFLKDEHAIDDHDPHDDPNADPERLAMGDAPWKSTAFR
FT                   TEMLKLRDIHMKHCECLVHGDLHTSNIMINDKKMKIIDQEYAFMGASSSDTGYLMGSVL
FT                   YEYIRWFYMDDYPEDFCKDFRETILGYMRDIIHTYNAVYTECWKKDAKVTYRDFDDFRE
FT                   SILKNFIQEVCGFTGCQITSRVGGLVPLPDFDTIEDRDKRNEACRLSLTIANYLIMHRM
FT                   EIGSIDDMVDTIVRITENFFKLIKIIN"
FT                   /protein_id="YP_003958016.1"
FT   gene            25198..25413
FT                   /db_xref="GeneID:9881930"
FT                   /locus_tag="ELI_0029"
FT   CDS_pept        25198..25413
FT                   /locus_tag="ELI_0029"
FT                   /gene_family="HOG000259289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825660"
FT                   /db_xref="GeneID:9881930"
FT                   /translation="MKKIDCLGDMCPVPVMKLQRETRKMKPGERVLLITDHSCTVKSVR
FT                   EFCAGMQMACVCDEVMNGVWEITVSR"
FT                   /protein_id="YP_003958017.1"
FT   gene            complement(25403..26302)
FT                   /db_xref="GeneID:9881931"
FT                   /locus_tag="ELI_0030"
FT   CDS_pept        complement(25403..26302)
FT                   /locus_tag="ELI_0030"
FT                   /gene_family="HOG000233518" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825661"
FT                   /db_xref="GeneID:9881931"
FT                   /translation="MNIESLRMFIKIADNGSITKTAEQTFISQSALSQQIKTMEQLFNT
FT                   SLIERSNKGVTLTCSGKTVYEYALHLTSTYDSMIRELQENEESNRVLHILSTPIIASYA
FT                   LPCTLYYIKKNFPTYSLEISSMASHRIEQQVNCDQGDIGFITGPPSDPSLTGQKVFSDD
FT                   VFLVAGSDMKIEDHILKEDLSRYPLLTLTTDQKTEQHLEKRLTDEGVDVESLMILFKQD
FT                   SIESIKLSTINGYGMAFLPYMCIKKELYHKQLKIISVEGLTLQNDYYIIKKKASEYRDR
FT                   TLLKLICYIEKILADTIC"
FT                   /protein_id="YP_003958018.1"
FT   gene            26481..27164
FT                   /db_xref="GeneID:9881932"
FT                   /locus_tag="ELI_0031"
FT   CDS_pept        26481..27164
FT                   /locus_tag="ELI_0031"
FT                   /gene_family="HOG000059637" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825662"
FT                   /db_xref="GeneID:9881932"
FT                   /translation="MEEEKIQRSTRTRAPRKPKKNQIPIAIVVTILVVAAGVYLGLGSE
FT                   KLPVYWIIGLCFGFILQRARFCFTASVRDPSLTGSTSLTRAVLIAFAVTTIGFTAIKYG
FT                   AYINGQEIPGMSSVSPISLPLALGAVFFGIGMVIAGGCASGTLMRVGEGFTMQMLALVF
FT                   FVVGSFWGAHDMGFWDGVFNTNAPKIFLPDVFGWFGALVVQGLIILLLYIAARQWQKKK
FT                   MGTAD"
FT                   /protein_id="YP_003958019.1"
FT   gene            27207..27434
FT                   /db_xref="GeneID:9881933"
FT                   /locus_tag="ELI_0032"
FT   CDS_pept        27207..27434
FT                   /locus_tag="ELI_0032"
FT                   /gene_family="HOG000259289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SirA family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825663"
FT                   /db_xref="GeneID:9881933"
FT                   /translation="MSEYTLDCLGEACPVPLMKTEKELEKLNVGDLLIVSIDHSCAMKN
FT                   VPEWARAQGHNVEIEEVDDGEWEVVIEKTK"
FT                   /protein_id="YP_003958020.1"
FT   gene            27461..28009
FT                   /db_xref="GeneID:9881934"
FT                   /locus_tag="ELI_0033"
FT   CDS_pept        27461..28009
FT                   /locus_tag="ELI_0033"
FT                   /gene_family="HOG000059626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825664"
FT                   /db_xref="GeneID:9881934"
FT                   /translation="MKEFFQKLSKNDFYKKLMKEPLTYVAGAVLLSVFQIAHLASLGSA
FT                   WGVTSAFADWGAWIYQGLGGDVSSWAYFASEKAQHTLAAGFLHDGGSIRNIGIIVGALL
FT                   ATLYASQFKIKKIKSIRQVVAAVLGGLLMGYGARMAHGCNIGALYSGIASLSLSGWIFA
FT                   AFLMVGAFIGSKLLAKYFM"
FT                   /protein_id="YP_003958021.1"
FT   gene            28034..29257
FT                   /db_xref="GeneID:9881935"
FT                   /locus_tag="ELI_0034"
FT   CDS_pept        28034..29257
FT                   /locus_tag="ELI_0034"
FT                   /gene_family="HOG000072911" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825665"
FT                   /db_xref="GeneID:9881935"
FT                   /translation="MNKKTEKYDVVIIGGGAAGLTAGIYCGRARLKTLLIEKALVGGLA
FT                   TYTSEIENYPGFPEGSSGLGLMDLFHEQAKKFGVKFKLTDVRSVDFSGETKVVETFRNR
FT                   FEAKVVIVATGGKPRLTGAENEDKYLYDKGISFCATCDAAANTGKTVMVIGSGDAAIEE
FT                   GTFLTKFADKVIVSVMHEEGKMDCNEIAKAQALENPKMEFIWNTVAERFEGDEHLDTVV
FT                   LKNIKTEESIPVKVDTCFLFIGYLPNTEWFKDILDMNRGGYLITNERMETNVPGVLAAG
FT                   DVRDKFLKQVATAVGDGAIAGYGAEKYISELEVYESQVLNNGEPSVVYVWNAVDPKCRE
FT                   LMTTVEAFQEKHAGDLHVTNVDIYKSDGIARRLGISEVPAVLYIKNNEVQKTLTQNISM
FT                   EGLEGLVD"
FT                   /protein_id="YP_003958022.1"
FT   gene            complement(29537..30397)
FT                   /db_xref="GeneID:9881936"
FT                   /locus_tag="ELI_0035"
FT   CDS_pept        complement(29537..30397)
FT                   /locus_tag="ELI_0035"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825666"
FT                   /db_xref="GeneID:9881936"
FT                   /translation="MQERFNLEYLNTFVTAAETGKLNITAEMVYRSPSSVSTQIKNLET
FT                   QIGAPLFIRNKEALSLTKSGEILYQYAQKILEINDSAFNIINNSDWKGALTFGVPTDYA
FT                   QLFLTSIYPRLTEIYPDFHFTTVCSRSREIRRQIEEGKIHIAIVAMEPQYTDDIFLWEE
FT                   PLYWVGSKNFIHKPDSRLPVALFSDNCIVNNHSLYCLKKTNVDFQIVFTSTVLDNIADC
FT                   VKSGVAVSLLPESLITDAFSTLSEDFITCPFTLKFGLTWGENADKAMLEEITEIVTLSL
FT                   KKYPC"
FT                   /protein_id="YP_003958023.1"
FT   gene            30410..30544
FT                   /db_xref="GeneID:9881937"
FT                   /locus_tag="ELI_0036"
FT   CDS_pept        30410..30544
FT                   /locus_tag="ELI_0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825667"
FT                   /db_xref="GeneID:9881937"
FT                   /translation="MLSACDGFIIVQKNPSINALMAMLQFFRILYSILIDCVLKKRIL"
FT                   /protein_id="YP_003958024.1"
FT   gene            30643..31740
FT                   /db_xref="GeneID:9881938"
FT                   /locus_tag="ELI_0037"
FT   CDS_pept        30643..31740
FT                   /locus_tag="ELI_0037"
FT                   /gene_family="HOG000294677" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical oxidoreductase protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825668"
FT                   /db_xref="GeneID:9881938"
FT                   /translation="MNEIPKKMCGVYLTGNGGFEKLEYRTDIDVPKPKAGEVLVKIGAA
FT                   AVNNTDVNTRIGWYSKKVKEETNAGGATGFKEEVKDDGSWLGQAMVFPRIQGADGCGTI
FT                   VAVGEGVSEDRVGERVLIRSVQERPSSQDGVECITFGSECDGTFAEYAAALSDEAFVIH
FT                   SELSDKELATFPCSYATAENLVCRVGVKKDDVVLVTGASGGVGSALVQLVKIRGAKVIA
FT                   VCEPDQAERVKGYGADEIIFRGESYIEKIGKMKVDVVLDMVAGNQWPEHLEILKKGGKY
FT                   GVCGAIGGPLVELDVRTLYLKDLSLFGTTYQSKESFLNLISYIEDGKIKPVVAKEFPLK
FT                   EIVKAQEAFLSKTLVGKIVLDVASE"
FT                   /protein_id="YP_003958025.1"
FT   gene            31785..32834
FT                   /db_xref="GeneID:9881939"
FT                   /locus_tag="ELI_0038"
FT   CDS_pept        31785..32834
FT                   /locus_tag="ELI_0038"
FT                   /gene_family="HOG000084336" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proline racemase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825669"
FT                   /db_xref="GeneID:9881939"
FT                   /translation="MGFKRMFNAVETHCGEPMRVVTSGIPTIPGNSVYEQSNWLKNNDD
FT                   QFRKLMLREPRGYPPLCCNLIVPAKDPRAAAGYIIMEQTEYPMMSGGNTISVATALLET
FT                   GMLPMKEPVTEFNLEAPAGLIGIKADCKNGKVTQVTFSNVPAFVVYLDKEIDVPHLGKV
FT                   KVDVAWGGMFYVLIDVRQFEGLELVPENGKEIAKVSALCMKAAQEQLPVEHPDYPGIGI
FT                   TISELHGPTDNPDADWKSVNTVFTGDIDFEQPETWTGALDRCACGTGTCALMAAKHAKG
FT                   ELKTGEAFRREGLLGIIFTGHPVEETEIHGHKAIVPTIGGQAWIYGYSQYVLDETDPFP
FT                   EGFTVGDIW"
FT                   /protein_id="YP_003958026.1"
FT   gene            32854..34122
FT                   /db_xref="GeneID:9881940"
FT                   /locus_tag="ELI_0039"
FT   CDS_pept        32854..34122
FT                   /locus_tag="ELI_0039"
FT                   /gene_family="HOG000166273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825670"
FT                   /db_xref="GeneID:9881940"
FT                   /translation="MKNLSFQKFMVFFILSSTVALAYQIPYLRYTFYDQFAAAYQLTNT
FT                   QMGILASALNLTNVLCYPIGGFIADRFSTKTLICTTLAAFVAVTLVFAFTTNFVVCLII
FT                   HVLYGFFGIATLWSAYLNGIRNLADKDNQSKIFGSSEATRGIVQTIMGFAFLGILGVTT
FT                   SAAAGMKAVLLLGSGACAVFFVLAIVFLPKSEVRHDDGAAGESAEKYSLMEVLKNPGVW
FT                   VTIFIIMFAYISWSIGNGYLTTYTVQVLNISQGTASALGIVRSYIIVLLAGFIGGFILD
FT                   KFTYKGTGFLVLFVAIIAAIIGVMTTSAIIPLCISLTLVIAFLANIMKSTYWSVMDQAG
FT                   VPVGMTAIATGIISFIAFIPDFLVTPVCGKWLDDAAAAGNVADGFDKIFILLIASSVLG
FT                   IISAILLTRRTKKVKAMEFNEGL"
FT                   /protein_id="YP_003958027.1"
FT   gene            34144..34218
FT                   /db_xref="GeneID:9881941"
FT                   /locus_tag="ELI_0040"
FT   CDS_pept        34144..34218
FT                   /locus_tag="ELI_0040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825671"
FT                   /db_xref="GeneID:9881941"
FT                   /translation="MKKLRKEKSQRTEVGFFNTKNYLT"
FT                   /protein_id="YP_003958028.1"
FT   gene            complement(34246..35562)
FT                   /db_xref="GeneID:9881942"
FT                   /locus_tag="ELI_0041"
FT   CDS_pept        complement(34246..35562)
FT                   /locus_tag="ELI_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825672"
FT                   /db_xref="GeneID:9881942"
FT                   /translation="MPVLKKFSVLDRMLGLAYPIIMNKMSPKLKKKIESLLVAYGKGDW
FT                   SAFEEVYRLAYNFQFLQACQFLGDACMAEDVVQETFLRLYKNPGKIANIRYPYAYLKQI
FT                   TYNLCIDKISAPVNTNECRADEELLCFIEDERPDASPESHAILTAASDELNAALQTLPP
FT                   DERTIFILRFVDELKINEIVLATGLSKSTVKRKIQTAREHMKNILHPRWMPGFLLTGTL
FT                   ASLVQNGFTDFAMDTARADRILYALMEHGSELAGQGSAAGISAHAVSSISANSRLSAFF
FT                   SSLSSSTLVTATCTVVVTGAVLIAPSAIHQSIVTADDTAEAHEPEPYTLAEESPEAASA
FT                   PADTQIPELVSYECIDGTIVLTLKDDLSGVDYAAITASSDNGSVPPVNISEAENQVTFE
FT                   ISNTPLTVNICDKAGNSGSMVIEPNPAFDKDLPTEDNPE"
FT                   /protein_id="YP_003958029.1"
FT   gene            35568..35714
FT                   /db_xref="GeneID:9881943"
FT                   /locus_tag="ELI_0042"
FT   CDS_pept        35568..35714
FT                   /locus_tag="ELI_0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825673"
FT                   /db_xref="GeneID:9881943"
FT                   /translation="MNPFSKKDGLKNQGTLYQGFLESGKKKFKMTEKNKTDINKEYEAS
FT                   PEQ"
FT                   /protein_id="YP_003958030.1"
FT   gene            35741..43165
FT                   /db_xref="GeneID:9881944"
FT                   /locus_tag="ELI_0043"
FT   CDS_pept        35741..43165
FT                   /locus_tag="ELI_0043"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825674"
FT                   /db_xref="GeneID:9881944"
FT                   /translation="MSGAKKGIRCLGCMMMIIVLLLGLMAVAMPETAEAKNEDIRDAYE
FT                   AEIKFKTFSAEDGIPVWDGINSVTTKPAGADITGNVCTVTTPEALRWAMTQYSTNSIAK
FT                   IVIAADMDMGGREDAVPPKWEPVTLTGAISIEGQRDENCGYYGGREYPTIYNLNVETAS
FT                   GHTGFIASTSGDVNIKNFYFDSAKIRTTSSSGVQGVAIIGYAGNGLIMENIGVENSLSK
FT                   TAFYGAAGLIGKSAETTNGIRVTNCYAKKVYVTASQCSGGLLGPISGGEFNNCYAIDGA
FT                   LITTGGGHSGGFVSCSGGYTMNNCFTNNVVYGTAYTGGFVGYPEGKKTVFNNCWTAGSV
FT                   EGTSSIGGFVGHTNVAAEFNNCYSTTMVGMLNSGTSMGGFVGYAASSPSFKNCYAAGEV
FT                   GGLTTVPGTAAASVGGFVGSSASTATYSNCYYDKQTTAMGEYAKGGTTDKQDGITGLTT
FT                   EELQRQPMDAYTIESGLYPQLSTLANPADTTFSSDYERLTARAYSAASASSAIFNVEKD
FT                   KNTGAIKGYDTVRNILKPPTFSNNTVVDTGKYNVKWTAGSDASPLQIEQTKKDDKGEPV
FT                   LDADGNPEKEMVNPPVLTIGRTVKEDGTVVQDDHITRMYPGVGWANVEVAMTEGENTVV
FT                   GKRAMRIIPTTTMSLGESDHPLAPGSKDSRIYVGLQKNDGGLVTDVDQKYNHRNTIAFV
FT                   KTSAEELDNIMKNPGGSSLSAIRYNPDITDTGYTNIAVDSANADRGKITTTIYKVTKDP
FT                   DDPSKEIETLIPDLSQNNLDAKFRGEKDFTNGSEDASETVASDDRGTYRIKYKWEIPVA
FT                   GDAGAVTTYEDSKTLTVTDPLTVTYYNNVKAGDPDAAEYANPEGFEEADQDTAADKAVF
FT                   DIYGDNDGERALKVGDRTTALHKKVTGDDGVETTIDAPSRIGYTFAGWSKNRQVVADST
FT                   RDEEMTDGDIRLADFKQELQAFTAANPESPDYTEPANAFIPGKSTVSADTKVYAVWENN
FT                   AYDVHFDFDPSAAEPAKPGDGKTVEDIVYNGSVQEGDFPSFNGVPIAENFVDTTAFDDE
FT                   GKPKSRLFTGWSVKDPSKAVAPAAETEEEQAPSEEKDIYFTKDSKITKDLFGKEAFARD
FT                   AENAAAGKNTQLEIYSVFKDAQITFLDSSQKQGGETPETADQLKQYGEKANVAADNTFT
FT                   LPDMTAQANARAGYKFLGWSAKPHADFAATDKDFSAAELISEDKLGKDFKADSPTTLYA
FT                   VWQNTGYVVTFDYGPQGTEAARVNMVYGQAIGDKLPETPQNWMDSQGQQWRFDGWKSGT
FT                   ESITAETIKNEGQVSGDAMTVKAQWKKVYDILTAKVGHGTIDSSKTVDEGSSYTVSWKA
FT                   DEGYHVAQVMIDNGVHDELLGDGHSGSYTQPRADRNRTVYVIFEKDADAPSGDAVYYTV
FT                   QTVKIGGDATTTLTETQTIAAGENHTVTWNAGDLYRVTGIVVDGSARPLQDGGSFTFSD
FT                   MNADHRVEVHFEEKLPDSSPSALPGYYTVNTVRNEGGVITETGVVKEGESREITWSEDS
FT                   GYTVKSITIDGQPAGPDIMTAKKVVFNDIREDHTVKAVFEKNGENPPADKVPVETVLVG
FT                   GPGEISSSAVVNKDESYKVEWNAPEDKRYLVDHILVNGERQEVAAEAVTTGHIEVKAEA
FT                   ETKVEVVLKPNLLKIATMVEGQGSIDPTKTVFYNDEAYTVAAKASDGWYIKSYQIDDGE
FT                   EQTVSSPQSAALMPMSEGEPQPAGDNSTVVIDVPSDSNNKIVDNHRIKVTTERLDGSAA
FT                   TELFPVATGMEGGTGTITAGSSVEKGGSMEVSWTPDEGYATAGVSVTASGVPIPVSYAD
FT                   NHLILSDIADPYQVTVQLRPVEKAAPETAPKYSVSTSISGAPGASITPSLAGNIEEGSD
FT                   VSIGWSWSDTAYEVKAVKVDGQPLSGAVKDLRSYAFSQVNTDHSIEVVLGKPDTNPAPD
FT                   TDAFTITTECTTGGSISASSVVAKGDTTTVTWAPDSNDYTVKAIHIDGVKRDDLLTTDH
FT                   VVFENVAQDHFIAVEFGKAGSPDEPEAPDEPAKTYTISTEIVGGIGSTIDSSRIADENE
FT                   TVTISWKPGSNAYVTTVIIDNVVRDDLKSAGSVTFENITANHRVQVVCQPIPPAPGVQH
FT                   RITVSKNGQGQVNGTKTVETGASYEVCWEADSGWHVESVKVDNIPIENPENKGSVRFEK
FT                   IDTDHQVEVVFKKDTDETPSKAWPVITGIIAGNGSISAGNSSVPEHGDYSVSWKPAEGW
FT                   HTARVFVNNAERKDLLDKNSVTLTNITQTQTVQVEFAKDTALPPEPDNPAEPGKPENPD
FT                   TSGPSIDPPDLEIPDTNAEGSVLDKIQKEADKILPRTAKASSIAPNTGIRDGGQSAASA
FT                   SGISGKPGRKTQRSTVERWISGEGESLLSHIVGKSSSNAAVLGSREISVFNLLAVMGAM
FT                   LLMMTSLKKNKVIRWTTTLVSLALLTLFFLTQPLSLSFRLFDPWSVIFGLLILLDVAAA
FT                   FIKKRSHKMF"
FT                   /protein_id="YP_003958031.1"
FT   gene            complement(43217..43882)
FT                   /db_xref="GeneID:9881945"
FT                   /locus_tag="ELI_0044"
FT   CDS_pept        complement(43217..43882)
FT                   /locus_tag="ELI_0044"
FT                   /gene_family="HOG000241645" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825675"
FT                   /db_xref="GeneID:9881945"
FT                   /translation="MNNQEILSHIDHTLLKPFSTWEQIAEICNDAIENKTASVCIPPSF
FT                   VKPVKEAYGDKLTICTVIGFPLGYNTTATKVFETKEAVKEGAAEIDMVINIGALKDGKY
FT                   DFVQNEIAEIKKAVGDNILKVIVETCFLTEEEKIKICELVTAAGADFIKTSTGFGTAGA
FT                   TREDIRLFKEHIGPNVKMKAAGGVKTKEDLVDFLELGCERIGTSSAVSMLKGGEAQGY"
FT                   /protein_id="YP_003958032.1"
FT   gene            complement(43896..45413)
FT                   /db_xref="GeneID:9881946"
FT                   /locus_tag="ELI_0045"
FT   CDS_pept        complement(43896..45413)
FT                   /locus_tag="ELI_0045"
FT                   /gene_family="HOG000222136" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Carbohydrate kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825676"
FT                   /db_xref="GeneID:9881946"
FT                   /translation="MYEAQYFMGVDTGTQSVRVVVADISGNIVASDEQVYETYYPQPGW
FT                   AEQKPADWWSCFNKAVENVTKNLSMGIRYSIKSISVCSTSSTVLAVDEQGNPMMDAIMW
FT                   MDTRAVKEMEKINATADPVLEYCGGEDSVEWMIPKTLWIKNNKPEIYKDSYKIIEQLDW
FT                   MNYQLCGTFATSICQAACKWNYVSCEGGWNSAFFKKIGLDDYEEKLVTDVRRLGEELGR
FT                   IDPAFAEKYDLNPDMMVVQGGIDAHIGMLGLGVARPGKMAMIMGTSFVQLAFANADEKL
FT                   KLDGIWGPYNEPVVPNAWLLEGGQISAGSIVKWFMREFDLNKMENPYAYMNEQVEKIAP
FT                   GSDGLVALDFFQGNRTPYKDPNAKGVIYGLTLSHTKAHIYRALLESVALGTKNIIDNFE
FT                   KQGCPVDMVVGCGGVTKDATWMQIIADATGKPIIVTVDPSAGALGCTIVAAVGAKAYPD
FT                   FEQATKGMVKEAYTVTPNPDVYDDYQKVFDTYVELYEELKGTMSKER"
FT                   /protein_id="YP_003958033.1"
FT   gene            complement(45465..46535)
FT                   /db_xref="GeneID:9881947"
FT                   /locus_tag="ELI_0046"
FT   CDS_pept        complement(45465..46535)
FT                   /locus_tag="ELI_0046"
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative L-iditol 2-dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825677"
FT                   /db_xref="GeneID:9881947"
FT                   /translation="MKAVRMYKPGDLRVEDVPKPEMMPDEAMVKVKAVGLCGSDIPRAL
FT                   VYGAHVSPITIGHEFSGEIEAVGSEVKNFKPGDRVVVPPLIPCGECEWCQKGIYSLCED
FT                   YDYYGSRRDGALAEYVSVKESNLLKVPDKVSFEDAATLDPCANAYHGLMRGNFKEGDSV
FT                   CVVGTGPIGLFAAQYAKLYGASKVIAVDVWDEKLEIAKKVGADVVINSTKEDAVEAVHQ
FT                   ATDGKGANIVIDFSGAPIAQKQCILMASKMGRVVFLGISHKGLDLSEKEVDTIMRSQLS
FT                   VVGSWNSFTKPYPGEDWTESLKGFDEKGMTAKDIISHRLPLDDAPAVLGEIAKGGYFYN
FT                   KVMFYPDGYDGDFDTV"
FT                   /protein_id="YP_003958034.1"
FT   gene            46768..47631
FT                   /db_xref="GeneID:9881948"
FT                   /locus_tag="ELI_0047"
FT   CDS_pept        46768..47631
FT                   /locus_tag="ELI_0047"
FT                   /gene_family="HOG000027157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825678"
FT                   /db_xref="GeneID:9881948"
FT                   /translation="MEVKGTLKSLLSDIRIKYNTFSKAQKRLADYILCEPEKVTLLSIT
FT                   ELAGKGDTSETTVMRLLKKLEYDSYQVFRINLAKELTEKPGETLNEELSEEDGLATIKK
FT                   KVIKHNVTAINDLEQTLSEDTIAEFLEFLAASKRVLFFGVGASASISQDALHKFGNIGI
FT                   NVCSHPDPHQMNIICAHSTPDDLFIAVSHTGESQEVLNAVSIARKNGSKIISLTSYANS
FT                   SLAKMSDLYLLSSTNDKKYHSEAMASRIVQLTIIDILYIATFMQNEDVYFEEMNKSRIA
FT                   VALNKT"
FT                   /protein_id="YP_003958035.1"
FT   gene            complement(47684..49249)
FT                   /db_xref="GeneID:9881949"
FT                   /locus_tag="ELI_0048"
FT   CDS_pept        complement(47684..49249)
FT                   /locus_tag="ELI_0048"
FT                   /gene_family="HOG000222138" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825679"
FT                   /db_xref="GeneID:9881949"
FT                   /translation="MKEKKYVVGIDLGTTSARTVVFDFDGNEIGSGQIMNPLTYPAPGR
FT                   QECDGDELIKHLYRTTRLAIDNSGVDPEEIAAISTDVFRCTVALRDENGGFTMPIIIWQ
FT                   DMRSAEMIPEVERKLVAAGLSADELYDRCGMPLGGVNPQSNLQWILKNMPEAYEKAATI
FT                   HTMMGLVTKAYGADDYYDDINDTPWVQLNGPDFQYDPQICAALGIDINKMAPLRQPGTI
FT                   IGKVTAEVAARTGLAEGTPIVMGTGDQQSGCLGCGCVREGVGYACGGTAGIVAGKSFNL
FT                   LRDPSRRCYVLGTPDGAWVMEGVANASGSAFKWFKEQFCDVEQLAAESLDISVYDFLTS
FT                   VATKSNPGANGLFFLPYFAGAVTPNQNPNARGTYIGMTVGHTKEDFIRATMEGVNYDIR
FT                   DMLDAMVSGGAPDFDMVRLTGGIFRSELWCQMQADIFNRSCEVVAVEEATALGCAMVAA
FT                   VGVGIYKDFEEAEKHMVKIRRRYEPNPENVKRYEDAFRTWQQIYKSLSTGAFDQVVAFQ
FT                   DKYR"
FT                   /protein_id="YP_003958036.1"
FT   gene            complement(49300..49674)
FT                   /db_xref="GeneID:9881950"
FT                   /locus_tag="ELI_0049"
FT   CDS_pept        complement(49300..49674)
FT                   /locus_tag="ELI_0049"
FT                   /gene_family="HOG000060312" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825680"
FT                   /db_xref="GeneID:9881950"
FT                   /translation="MEKQITCIGCPLGCAVTVTMNQGEITDITGHTCSRGEKYARKEVT
FT                   HPTRIVTSIVKVNEGDIQMVSVKTESDIPKDKIFDCMEAIREIVVTAPVKIGDIIVPDV
FT                   CGTGVNVIATKNIDKKACSY"
FT                   /protein_id="YP_003958037.1"
FT   gene            complement(49679..50944)
FT                   /db_xref="GeneID:9881951"
FT                   /locus_tag="ELI_0050"
FT   CDS_pept        complement(49679..50944)
FT                   /locus_tag="ELI_0050"
FT                   /gene_family="HOG000060029" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825681"
FT                   /db_xref="GeneID:9881951"
FT                   /translation="MKSYEIVIIGGGPAGLAAAISAKQSGVNDILIVERDRRLGGILNQ
FT                   CIHNGFGLHTFKEELTGPEYAQRFIDEVADLGIEYKLNTMVVDIEGDKVLTIMNSTDGL
FT                   VKLKAKAIVLAMGCRERPRGALNIPGCRPAGIYSAGTAQRFVNIEGFMPGREIVILGSG
FT                   DIGLIMARRLTLEGAKVKVVAEIMPYSGGLKRNIVQCLDDYGIPLKLSHTVVDIKGQER
FT                   VEGVTIAQVDENMKPVPGTEEEYSCDTLLLSVGLIPENELSSKMEVSLDRKTNGPIVNE
FT                   SFETNVEGVFACGNVLHVHDLVDYVSEEAAGAGKCAAEYVIKQRKPESGPVVELVTGEG
FT                   VSYTVPKTIDLSRMDETLKVRFRVSGVYENCTVSVYFDDKRVKHRKKRIVTPGEMEQIE
FT                   LVRQDLQAEPDLKQILIKIEEA"
FT                   /protein_id="YP_003958038.1"
FT   gene            complement(50955..52418)
FT                   /db_xref="GeneID:9881952"
FT                   /locus_tag="ELI_0051"
FT   CDS_pept        complement(50955..52418)
FT                   /locus_tag="ELI_0051"
FT                   /gene_family="HOG000060323" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825682"
FT                   /db_xref="GeneID:9881952"
FT                   /translation="MKKMYDLVIIGAGVTGCCIAREISKYEVNACVIEKGDDVASGTSK
FT                   ANTGVIHTGLEADPGSLMAKLCVEGNRLMWKLSEELDFPVKKNGKFIVCTHEEDLPKLQ
FT                   EQLDHAEKNGVPGCRIVPRDEVLRLEPNLTERTVAALYAPTGGVICPFNLAIAMGENAN
FT                   VNGVAFKFETEAYDIIKADGFYTIKTNRGDIQTKAIANAAGVYADKFHNMVSEKKIHIT
FT                   PRKGEYIFFDKSLGTIFNATVVPLPGKMGKGIAASQTIHGNFFVGPTATDVDDKESFQT
FT                   TQEVLDSLKEIAASPDFLHKNPLPLNKIITSFVGLRAHEDHHEFIVEEVADAENFFDAA
FT                   GIESPGLTSSPAIGVMLSGIITEKMQLKKKTNFIARRKGVLKFDSLSDEEKMALIKEKP
FT                   EYGNIVCRCEMVTEGEIMDAINRPIGAKSMDSVKRRTRAGMGRCQAGFCTPRTMEILSR
FT                   ELGIKMTDITKKGGASQLLTGCDKEIGQE"
FT                   /protein_id="YP_003958039.1"
FT   gene            complement(52424..53074)
FT                   /db_xref="GeneID:9881953"
FT                   /locus_tag="ELI_0052"
FT   CDS_pept        complement(52424..53074)
FT                   /locus_tag="ELI_0052"
FT                   /gene_family="HOG000241645" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825683"
FT                   /db_xref="GeneID:9881953"
FT                   /translation="MNKQEILGHIDHTLLKAFSTWDQIKALCDDAVEYKTASVCIPPSF
FT                   VKRAKETYGDALNVCTVIGFPLGYNTTAVKAFEVKEAIREGASEVDMVINIGALKDKDY
FT                   DYVQNEIAELKKAAGDHILKVIVETCYLTEEEKVKVCELVTNAGADYIKTSTGFGTGGA
FT                   TIEDINLFKAHIGPSVKMKASGGVKTVEDLEMFLDAGCERIGTSSAIGLLKES"
FT                   /protein_id="YP_003958040.1"
FT   gene            complement(53106..54293)
FT                   /db_xref="GeneID:9881954"
FT                   /locus_tag="ELI_0053"
FT   CDS_pept        complement(53106..54293)
FT                   /locus_tag="ELI_0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825684"
FT                   /db_xref="GeneID:9881954"
FT                   /translation="MNYPKIYLVLDNCFAIKRWVEPETWGPLIKQLGFDYVEASFDNEA
FT                   DFFYSPDWYLDAWFDRVKAVEAAQDIHVANFFTGYQTYRTAGLAHPNEKMARHMLEGWV
FT                   KPAIERLGARGSGIGFSLHAYPDRVLQDPELYKKETRKVSELLSEIGGIAKDNGNIPVC
FT                   VEAMYAPHQTPWTIEGTKNFLRDIYNIGQNPVYTTIDMGHMVGQVRFQKPSRDAVRKSI
FT                   EAAIEGRVFTEPWLGGDTTYAVWEKAIKDKDTGDGILDAIEADMARYPHLFSFDPADSD
FT                   PYAWLEALACYSPIMHMQQTNGVTSSHAAFTEDNNAAGIIDGARLLAAIAKSYEKEDPA
FT                   MPPKAEAIYLSFEIFASNAEHPREIKNKLKETCAYWRTFIPKDGMPLNELIERLK"
FT                   /protein_id="YP_003958041.1"
FT   gene            complement(54315..55358)
FT                   /db_xref="GeneID:9881955"
FT                   /locus_tag="ELI_0054"
FT   CDS_pept        complement(54315..55358)
FT                   /locus_tag="ELI_0054"
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825685"
FT                   /db_xref="GeneID:9881955"
FT                   /translation="MQAFVLNENRELEVREVPEPQGNDDNIIVKVKSASICGTDMRTFL
FT                   KGNDKIDVPRVLGHECAGDIVHAGKLAREHGYQAGDRVTIAPAIGCGECWPCKTGHTNM
FT                   CDHLTTIGFQYEGVFAPYLEIPAQAIKMNNVIKLPDSIEYDDATLIEPAACALNGQRYM
FT                   HIEPGDFVVVYGSGMIGCIHAELAFQKGAAKVIIVEPVEKRGKIAMEKVPGVIWVNPFT
FT                   QDTAAEVEKITEGRGANVVITATSVPSVHTEAQVIAAKMGRISLFGGLPGESRGHIDSN
FT                   LIHYKELQVCGVHATTPDCMREIMQLMAEGKLDAKKYIERSIKLENIMDGFTAIRDENI
FT                   MKVVVHP"
FT                   /protein_id="YP_003958042.1"
FT   gene            complement(55376..56428)
FT                   /db_xref="GeneID:9881956"
FT                   /locus_tag="ELI_0055"
FT   CDS_pept        complement(55376..56428)
FT                   /locus_tag="ELI_0055"
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative L-iditol 2-dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825686"
FT                   /db_xref="GeneID:9881956"
FT                   /translation="MKAVRMYKPGDLRVEDVEKPKMMDDEAMVKVRAVGLCGSDIPRAL
FT                   VYGAHVSPITIGHEFSGEIEAVGKNVKNFKPGDRVVVPPLIPCGKCEWCQKGIYSLCED
FT                   YDYYGSRRDGALAEYVSVKESNLLKVPEGVSYEDAATLDPCANAYHGLMRGGFKEGDSV
FT                   CVCGTGPIGLFAAQYAKLCGASQVIAVDVWDEKLDIAKKVGADVTINSLNEDPVEAVKK
FT                   ATDGKGANLVIDFSGVPAAQKQCILMASKMGRVVFLGISHKGLDLSEKEVDTIMRSQLS
FT                   VIGSWNSFTKPYPGEDWTESLKMFGERGMTARDIISHRLPLDDCPGIFDKIKEGGFFYN
FT                   KVMFYPWGQE"
FT                   /protein_id="YP_003958043.1"
FT   gene            56643..57488
FT                   /db_xref="GeneID:9881957"
FT                   /locus_tag="ELI_0056"
FT   CDS_pept        56643..57488
FT                   /locus_tag="ELI_0056"
FT                   /gene_family="HOG000027157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825687"
FT                   /db_xref="GeneID:9881957"
FT                   /translation="MASLLSDIRTKYNLLSKTQKTIADYILDNPDATILLSITELANYC
FT                   STSETTVMRFLKKLDYDSYQIFRVNLAKELIDSPSETINEEIAEGDSTSDIKRKVIKHT
FT                   NTAVSDLEYSINQKDIDQCAEMILNARRVTFFGIGASSAVAIDALHKFGKIGLNVNGFQ
FT                   DSHLMNIHCSHMTSEDVLFVVSHTGESVEVLNAASLAKENGAKIISLTSFSNSSLAKKS
FT                   DVFLSSSTNDKKYHSEAMASRIVQLVIVDILYLSVFMQNEAKFYKALNQSRIAVSLNKT
FT                   "
FT                   /protein_id="YP_003958044.1"
FT   gene            57652..58191
FT                   /db_xref="GeneID:9881958"
FT                   /locus_tag="ELI_0057"
FT   CDS_pept        57652..58191
FT                   /locus_tag="ELI_0057"
FT                   /gene_family="HOG000277079" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825688"
FT                   /db_xref="GeneID:9881958"
FT                   /translation="MMDLMKTAAEVQLVEDTKAVLACNEESEHFGLTLSGEDALAVMES
FT                   RNESLKKHQRVEIGPCVTKKIIHLFCDSQYIWQENYVKTLKRLQDIFFLYKNESDDLVS
FT                   DDELLTFMQEQFEGVCFGDLDYLETTCLQRFCMAVRAGYRGYRKSGGHSEYSLFDEEPR
FT                   WDKELYMKVLRELAWE"
FT                   /protein_id="YP_003958045.1"
FT   gene            complement(58212..58736)
FT                   /db_xref="GeneID:9881959"
FT                   /locus_tag="ELI_0058"
FT   CDS_pept        complement(58212..58736)
FT                   /locus_tag="ELI_0058"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825689"
FT                   /db_xref="GeneID:9881959"
FT                   /translation="MEALYINEPHYTKADTEELLKKNTLGLSKDMTNIKIMGVLIAGME
FT                   IIIFLLSGFKFDLISLIGLAALSLVALIELYACNYDRFIFFITKLKGARLRKVNKVEDK
FT                   PPVFLFYENYADCTFMKHLEYSELTNFKEDDLHFVFYYKNIYFVLQKNAFTKGTPENFR
FT                   EFFLNKTGNAL"
FT                   /protein_id="YP_003958046.1"
FT   gene            complement(58812..60950)
FT                   /db_xref="GeneID:9881960"
FT                   /locus_tag="ELI_0059"
FT   CDS_pept        complement(58812..60950)
FT                   /locus_tag="ELI_0059"
FT                   /gene_family="HOG000292951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YkuG"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825690"
FT                   /db_xref="GeneID:9881960"
FT                   /translation="MDQKVLMTQKWLNATYKNFNGYISCTEDGQTGNGTVASLISALQI
FT                   EIGVSTPTGEFGPMTAELCPTVQSGAKGHIVNIIQGGLWCKGFSSQDLTQDFDNTTVSG
FT                   VNQFKMAAGLTADRKVDAKTMKGLLSTDAVVLISGGDSRIRAIQQALNNKYSDYFWMDL
FT                   NICPCDGVYGRNTCNALLYAFQKEVGIDEPNGVFGPGTAQGANDHNVALNSRQTALVYL
FT                   LQYMLYVNGFNPGSFNGIFDTGVENAVINFQSLMALEADGWVGLSTWAALLVSKGNVDR
FT                   SCNACDCTDRITSQRAQYLKSIGINYVGRYITGYWAVSISEISLILEAGMKFVPIFERS
FT                   GNDLSGNMDVTDASYFTHEQGRQDALYAASTAQELGLPENTTIYFAVDFDAYDFEVDSN
FT                   ILEYFRALSVYLLHYNVGIYGPRNVCTRVSNAGYAKTSYVADMSTGFSGNIGVRIPSNW
FT                   AFDQFYETSYGSGDSQINIDKVMASGQDTGVSSLTLSNVAKGLCNEMLRIFHIDPSIGW
FT                   DWNQKTTIPGPFIDIEYKFGLSGSFTPMVDTSTIPSSDKATITINNGEFEKGDITTAEK
FT                   ILDTLTATDKAIINASGGIQTSVAFANSINHGTLTISFSTVDGFPTFNIQVKQLVYSTS
FT                   VENRNVYFEISFKMKGQPDYQQDLDNIVANHRALLYTGGLVLAIVLLIAAVPTGGLTAS
FT                   TGAALMIAVLLAINTYNN"
FT                   /protein_id="YP_003958047.1"
FT   gene            complement(61125..61859)
FT                   /db_xref="GeneID:9881961"
FT                   /locus_tag="ELI_0060"
FT   CDS_pept        complement(61125..61859)
FT                   /locus_tag="ELI_0060"
FT                   /gene_family="HOG000253777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="muramoyl-pentapeptide carboxypeptidase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825691"
FT                   /db_xref="GeneID:9881961"
FT                   /translation="MEMTLTQVQEALKLCNYAPGTVDGYDGPETQAAVRRTQEGYDIEA
FT                   DGIAGPVTKEHLSKQVRGIQAQLNAKGCGCPVDGLPGPLTDAAVKTLQADFGLVADGIV
FT                   GYNTEAALFDYATADPAPAFDPQEQVTEHFNMQEFKCECGGKYCDGFPVPMNRTLIEKL
FT                   EQVRNDLGIPLVVTSGVRCEILNAEVGGVPDSYHKLGRAADIAVYAANGYTVDAVADAG
FT                   ERYGLKTIRYYDRSFVHFQWNA"
FT                   /protein_id="YP_003958048.1"
FT   gene            complement(61850..62110)
FT                   /db_xref="GeneID:9881962"
FT                   /locus_tag="ELI_0061"
FT   CDS_pept        complement(61850..62110)
FT                   /locus_tag="ELI_0061"
FT                   /gene_family="HOG000000778" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825692"
FT                   /db_xref="GeneID:9881962"
FT                   /translation="MNLKIRLKNKAFWVACIGLIVLILQYAQGFISTDFNVPLIEKILN
FT                   AVVICAVAMGVIVDPTTPSISDSEQVLKKKDKKEGGEKKWR"
FT                   /protein_id="YP_003958049.1"
FT   gene            complement(62298..62696)
FT                   /db_xref="GeneID:9881963"
FT                   /locus_tag="ELI_0062"
FT   CDS_pept        complement(62298..62696)
FT                   /locus_tag="ELI_0062"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825693"
FT                   /db_xref="GeneID:9881963"
FT                   /translation="MKLLEKDDSVISLKAELAIIQEEIIHLTQLEEKWMRLSEKTSYTR
FT                   VERKQQILKQLTLIREAVGEKRRQEHLLKKSLKVILEAIPKLKNIQKKVFYMQRYTGKS
FT                   LVQIAEELEYDYDYIRHVASKANQVMKR"
FT                   /protein_id="YP_003958050.1"
FT   gene            complement(62937..63104)
FT                   /db_xref="GeneID:9881964"
FT                   /locus_tag="ELI_0063"
FT   CDS_pept        complement(62937..63104)
FT                   /locus_tag="ELI_0063"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825694"
FT                   /db_xref="GeneID:9881964"
FT                   /translation="MIFSKCNSYAKNIPKKPGFITLKHRNFIFLLSFSFIFVQNIDTVI
FT                   KNNKPKNQYF"
FT                   /protein_id="YP_003958051.1"
FT   gene            63137..64567
FT                   /db_xref="GeneID:9881965"
FT                   /locus_tag="ELI_0064"
FT   CDS_pept        63137..64567
FT                   /locus_tag="ELI_0064"
FT                   /gene_family="HOG000250777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MttB3"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825695"
FT                   /db_xref="GeneID:9881965"
FT                   /translation="MKKYEQFIAKEDIELIHENTIRILENVGVKFEHEEALEIFRKHGM
FT                   RVEGDVVYMGEKDVRAALSTVPETFTLYSGRGTVEVGGGSMVKLPVGCPAFIEDRGNIR
FT                   KILNKDIIDLFKLIDTSPLLDCNHVNFFTESEGFSDDVKRYSYLALLMKYSNKPFPFAI
FT                   PDTSAEKGSLREAMAGGIRLMKRFEGVEDKCLASVGINPLSPLCYDHAPIERIIGTCSE
FT                   NQGIWLASCVMPVLTAPPSVASILTMVNAEILAGFVFTQLLKPGTPMIYANVSGSTDLR
FT                   TIQLSMGNPEAALMIYGTAALADYYRVPFRAGGAISDAKDLDFQAGMESMMMAEATVEA
FT                   KPDMILHSTGCLGTYNIVSFEKMLMDEEIFAYAERIHRGIDVTEKKICFKDIEKTGPRG
FT                   NFLSGRTPKMYREEFYLTQYLNKADANDWQNKGRVGLKENAGQKVQERIEAYQAPEITK
FT                   EQEELLKPYLPEAYRDQI"
FT                   /protein_id="YP_003958052.1"
FT   gene            64578..65807
FT                   /db_xref="GeneID:9881966"
FT                   /locus_tag="ELI_0065"
FT   CDS_pept        64578..65807
FT                   /locus_tag="ELI_0065"
FT                   /gene_family="HOG000166273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825696"
FT                   /db_xref="GeneID:9881966"
FT                   /translation="MSKGKRNFLLVLISVMVGIIYFIPYLRFFFYDQMLDGFHLTNLQL
FT                   GTLGSIYGLVALFCYPVSGYLADRFSARILLTISFLVMAGLTFWQSTFPGYNTLVVIYV
FT                   LYGFFTTATLWSPYICFVRHLGTEEEQGKLFGVSEAMRGVVSAVTGFVFLWMLGLFVDS
FT                   VGGMQVLLWISVGLYVLFAALSIVFLPKTEVKGSKQDSPQEKGMKNIIKALKLPGTWLV
FT                   AFFLFSCFCVINTGTNYLGTYTTQVLGVSASVSSGLAIFRSYVIVIAAGVLGGILADKA
FT                   KSRAIFISGLLGGIIVCAALLIFSSSLVTVSIVITMVMSFLYFTVKSVYYSVMGEGGIP
FT                   LELTAAATGIISFIAYAPEAFMTTIMGSWIDADPVVGFNKIFIWMISFSVISIILAVII
FT                   YRRHKKAEGI"
FT                   /protein_id="YP_003958053.1"
FT   gene            complement(65804..67255)
FT                   /db_xref="GeneID:9881967"
FT                   /locus_tag="ELI_0066"
FT   CDS_pept        complement(65804..67255)
FT                   /locus_tag="ELI_0066"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma-54 dependent transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825697"
FT                   /db_xref="GeneID:9881967"
FT                   /translation="MEQDLKALRPLNIGDLERITDMAVMILDAEGRIICYSKGCEKIEA
FT                   LRRDEVIGKSPEELYNPQQFPNIIRPKRSMVLDTLKTGKIYQETLDYYTTVGGNEANIL
FT                   CSTYPIYGKNGKIDYALCIYREVSDYLEMIADGNKKQSDRQAPSQYLQNGTQHTFANVI
FT                   GSSPMLQKAVYRGKIAAKTDAPVLIWGETGTGKEVFAQSIHNYSAFSSYPFVAVNCSAI
FT                   PEALLESTLFGTCKGSYTGAVNRKGLFEEAENGTLFLDELNSMDIGLQSKLLRVLETGR
FT                   FRAVGGQEEKPCKCRIISAINEEPFIAIENSHLRADLYYRLAVFSIELPPLIRRREDIS
FT                   ETAEYFIGSMAPVLGKKVTRLSSAVKQIFEYHSWPGNVRELRHIITQAIYFAGKDEAFI
FT                   KPHHLPEYLLRTKAAPEKAPPSGLPGTSGEERLSHLMNAYEAKIIQDALENNGHNISQT
FT                   AKQLQISRTNLHNKIKKYNLEKAEG"
FT                   /protein_id="YP_003958054.1"
FT   gene            67522..68115
FT                   /db_xref="GeneID:9881968"
FT                   /locus_tag="ELI_0067"
FT   CDS_pept        67522..68115
FT                   /locus_tag="ELI_0067"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825698"
FT                   /db_xref="GeneID:9881968"
FT                   /translation="MDENRVSVPADPGGAMLFVFSMEVISFWAVYLDVFSEGTYLVLGC
FT                   LMLAVYPVYLIGAFIYYKRNDAYMGNCYFIFGSLFGGIFGLIYIALHFGFLFGWDMNIS
FT                   ILAIPMFWGSLAVFALLKPMLKGPVIPLVVYGIAAIWLFTYGLELLSVGSLIIFTVNKY
FT                   LSLIVGVGTAYLFVNDLLLSAGDRGLPMGPLLGH"
FT                   /protein_id="YP_003958055.1"
FT   gene            complement(68162..69553)
FT                   /db_xref="GeneID:9881969"
FT                   /locus_tag="ELI_0068"
FT   CDS_pept        complement(68162..69553)
FT                   /locus_tag="ELI_0068"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825699"
FT                   /db_xref="GeneID:9881969"
FT                   /translation="MNNPFQHSEEYMNYLMSLPKELYIKILENLFLGVFVSDQNGKTIY
FT                   VNPAISRHYGKLPEDLVGDSDWGKWEGVVYPPAYKNMLAMKRPLIYRQKNMLSRNYMEI
FT                   IDTPVMKEEAPDDIDFTVYVIQENFSDVDFDADAKLMEKPEKVKKRQRRNIVGESHAFL
FT                   KRIVELERIAKSDMSILLLGESGTGKTLIAEYIHQCSDRGFGPFMSINCGAIPDNLLES
FT                   ELFGYASGSFTGANTRGKKGLLESADKGTVFLDEIGDLPLNLQVKLLHAIESKSFLPVG
FT                   GTTPVHVDVRIISATNKDLKTAIAQKTFREDLYWRIGSFISYIPPLRERKEDIIPLSLH
FT                   YLKKQNLKYGTNKVFYSLTLLALVNYDWPGNIRELKNVIERMYVLTSGSIIYESKVPEE
FT                   IRMHVPRTDDKFYYSYDQLLDQVKSYIIQDCYSRRKTSVGVAEELGITQSKASRLIRKY
FT                   CAKEE"
FT                   /protein_id="YP_003958056.1"
FT   gene            69670..69825
FT                   /db_xref="GeneID:9881970"
FT                   /locus_tag="ELI_0069"
FT   CDS_pept        69670..69825
FT                   /locus_tag="ELI_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825700"
FT                   /db_xref="GeneID:9881970"
FT                   /translation="MINRRPFFMEKWRIWGFFKIGTGLALLNGMNRKADPSRICRMMES
FT                   SVINEK"
FT                   /protein_id="YP_003958057.1"
FT   gene            69852..71315
FT                   /db_xref="GeneID:9881971"
FT                   /locus_tag="ELI_0070"
FT   CDS_pept        69852..71315
FT                   /locus_tag="ELI_0070"
FT                   /gene_family="HOG000250777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trimethylamine methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825701"
FT                   /db_xref="GeneID:9881971"
FT                   /translation="MYPNRNLFEKYITRDEIELIHEYTLKILAEVGVVIESDYAAEVFA
FT                   KNGARVEGHKIFIDEALLKRGLSTVPKEFDIYSPSGKLTLGETAPTICAGPVAPTTIQD
FT                   FENNTYRPANLKDVAEYYMLQETSAVIDMPTHSCQNTDDLDKSGDDFHTPQVAMGLKYC
FT                   RKPIYQGNTITPINYKKGSLVEANRRLVKLHREFYDIWDKPVTMSNCCVLSPLAIGAEV
FT                   VDTIVGAVLENQPVIIISCSMTNLTCPPTLASAIVQDNANILAGIVLTQLINPGVGAVY
FT                   GSVTSPTDMRNVQLATGAPEAVLMQMGLVAMGRYYNLPVRSGVSATTAVDLDFQCGAES
FT                   MMTLMTGMLGKTDFILNAAGAYGGYNLGSLENFVLDEENIAYLRRVNQGLDITEDKLYF
FT                   DLIKKTGPRGNYLKGRTPKDYRKENYFPNIFVREGGSPADVIEKNGNLVARARKVINER
FT                   LESYALPDVTTTQKKLLNEYLPEGHKYDL"
FT                   /protein_id="YP_003958058.1"
FT   gene            71343..72257
FT                   /db_xref="GeneID:9881972"
FT                   /locus_tag="ELI_0071"
FT   CDS_pept        71343..72257
FT                   /locus_tag="ELI_0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar isomerase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825702"
FT                   /db_xref="GeneID:9881972"
FT                   /translation="MRRNDRPLQLGMHTYTLHLSGLGESWGFDDTHAFEKSINLMQLMD
FT                   LAVEWGLDGLHITNVDLETLDPAHLAEVKAAAEDHGLYLEYNVSFDAPCDPRVNSNVHD
FT                   ALVNAKAMGADLVKFSLDIERPKPLYGTCFHPEVMSQLAARYREFKENIPLMEELGLQV
FT                   SIENHCDTYADEVIWLVKQLNHPDIGACLDTINSLCVLEGPEACAQKMAPYANCCHFCD
FT                   NKLVIDPDGTHSIGVAIGDGDIDCAKILKMLKEEAPLSRITFEVEYEIGEDTLEVAREK
FT                   EIEACKKSINYLRNVLKLGVRGR"
FT                   /protein_id="YP_003958059.1"
FT   gene            72279..73619
FT                   /db_xref="GeneID:9881973"
FT                   /locus_tag="ELI_0072"
FT   CDS_pept        72279..73619
FT                   /locus_tag="ELI_0072"
FT                   /gene_family="HOG000166273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825703"
FT                   /db_xref="GeneID:9881973"
FT                   /translation="MKVTGKKRWVVLTLVSLLGGIMVYVPFLRYNYYDQMITVFTQFKP
FT                   IVSESYAHEFIGDIGLWFGIFSVLIYPIGGILADKFSERNLLVIGAAIMGLASFWYGMV
FT                   PGSTEIMIIHILYGIGTSIFIWSAYLKVVRKMGTDAEQGRMYSTSEFVRAIVGTAIGFF
FT                   GASLLNKAIFSGTGVDAQVLGQQWQLMLFFNGALFIVLGILIFILVPRKITGAEESNEV
FT                   VQEGFSMKSITTVLKMPGTWLLALLIFFCFSFTSAGAGYLGTYTTNILGISETQASNFA
FT                   VIRNYIIAGLSTLAIGFIADKIGSKVKTLGIYLVLATVMAVVMILTKDATMLCIVVTFV
FT                   FATVYTGMRGIYFATLSEVGIPLSLTGVATGIISLICYTPDIYFAKLAGSWLDAYGSAG
FT                   YDFIWYWAIGCGILGIITAVITLAYSKKLQAKNKTKQPAAETVADAE"
FT                   /protein_id="YP_003958060.1"
FT   gene            73634..75037
FT                   /db_xref="GeneID:9881974"
FT                   /locus_tag="ELI_0073"
FT   CDS_pept        73634..75037
FT                   /locus_tag="ELI_0073"
FT                   /gene_family="HOG000250777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trimethylamine methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825704"
FT                   /db_xref="GeneID:9881974"
FT                   /translation="MKQEYNFAPKEELELIHAHSLRLLKETGVVFYCDEALEVFKKHGA
FT                   RVDGETVFIEEKMLNEALRTIPKTYEWHGRKNTLTLGGGKPIYASSYGPMYVYEDDDYH
FT                   FPTPLDFANFAKLDQSSRVVTIGNPNNMDMPQIKPEERSNYAMAATLMYLDKPLMGMVD
FT                   GKKSATDCLNMVRRFYGMDDSDKRCVVSGLINVASPFHYSQAMCEGLMKYASEGQATFV
FT                   TSAGMSGLTVPDTLAGHILVANTEILAGVVLTQLINPGVPVVYGLQGLGSDLRYTVGTM
FT                   GSPEQSLIFQTAKALANFYGMPVRTGGLMNDAKDMDIQAGVESFNSGYAAIMSGVDVML
FT                   LSCGMLDSVNTISYDKYIYDEEMIQSIERFVRGYEVTEETLQLDKIQKAGPGGDFLGRT
FT                   TRLYRRDYFMPEICNRLSHGNWIAAGKPIVKSRTKAAYQKRLEEYVMPEMDKDQKALVE
FT                   KYIPKEHWY"
FT                   /protein_id="YP_003958061.1"
FT   gene            75409..77004
FT                   /db_xref="GeneID:9881975"
FT                   /locus_tag="ELI_0074"
FT   CDS_pept        75409..77004
FT                   /locus_tag="ELI_0074"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="BCCT transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825705"
FT                   /db_xref="GeneID:9881975"
FT                   /translation="MEGKNKEKGKSVWQEVDKRVLIPGGICLLLVVLAGAVFPAQFETG
FT                   LSACVEWIMAHFKWLYIVCVCAITIVCFWLIFSKYGNIRLGGKKAKPSFSLFTWCTLSL
FT                   TGTIAVGICFYGVSGPVNAFMNPPEFLHVAPGSPEAVIPSLKYCFLHYGIPSYFLMVFF
FT                   AMILALVYYNGKRDLRGSSTLFPLIGDKSKTWIGNIANILMVVCLIVCGTNMGLAVIQL
FT                   NAGIGTVAGMTETPSFEVVLIVIYTVATVIFATSGAHKLMGRLSNVNAVCYAVILIFVL
FT                   FTTSVNDTFNLLFTALGEFVRDFIPMISFGDPIYQTGWQNSNSMFYYAWNLVPALMQAL
FT                   FYVSIAYGRTLRQFLLVNCLLPCTVVFTWYAAFGGNAMLGILNGSDLFAQMQQFGDGIA
FT                   TFAFLDTLPLGQIMKWVFIIVAMMTFITFSDSVAYSFPMLLMKKTSTDISLTKIPKALN
FT                   AAVAIFMGVLTMVLLFVGGYDALNQVIVALGFPAVIFTLIVLIAGVKFILHRDKYDATY
FT                   IEEMEEAARTTKIE"
FT                   /protein_id="YP_003958062.1"
FT   gene            77273..78244
FT                   /db_xref="GeneID:9881976"
FT                   /locus_tag="ELI_0075"
FT   CDS_pept        77273..78244
FT                   /locus_tag="ELI_0075"
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADPH:quinone reductase-like Zn-dependent
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825706"
FT                   /db_xref="GeneID:9881976"
FT                   /translation="MKAIIVSSFGDEEVLKYQETETPTPAAGEVRVKIKAAGVNPVETY
FT                   IRSGHYTALPALPYTPGNDGSGIVDAVGDGVEHLKKGDRVFVAAALARRNTGTYADYTV
FT                   CDADAVRYLPQNLSFSEGAALGTPGLAATYALYSKAKIKPGETVFIHGASGGVGSLAVQ
FT                   LARRTGTFVMGTAGDPEGMTLIEKLGAHRAFNHRSPGYLEAVKQETGEHGPDVIIEMVA
FT                   NINLMKDMELLAKYGRVVIVGNHGTLEFDPRSAMTKDAVVMGMNIGNMPQEDYIANMYT
FT                   LSAAMETGLHTIIGKELPLCQAEQAHRDVREGKGGKVVLTVE"
FT                   /protein_id="YP_003958063.1"
FT   gene            complement(78282..78632)
FT                   /db_xref="GeneID:9881977"
FT                   /locus_tag="ELI_0076"
FT   CDS_pept        complement(78282..78632)
FT                   /locus_tag="ELI_0076"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional repressor"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825707"
FT                   /db_xref="GeneID:9881977"
FT                   /translation="MKQTIGQRIRLALEINHMRQSDLSKKTGISPSAINQYISGNFEPK
FT                   QNNIYLLAKALNVNEAWLMGYDVSIERSDNSAPLITEQEVALLKLFRKLSETGQDEALK
FT                   RVEELSELSRYV"
FT                   /protein_id="YP_003958064.1"
FT   gene            complement(78711..78839)
FT                   /db_xref="GeneID:9881978"
FT                   /locus_tag="ELI_0077"
FT   CDS_pept        complement(78711..78839)
FT                   /locus_tag="ELI_0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825708"
FT                   /db_xref="GeneID:9881978"
FT                   /translation="MTLPRFFSFNKFYYIITHFIYEYNNNFIFFLILFYLMYFVRK"
FT                   /protein_id="YP_003958065.1"
FT   gene            78838..79080
FT                   /db_xref="GeneID:9881979"
FT                   /locus_tag="ELI_0078"
FT   CDS_pept        78838..79080
FT                   /locus_tag="ELI_0078"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825709"
FT                   /db_xref="GeneID:9881979"
FT                   /translation="MCFNYDRLLERVLEVFWDKRVFAVEMQMAEAVLISRIENKTPFRK
FT                   EEIDRAVMLLNIDHEKISDYFFRIENDKRGQIEKM"
FT                   /protein_id="YP_003958066.1"
FT   gene            79067..79303
FT                   /db_xref="GeneID:9881980"
FT                   /locus_tag="ELI_0079"
FT   CDS_pept        79067..79303
FT                   /locus_tag="ELI_0079"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825710"
FT                   /db_xref="GeneID:9881980"
FT                   /translation="MKKCDYRLCGNFDERFGNNCRALSRVIPQKECFARMSRQTARQVD
FT                   EEIRDALETETAQTNRRYYEKKNKNMNDEKRGK"
FT                   /protein_id="YP_003958067.1"
FT   gene            79307..80020
FT                   /db_xref="GeneID:9881981"
FT                   /locus_tag="ELI_0080"
FT   CDS_pept        79307..80020
FT                   /locus_tag="ELI_0080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pathogenicity island protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825711"
FT                   /db_xref="GeneID:9881981"
FT                   /translation="MYSEKTKFYTHPELGVQTVALKDGQVYFIPKDFTGRFGYKCNDAL
FT                   VRRLCKGQQMLMVPVGPDTRKMRKVLGVPCHEALAIINDIAHYITEKEAYRLWFDEILL
FT                   DFMKPEFDLKEELLKCIHRYHSNGGATFTDMERNFDRYGYDYQGDCSLVFEAVGGGQPV
FT                   YFWSGWNKETFEALAQLVEEGRIQRRYTGPLPYYYEGHALSLPVIHDIDGIAAGGWLPI
FT                   GFTITPAGEAALEAA"
FT                   /protein_id="YP_003958068.1"
FT   gene            80357..83659
FT                   /db_xref="GeneID:9881982"
FT                   /locus_tag="ELI_0081"
FT   CDS_pept        80357..83659
FT                   /locus_tag="ELI_0081"
FT                   /gene_family="HOG000166274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825712"
FT                   /db_xref="GeneID:9881982"
FT                   /translation="MKKFLTVLLSALLVAASLPLAAFAQTASEETPVITGDYVQGEVIV
FT                   CMDSGSTALRSRSALPELLAGAEQLMTLSDSAGDADNAQLRSRSAASADTQVLALVKDE
FT                   SRSTEALIAELESYPQVVFAEPNYITTNFETTATETYPDLSDLQWANSDQSSKNNPFGN
FT                   PQGFNIGVPDWNVPSASAESDNPVVAILDTGVDLTNPDLKDKLWTRPAGSGLPGGDHGI
FT                   NVSGEGSQENVVDTNGHGTHCAGIVGAAWNNMGVSGAGEKIEIMAIQSNNAISSKIQGF
FT                   DYVKQACQEGVNVKAVNLSWGGPGQSKALDRAIEETGKAGAIALVASGNSGWDNDISNS
FT                   MASGFSNNPYAVVVNSANPTGTMSTFSDYGKRTTDIVAPGSQILSTVPMDQSVYYPEKD
FT                   KAPVWYDNFEDGQAPAISFFYDAACTEAAKVTKISGDKVYEGSKSLSIDIEDAESGNVV
FT                   LYSQPMDLSEKASAIENKAISIKVAAAGQKVGACALLVKNTGGEFEKVKISGGSALDGT
FT                   WMNYSAALPKDTDYKNFQMKVLFAFRDITFLPDSSNPSVTPNSGTVYADAMGIGDASKM
FT                   LPFDYKNGTSMATPAAAGAAALLGSQYNESGAALAARVVGSVTKYPNFTDKCVSGGMVN
FT                   VSQTRPYPVLNSIVDQGDTVEVDGYFFENLESAKIGGMDAEIVANVPEAVSATDGGKVV
FT                   TLKKPEGFAGGTAEVSLTTGNGEGHQTFEIGQNVNIDYFEENLPLPEDEDFYKAENKQI
FT                   VGYQNQLYVLPDGLESEPSPEIWAYSIENQKWSTLELPEALVNLTGATWNGRLAVAGLT
FT                   VDEKNQPVEKLWFYDGQWQEQKIEGLPFATSLVNADGTLMGVGGQYIEIDKETNQAAAA
FT                   ATKDIVAIDTKAGTVSKAGELAEARVYGKVNAHENRLIISGGTDSTGEPVGSIELVTQS
FT                   ENGYQGMKVSLDIKKGQAFNSIANATVKNGFMLAGPQSASEDPAAVADAYTVDPQTGVI
FT                   TPYGKRIDDGILIGTGATAYHDQLYVLAASYTAPGGYIFKATAVETINLQPGEEADKKP
FT                   DDNSGQPVNPENKPDNVKTGIVEDSQTAAFLCAGLLILAVAGLAAYRKRKIS"
FT                   /protein_id="YP_003958069.1"
FT   gene            complement(83714..84226)
FT                   /db_xref="GeneID:9881983"
FT                   /locus_tag="ELI_0082"
FT   CDS_pept        complement(83714..84226)
FT                   /locus_tag="ELI_0082"
FT                   /gene_family="HOG000249577" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825713"
FT                   /db_xref="GeneID:9881983"
FT                   /translation="MIRLKAAFLCCSLLLAAAFTGCAADTAASSAPEPEKPSPSVQTTA
FT                   QAETTPTAVTELRIQAGDRVFTAQLEDTPAAQALAAAMPMTLNMDEMNGNEKYFFLSDA
FT                   LPTNAERSGHIAAGDLMLYGDNCLVLFYESFQSAYSYTHLGSITDTAGLADALGSGSVE
FT                   VSFSLAE"
FT                   /protein_id="YP_003958070.1"
FT   gene            complement(84254..84796)
FT                   /db_xref="GeneID:9881984"
FT                   /locus_tag="ELI_0083"
FT   CDS_pept        complement(84254..84796)
FT                   /locus_tag="ELI_0083"
FT                   /gene_family="HOG000030547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="iron-sulfur flavoprotein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825714"
FT                   /db_xref="GeneID:9881984"
FT                   /translation="MKKNILILSTSPRKGGNSDTLADEFTRGARDAGHDAEKISLAGKT
FT                   IGFCRGCLACQKTERCVIQDDVNAIVQKMLSADVLVFATPIYFYEMSGQMKTLLDRSNP
FT                   LFPADYAFREIYLLAASADENRDSMDGAVKGLQGWIDCFERAKLAGVLRGTGLDAVGAA
FT                   KNAPLVLKAAYDMGKTL"
FT                   /protein_id="YP_003958071.1"
FT   gene            complement(84826..85395)
FT                   /db_xref="GeneID:9881985"
FT                   /locus_tag="ELI_0084"
FT   CDS_pept        complement(84826..85395)
FT                   /locus_tag="ELI_0084"
FT                   /gene_family="HOG000049435" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825715"
FT                   /db_xref="GeneID:9881985"
FT                   /translation="MNLDTFLEHLNKGLTVDGGSEAHEFMHKVSQEALRITSALNNTYH
FT                   SPEEIRELFSELTGKPVDASFGLFPPFYTDCGKNITVGKNVFINSGCRFQDQGGITIGD
FT                   GALIGHNAVLATLNHDFSPEKRSSMHPAPVVIGKNVWLGANVTVVPGVTIGDNAVIAAG
FT                   AVVTKDIPAGTIAAGVPAKVLRELSV"
FT                   /protein_id="YP_003958072.1"
FT   gene            85553..86446
FT                   /db_xref="GeneID:9881986"
FT                   /locus_tag="ELI_0085"
FT   CDS_pept        85553..86446
FT                   /locus_tag="ELI_0085"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825716"
FT                   /db_xref="GeneID:9881986"
FT                   /translation="MELRVLRYFLAVAREETISGAAESLHVTQPTLSRQLMELEEQLGK
FT                   KLFIRGSRRVTLTDEGAFLRKRAQEIVDLADRTEADFKASDEIVGGDVYIGGGETDAMR
FT                   IIAQVVGRMRRDYSHIRVHLFSGNADDVTERLDKGLLDFGILIEPGDITKYDYIRLPAT
FT                   DTWGLLMRRDSVLAALPDIKAENLLEIPLLCSRQSLVRNELSGWFGSDSDKLNVVMTYN
FT                   LIYNAAIMVQEGIGYALCLDKLVNTTGDSALCFRPLSPRLEAQLYVVWKKHPAFSRASE
FT                   IFLKQLQAFLTENDGE"
FT                   /protein_id="YP_003958073.1"
FT   gene            complement(86488..87258)
FT                   /db_xref="GeneID:9881987"
FT                   /locus_tag="ELI_0086"
FT   CDS_pept        complement(86488..87258)
FT                   /locus_tag="ELI_0086"
FT                   /gene_family="HOG000075173" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825717"
FT                   /db_xref="GeneID:9881987"
FT                   /translation="MLFKFIICFIAGIGAGLGTGFAGMSAAAVISPMLITFLGIPAYEA
FT                   VGIALASDVLASAVSAYTYGKHKNLDIKNGLVMMAAVLCFTLVGSWISSLVPSTAMGGF
FT                   SVFMTLLLGIKFIVKPVMTTKDSMTDTSPQKRFVQSVVCGMAIGFICGFVGAGGGMMML
FT                   LILTSVLGYELKIAVGTSVFVMAFTAFTGAVSHFAIGGPPDVWSLVFCVLSTLLWARIA
FT                   AKFANKASPIVLNRATGVVLSVLGVSIILVNFLK"
FT                   /protein_id="YP_003958074.1"
FT   gene            87446..87670
FT                   /db_xref="GeneID:9881988"
FT                   /locus_tag="ELI_0087"
FT   CDS_pept        87446..87670
FT                   /locus_tag="ELI_0087"
FT                   /gene_family="HOG000166275" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825718"
FT                   /db_xref="GeneID:9881988"
FT                   /translation="MAVTANVKSVGLKIVSNYGEENGKIVKKSKTYSDVKSDATNESIY
FT                   NTYKLIKNMQEPVGESCTKTIAEELMDVA"
FT                   /protein_id="YP_003958075.1"
FT   gene            87689..87916
FT                   /db_xref="GeneID:9881989"
FT                   /locus_tag="ELI_0088"
FT   CDS_pept        87689..87916
FT                   /locus_tag="ELI_0088"
FT                   /gene_family="HOG000060671" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825719"
FT                   /db_xref="GeneID:9881989"
FT                   /translation="MANVSKDLQLIYELANGKNYTLTIPDYKDGITDAEIATGANGILT
FT                   EGIFAPDGQPLAALVSAVRIDTTKTEVALA"
FT                   /protein_id="YP_003958076.1"
FT   gene            87927..88322
FT                   /db_xref="GeneID:9881990"
FT                   /locus_tag="ELI_0089"
FT   CDS_pept        87927..88322
FT                   /locus_tag="ELI_0089"
FT                   /gene_family="HOG000162381" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825720"
FT                   /db_xref="GeneID:9881990"
FT                   /translation="MREIIRGAAAVAGGTLSFLFGGLDDLLVVLTVLVCLDYVSGVIKG
FT                   IYRHELSSAVGFYGILKKLMLFLVVSAAFMVQRIITAELPIRDITVLFYISNEGISLVE
FT                   NAAEFIPIPDKLKAVLKEFTKDEKEKK"
FT                   /protein_id="YP_003958077.1"
FT   gene            88319..88840
FT                   /db_xref="GeneID:9881991"
FT                   /locus_tag="ELI_0090"
FT   CDS_pept        88319..88840
FT                   /locus_tag="ELI_0090"
FT                   /gene_family="HOG000253777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative muramoyl-pentapeptide carboxypeptidase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825721"
FT                   /db_xref="GeneID:9881991"
FT                   /translation="MSILEVQRILSHLGYNPGEHDGLDGPNTQAAVKAFQRKAGIKADG
FT                   IAGPVTRGHLAEAYKNSRASEHFAMSEYQCDCDGMYCGGFPELMEEALLAQVENLRNRL
FT                   GRPVIITSGVRCTQRNHEVGGIEYSKHKIGCAADLYCPGVHYSEVAAVARELGLGVIEY
FT                   PEQLFVHVEV"
FT                   /protein_id="YP_003958078.1"
FT   gene            complement(88888..89955)
FT                   /db_xref="GeneID:9881992"
FT                   /locus_tag="ELI_0091"
FT   CDS_pept        complement(88888..89955)
FT                   /locus_tag="ELI_0091"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="surface proteins containing Ig-like domains"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825722"
FT                   /db_xref="GeneID:9881992"
FT                   /translation="MRKRRFGKKMLSALLIAGMLLTAMPLGVFAEEESNAVTPDESGVY
FT                   VVTTPEELQWVADQTRLAENAENFAGKIVRLQAAEIDMQSIPWVPIDNFRGTFDGNNVP
FT                   IKNLTVTNTGEDGSGLFGSIAYTESAAAPTFKNIVIDGATITGANDVGGIVGNAYSADI
FT                   INCKVMNAIFNGGTRIGGMAGLSYGDITNCEVINCQMTGTDENGAVGGIIGLIGEGGSV
FT                   IDSCNVNGCTMVGNRKIAGIAGAIQYGNTIKGCTVNSSTIRATVKFSSILTPIIKNAAA
FT                   AGGIAGEVIGTSTLMTLQDNTVSGDMTVQSNQNKFRGWLIGSMTYRSGTQYVTLTNNQD
FT                   LSNLTGAGVPEIGTK"
FT                   /protein_id="YP_003958079.1"
FT   gene            complement(90028..96138)
FT                   /db_xref="GeneID:9881993"
FT                   /locus_tag="ELI_0092"
FT   CDS_pept        complement(90028..96138)
FT                   /locus_tag="ELI_0092"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ig domain protein group 2 domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825723"
FT                   /db_xref="GeneID:9881993"
FT                   /translation="MKKKNIAIVLLAVITILLLVFGCGKKSSPQAEAKVFDTAGTYSDQ
FT                   ATYGDVQIKSDGVTLENATITGTLTVDKAVGEGTVIIRNSRISKDTDINGGGANSVHFE
FT                   KTALHKVSLNKKDVRLTLDKESEAAELNVIQPAKLELSGKVTTLSIAKNGEGSTVTIAK
FT                   DAKVETVKLDGKAEMTVDSPLKTLVIGENAQESRLVINGRVDKLDVNAKAEINLNAGAE
FT                   VGKLIVTDKAKDSTVNIAKDAKVSTLATETPLSLNGEGSVENVITNKEENIQGSIKPAG
FT                   IRVSANPIAKSPNGNDVNSKTDAAKNTDTNTSTTANNSSTGSTSPENNNTSSNTGNTGS
FT                   GQDNPPAPQPAPGPAPQPAPDPTPTPTPPPTPTPTPSVVHVTGVTLDQSQLIMTVGDST
FT                   VLTARVAPDNATDKTIAWYAEDSKIAAVDGNGKITALAEGQTRITVVTRDGDHKAFCDI
FT                   TIHKKAPTDIPVESIAIQKTADSIEVGNTLRLTASVKPDNATNKNVKWHSAAESVASVD
FT                   EAGVVTAKAPGDAVITATPENPASPSVTTAITLRVTAPFKAVVMSGSGKAVMVGDVLTF
FT                   TSVDPENGLSDALFSWKADGQEVGNGSAYTVSEGDIGKALTLTVTGKENSHYTGSVTSE
FT                   ATKAVTANKTALTAALNAEIGEDHQNPTYKLKKDDYKAVTWNTYTDAVNAAIGVEADPL
FT                   ATTGQVSAAINNIGTAKAQLIFAGIDKLEELKKTADAKQESDYTAASWQAFQSAYGAAK
FT                   ALPETTQAEIVAKTETISKAMDELVLKTPVTAVRLSIEKNQAVVGHQVTATTDPEDATV
FT                   NYLWQRGNGTAFEPIPDADSAVYTLRSDDIGKVLQLTVTGTGDYQGSSSASISKILDNK
FT                   VTDVTLDQATLDMKAGDSKVLTATVTPEYAADKTVTWSSSDAAVAAVDADGKVTAVAAG
FT                   QATVTVTTTDGGKTAACAVTVTNPVISVESVTLAPVSAELYTVEGHKTLELTATVTPEN
FT                   ATNKALAWSSSDSAVATVAAVENSTKATVTALTAGTADITATTADGSKTAKCTITVKEP
FT                   IQLTVSGTTVKSKVYDGNPDAEVENAGSLTNKEAEHDVTLAATAKFNDKKAADNKPVTA
FT                   QYTLTGTDAWRYLAPKDNTDLSASITKKEIRITNIKAADRAYNGYTAVALAGGDLSDIV
FT                   DGDDIHLDTSAVTAQMADANAKENKPVVVTGYTLAGADAENYSLTQPVGITVNITKAEQ
FT                   TAPTFTVTKTSNSITVTPTAASNKLLYALYQSGTSVKDWSMTPSFTGLAASTEYTVKVK
FT                   LSGDDNHNESPEATASVTTDAADIKPAPVITIEKPSVTVSGTAQSQNSTLVGIKNTMEY
FT                   VKSDTEPAADATWTPCQNQNMSVEPGIYYVRYKKTASDAASAAIRLEVKKVYRVTFAHG
FT                   DHGSCHPSVAVFYEGELPSSTISPNSGYLVNPENNGWDRPITAAAGESADIKYTAQYIE
FT                   TKAMVMAFDSKSQTYTIKNTGTATIGEDFTVPATYNDSINGEHPVTAIGDKAFTSNNCK
FT                   DLKTLTIPESITNIGDYAFDGRLALEKVTIKGNPNIGNYAFSGCTALKEIHITSNEAPG
FT                   TTGTEILYNIPGQVRIFVPQEKVADYKNSWVSYADQIYETGTAFFTLSYDANGGTGSVP
FT                   ASAEYAQGTEVNVKFDPLPSTEGKTFLGWAANKNAESPDYTATGTTNSIRVEKATTLYA
FT                   IYGDVVTPPTENNPWDGKRDISWYVGHEEGTSYSITTPQQLAGLALLVNGGGQDDYGKS
FT                   SGGAVDFSGKTITITADKLDLNNVNWVPIGKDDVHPFKGSFDGGFKSITSLSINSENEI
FT                   VGLFGVIDSANLQNVELSDGTVTTTHEGGIAGGMVGFATDSKIEKCHNDAAVSSQISAG
FT                   GIIGGGQAEVTECCNTGKIEAKAELYSMAGGIIGTGTGITVSNSYNTGEVNAPSGSGIV
FT                   GMASSTSELKSFVQNCHNVGSINSGQGFGITATLDNNGKIQTSYSLEGSAATIATIGAD
FT                   DKSKMLTAEEMKTPNNFTGWSFDESNSIWKMGNAYPILAWQTNE"
FT                   /protein_id="YP_003958080.1"
FT   gene            complement(96143..96955)
FT                   /db_xref="GeneID:9881994"
FT                   /locus_tag="ELI_0093"
FT   CDS_pept        complement(96143..96955)
FT                   /locus_tag="ELI_0093"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825724"
FT                   /db_xref="GeneID:9881994"
FT                   /translation="MKENTVEMQYLYELAASVLEVRPPARPPSKLNWELVCREAERLSM
FT                   LSFICYGLEGLGENDQPSNSVMSELKKWKIKGILKEAEQQRLLTNVFCGFDAQNLKCLL
FT                   CSDLPLKRLYPYPDLRCRQEVEIFMPAEAIPCARCILRDLGGSPVAAESTDFGCCRFGQ
FT                   TTLIVKKYADEASFPSSGEKIQKYKHYSNIYEPPPEALYRQLAGSAAQAARGQKEFIWP
FT                   YFDLSMLQRFYHFSLPARHSAFQVNLKSLFSHQGQRPLNIDKTIIHER"
FT                   /protein_id="YP_003958081.1"
FT   gene            complement(97148..98386)
FT                   /db_xref="GeneID:9881995"
FT                   /locus_tag="ELI_0094"
FT   CDS_pept        complement(97148..98386)
FT                   /locus_tag="ELI_0094"
FT                   /gene_family="HOG000235100" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family site specific recombinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825725"
FT                   /db_xref="GeneID:9881995"
FT                   /translation="MKKHRKNIYQRSDNRYEGRYITGYKEIHGKAIYRSIYADTYREIV
FT                   ALLEEAEKSVSEKVAFERLIRKQKRNNLPVTSLEHMAENYSFRNSVQGGTTLRQCLVQW
FT                   LEEHKKFSVKASSYTRYCSIVYKHIVPQLGDFPVADVTAAVVQDYIHYLRTDANKHKGL
FT                   APSTIKIHLVLLSSFFEKMIELEMVQNNPCEAVRIPPSQKKKPNYLKQNEYQKLEKVLE
FT                   DKICDKRARAILLALKTGIRLGELAALRWTDIDLQSKTIHVRHSIQRVKAKSPGKNKTE
FT                   IVFGQTKSVCSQRDIPMNDGIYTLLYSYQKVLKKSGIFTEESFVFSNRQGSYLDPRAYQ
FT                   NYFSKLLKKAGIRCVNFHALRHTFATIAASKNMQISTLSRILGHSTPTITLQIYVHAVD
FT                   EQDRIEMAKIESI"
FT                   /protein_id="YP_003958082.1"
FT   gene            complement(98730..99419)
FT                   /db_xref="GeneID:9881996"
FT                   /locus_tag="ELI_0095"
FT   CDS_pept        complement(98730..99419)
FT                   /locus_tag="ELI_0095"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825726"
FT                   /db_xref="GeneID:9881996"
FT                   /translation="MKVKIYDQIINDIMDDIHYGNLKPGEKLPTYAELAKKYNTSIVTV
FT                   RKSISSLINKGYLSAVERVGTFVRECEKEQYLISFAPQANINEEITEISVEDISLSLIK
FT                   MREIRQEMKAVEMRQILYSDTLPICYIITALLLNGRYNPESMADMTERNLQTINKILDG
FT                   FEIKKVLEITMDTPNRFIQNKLLVDRDDPVFCFTTYYYTMKDEPVGKSVLYAAGENIDL
FT                   YGKSFLK"
FT                   /protein_id="YP_003958083.1"
FT   gene            complement(99441..99941)
FT                   /db_xref="GeneID:9881997"
FT                   /locus_tag="ELI_0096"
FT   CDS_pept        complement(99441..99941)
FT                   /locus_tag="ELI_0096"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825727"
FT                   /db_xref="GeneID:9881997"
FT                   /translation="MLAKTNDKFVLSLKPENILKEPYNRVELLGSEIIKPTIELVYHLR
FT                   VAPDSRIVLINWLLFRDDLPVIYDNQFIPYFPGISPWNDDFEYNSFSEIVNQRNHLYIT
FT                   QERIHIEAVGCDAQAAEKLNIPEDTPVMQITQNLMDNDDPLGMRKLYIRKECCKLTGIT
FT                   YLP"
FT                   /protein_id="YP_003958084.1"
FT   gene            complement(100129..100776)
FT                   /db_xref="GeneID:9881998"
FT                   /locus_tag="ELI_0097"
FT   CDS_pept        complement(100129..100776)
FT                   /locus_tag="ELI_0097"
FT                   /gene_family="HOG000223258" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825728"
FT                   /db_xref="GeneID:9881998"
FT                   /translation="MLESIVTAVKKLEEKKVIKLVRYAVKEGASQMQIIESVQAGLDEV
FT                   GKYFETGRYGVTDLMMAGIIFEEILKLDCLKLEKENPEEAIGTILLCTIECDLHDIGKS
FT                   IFKSAALMSGFKVIDLGIDISPEKIVAETKKSHPDVIAISSIMANGVKYMKETNELLVK
FT                   ENLRDEVKIILGGLSTHKDAVEYVGADAFTKDVYEGVNLCKEWMEGGVSHKL"
FT                   /protein_id="YP_003958085.1"
FT   gene            complement(100793..102169)
FT                   /db_xref="GeneID:9881999"
FT                   /locus_tag="ELI_0098"
FT   CDS_pept        complement(100793..102169)
FT                   /locus_tag="ELI_0098"
FT                   /gene_family="HOG000250777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825729"
FT                   /db_xref="GeneID:9881999"
FT                   /translation="MKLRYSFAEKEECQQIHEYSLDILENTGIVVHSEKARNTFKKNGA
FT                   KVEGKKVFLPPKIVEDHLVHVPSSFTFNTPGHRVTVGDGTTCTMPPYGATYAKKNNVSH
FT                   LAGREDFINFTKLNQVSSQMSMACPYVLEPMDVPIDFREKYKMAMCLKYSDKPTFSMTQ
FT                   DGPSARESIRFAREYWDSQDSNILIGNINISAPLIMGEGTADVILVHGEESQPLMVACG
FT                   SGLSGLTAPPLPAANFLISNAAVLAGIILAQMVRPGLPIVYGFPLFGVNPLSADASPGE
FT                   PTTALFTMAAAEMGRFYKIPVRSGGVFTDSTYLDYQNGAESFMNLFSCLFSGVDCMMHA
FT                   FGMEDSLNTVNYNKYILDEALYSTIKHYLNGFEVNAVTLMLDAIKKNGCTDNYINMSNL
FT                   RLIRKHYAPYPFKNTNGEQDILEETSAVIDERLENYVAPAFTRAQQKHVEGYLPKAFID
FT                   "
FT                   /protein_id="YP_003958086.1"
FT   gene            complement(102275..103732)
FT                   /db_xref="GeneID:9882000"
FT                   /locus_tag="ELI_0099"
FT   CDS_pept        complement(102275..103732)
FT                   /locus_tag="ELI_0099"
FT                   /gene_family="HOG000250777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825730"
FT                   /db_xref="GeneID:9882000"
FT                   /translation="MYVNRRFYDKYVSTRDVELLHEYSLRVLKEVGVSFDCEEALEIFK
FT                   KHGATVEGSIVKIDEDLLNQALETAPKTFTVTTSAGETKIGERFKPKTVGCYGPPKFLF
FT                   EDDEYRVAMKDDMVKFLKLMDTSDVTDFVNNSAYDTADLDKTKDDFYMPQVAMCLKYSQ
FT                   KPTYGNVANSLNVRGKSLKEAAKGIAQLYKEFYDIWDRPVLLTNACALSPLGYSYEVLD
FT                   NIMGLVEEGQPVTIITCSMTNLTAPAALLGSVIQNNATILAGIVLTQLINPGCPVIYGT
FT                   VSSPTDMRTVSLAIGAPEAQLIQMASLALGRYYQLPVRTGIAGTDSLKPDYQAGVESFM
FT                   ILMTTYLGKSDFVLNHAGILQSYALGSYEKFVLDEEVNRILMRLNRGMDISDMRAEKVF
FT                   AEIKKAGPLGNYLSGRTPKEYRQEHWLTKLFNRQAGNPQPIFDEIGDLRERASKEVEER
FT                   VAGYTLPDLTKTQKDILNRYLPEDEKF"
FT                   /protein_id="YP_003958087.1"
FT   gene            103798..103941
FT                   /db_xref="GeneID:9882001"
FT                   /locus_tag="ELI_0100"
FT   CDS_pept        103798..103941
FT                   /locus_tag="ELI_0100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825731"
FT                   /db_xref="GeneID:9882001"
FT                   /translation="MSILKNGKIKKITMNFKDKNPLFSKKSGFSSIEALDKCRKKRKIF
FT                   IF"
FT                   /protein_id="YP_003958088.1"
FT   gene            104066..105583
FT                   /db_xref="GeneID:9882002"
FT                   /locus_tag="ELI_0101"
FT   CDS_pept        104066..105583
FT                   /locus_tag="ELI_0101"
FT                   /gene_family="HOG000053240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825732"
FT                   /db_xref="GeneID:9882002"
FT                   /translation="MKKIFESVDKTIFLVAGSITLLLAIVSIVFTEQVASVFSGIFNFF
FT                   TNTLGFAYIGFALFVIAACLFVSFSKYGKIRLGGDDEKPEYSNISWFSMIFAAGMGIGL
FT                   VFWSVAEPMNHFMVPPFADPQTPEAAVESLQYTFLHWGVHPWALYAAVALPMAYFHFRK
FT                   GLPLLVSSSFYPFLGDKALKGGFSKGIDTFTVILILIGVATSFGLGALQIQSGLEFVFH
FT                   ISGGTLLAVVIVIICTILFVISSTAGIDRGMKLLSNTNTVIVFAVMLFVLLAGPTLYIF
FT                   NITLESIGDYIFKFIPMSFFTDANGTVAAHTGENWIGNWTVFYWAWWITWTPFVGSFIA
FT                   KISKGRTIREFVLAILGVPTIMSCIWFGIMGGTGLNMELANPGSVIQNGAVDTNSSVFQ
FT                   MLSNLPLSGVISVLVMLSLLVFFLTSADAGVQVVSTMSSRGRENSQKLIKVIWGVILGL
FT                   LAIMFIVTGGLSAVQSLSFAFSFPFLIIICLMLAGFFKYLKKEEFDK"
FT                   /protein_id="YP_003958089.1"
FT   gene            105642..106916
FT                   /db_xref="GeneID:9882003"
FT                   /locus_tag="ELI_0102"
FT   CDS_pept        105642..106916
FT                   /locus_tag="ELI_0102"
FT                   /gene_family="HOG000166273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825733"
FT                   /db_xref="GeneID:9882003"
FT                   /translation="MELDKKKRNIVLVILSMIAGIAYLTPLIRFSFYDQMIVALNINDV
FT                   QLGTIAGVYGLFNVIGYVPSGILAEKFNTKKLLILSCGAMCLVTLWYSSFPGYTALIII
FT                   HALYGIFSVGTFWSPYLKAIRNLGSENEQGRLFGISEGLRGIGQTAVAFLCLWAMGLFA
FT                   TQAAGFRAVLLINAAAFALLTVLVIVLVPDFDKGKKEQNAKAEKKESMWKAFGMSSTWL
FT                   CIFVIMCGYTLWNTANGYMGTYCTRVLNISPELSSTLSIIRSYIIVFVAGISGGIIMDK
FT                   FSYKGKGMFWTFLATGVCVLAILFTSKIVAVCVVITVILAYLVNVLKSTYWSILGEAGV
FT                   PLAMTGIATGIISFIALTPDIFVAPIISRFLAYGEAGGNVELGFNMMLVWMVVWAVLGV
FT                   FSAILLKRRGVKTKQLEQAAQAENV"
FT                   /protein_id="YP_003958090.1"
FT   gene            complement(107027..108409)
FT                   /db_xref="GeneID:9882004"
FT                   /locus_tag="ELI_0103"
FT   CDS_pept        complement(107027..108409)
FT                   /locus_tag="ELI_0103"
FT                   /gene_family="HOG000126638" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825734"
FT                   /db_xref="GeneID:9882004"
FT                   /translation="MNDTLKKMDRKNLVKWICVLLVPILIMLIPVQGVFTPALRTFSAI
FT                   TITAILLFAFGLLPNFIVAIALPISYMLLNVAAPDVAFAAWYGSIPWMFMGGFLLANVL
FT                   ERIGLLNRIALWSIIKTGGTYSGILWGLTLAGIILNLIAPGESFVPMAALSFGICKALN
FT                   FEKSRESAGIMMGGFFASWFPTFFLYNPTFAIMPSLGKEVMPIQVTWIQYFFNNLPFVL
FT                   WLALCIFMVIKLCKPKTAINIKDYAVEEYAKLGKITKTEIRSIFVVALLFIFLFTSGMH
FT                   GIDVGWGFALIPLLFFIPGINVGKAEDISKINFNMTIFTTACLSIGYVANALGVGQIIA
FT                   DAVLPMLQGKSAFFVIGAVWLVCVVVKFFLTPLATYATLTVPLTQIALSLGISPLVIYY
FT                   TMSVATTEILFPYQWALVLIFMGYNLTSGKDFTKIWGTKLIMSFVFILAIAVPYWMLIG
FT                   LI"
FT                   /protein_id="YP_003958091.1"
FT   gene            complement(108428..109810)
FT                   /db_xref="GeneID:9882005"
FT                   /locus_tag="ELI_0104"
FT   CDS_pept        complement(108428..109810)
FT                   /locus_tag="ELI_0104"
FT                   /gene_family="HOG000294981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825735"
FT                   /db_xref="GeneID:9882005"
FT                   /translation="MNEQKLTPAQEKKAERTKLFEDVYSGVIPKRVPIVASMTPEAALE
FT                   YSDIPVGKTIWDLDADSIARALDKVCEMIPSDTPAVGGILKNPAVFKLLGSRGYSMGQT
FT                   GYMQHVDLETLKSDEYDEFIKDPFAFIVTKSLPRIFENLDSHSPRSGMALAEAMKAFYD
FT                   YLAKFDSIKAPIFAKYGYYSPPEGSTTLCQASFDLIGDFLRGIKGIYMDVRQRPEKILE
FT                   ACEAMLPMQVKRGLPPKPHKLGEVFMPLHLGTYLRKKDFEKLYWPSFSKFIHIMAEHGQ
FT                   TASLFCEHDWMRYLDLLQDLPANTRILFEYGDPKIIKEKLGNKHILSGLYPITYIKTAT
FT                   KQQCIDKAKEMIDIMAPGGRYIFDFDKSAMSLDTINMENYAAVIQYVAENTNYANAGTA
FT                   VKASTAEYEKPDTKVPRFESPCFTDWQKIEKNEIETQLKDTVNPILQSYEEMLFRMIFT
FT                   II"
FT                   /protein_id="YP_003958092.1"
FT   gene            109965..110129
FT                   /db_xref="GeneID:9882006"
FT                   /locus_tag="ELI_0105"
FT   CDS_pept        109965..110129
FT                   /locus_tag="ELI_0105"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825736"
FT                   /db_xref="GeneID:9882006"
FT                   /translation="MDWNFSDQSANFLYDKQPEYAFNRERSMLLISIWKTAFAQGENTT
FT                   SMESGFMIL"
FT                   /protein_id="YP_003958093.1"
FT   gene            110489..111964
FT                   /db_xref="GeneID:9882007"
FT                   /locus_tag="ELI_0106"
FT   CDS_pept        110489..111964
FT                   /locus_tag="ELI_0106"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825737"
FT                   /db_xref="GeneID:9882007"
FT                   /translation="MKRDQELSRLNYLMDLFHVKGTDLANYLHVDTSLVSKLKNGKRKL
FT                   NVNSEACGEIANFFILLDKETEYRTVKKLLAETYQETDDLTREALVILLKRWLTSLDEV
FT                   SAGGGSFTDKTVYTAKVKTFQGKNGRRKAAQEFIQSVLLEKTPQEVYVLDWTEHYSWQS
FT                   EDTAFFTEWKKQYLKVAEAGHRITFLISLNHSIDYLINTLLYRLPMLLTGNVEYLYYPD
FT                   YSYMLYKPNIVVLKNKMALAKISSDDITQKDITHMYTDLPTVRHCEEMVLAAKKHCRQS
FT                   HTVIPKNQVPSTFEEFSGQYGNAYIKNDLSFFMNMPKDNFKNILEKNEIPPENIKAFFE
FT                   SFRNYNQKFLKDIKNFEYHLLIDKESLIRGMCDDKTKAKELELYTGQLIYLESGDIRRQ
FT                   VEYLIWLLKNFPNFQIAFFRKNQGNLLDGLDLWIKEHGSVLINKENNEDAFVLMNESSI
FT                   CAAFYNYLEKYWYSIPFVDREKEEVIRQLKNML"
FT                   /protein_id="YP_003958094.1"
FT   gene            112092..112898
FT                   /db_xref="GeneID:9882008"
FT                   /locus_tag="ELI_0107"
FT   CDS_pept        112092..112898
FT                   /locus_tag="ELI_0107"
FT                   /gene_family="HOG000102889" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Methyltransferase type 11"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825738"
FT                   /db_xref="GeneID:9882008"
FT                   /translation="MNKEIIIGDWKMPECDTEASMNMWNARAQEFAKQRGVEDDDWVAA
FT                   LVKRHGMLPADGAFLDVGCGAGKYTVYFAKKCAEAWGTDFSEEMIKNAEQRAREAGTGN
FT                   AFFSCDNWHTLEMADKGWKGKFDFVLANMTPAIQSAETFEKLTEASCGWCLYIHPVLRT
FT                   GSVADRLKKKIFGKKPDPRYPQLQYAFNLLWEKGLFPAVEYREHNWVRSFELERAVDIF
FT                   KNDLRSKRTLTDEEEASIEKYLIEHAINGIVEEEVRTTQFALYWEV"
FT                   /protein_id="YP_003958095.1"
FT   gene            complement(113195..114577)
FT                   /db_xref="GeneID:9882009"
FT                   /locus_tag="ELI_0108"
FT   CDS_pept        complement(113195..114577)
FT                   /locus_tag="ELI_0108"
FT                   /gene_family="HOG000126638" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825739"
FT                   /db_xref="GeneID:9882009"
FT                   /translation="MPDAIRKTNPKTLIMWICVIAAPIIVMLIPTQGVFTPQLRTFSAI
FT                   TLTAILLFAFNILPNFVVAVALPVSYMLLNVAEPNIAFAAWFSNIPWMFMGGFLLANVL
FT                   ERIGLLNRVAFWSIIKTGGTYSGILWGLAIAGIILNLIAPGKAYVPMAALSFGICKALN
FT                   FEKSRESAGIMMGGFFASWFPTFFLYNPTFAIMPSLGKEVAPVQITWLQYFINNIPFVL
FT                   WLAVCIFMVIKLCKPKKQIDIKDYAIQEYSKLGKVSLEEKKSIIVVSLLFIFMFTSDLH
FT                   GIDVGWGFALIPLLFFIPGINVGKPVDISKINFTMAIFTTACLSIGHVANSLGIGQIIA
FT                   NAVLPLLQGKSVFFVIGAVWLVCVVAKIFLTPLATYATLTVPLTQIALSLGISPLVIYY
FT                   TMNLSTTEILFPYQWALVLIFMGYNLTSGKDFTRIWGTKMVLSFVFVLAIAVPYWMLIG
FT                   LI"
FT                   /protein_id="YP_003958096.1"
FT   gene            complement(114595..115980)
FT                   /db_xref="GeneID:9882010"
FT                   /locus_tag="ELI_0109"
FT   CDS_pept        complement(114595..115980)
FT                   /locus_tag="ELI_0109"
FT                   /gene_family="HOG000294981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825740"
FT                   /db_xref="GeneID:9882010"
FT                   /translation="MSDQKMTSAQEKKAERTKLFEDVYSGIIPKRVPIKASMTLEAALE
FT                   YSEIPVGKTLWDLDPENITTAMDRVCEFIPSDTPAVGGILKNPAVFKLLGSKGYSMGQT
FT                   GYMQHTDLETLKADEYDAFIKDPYTFIVTKSLPRIFENLDTDSPRAGMVLAEAMKAFYD
FT                   HQAKFNAIKAPVFKKYGYFTPPAGANTLCQASFDLIGDFLRGVKGIYMDVRQRPEKIIE
FT                   ACEAMLPMQVKRGLPAKTHKLGEVFMPLHLGTYLRKKDFEKIYWPSFSKFIHIMAENGQ
FT                   TASLFCEHDWMRYLDLLQDLPENTRIQFEYGDPKVIKEKLGNKHILSGLYPITLTKTGT
FT                   KQECIDKAKEMIDIMAPGGRFIFNFDKSAMSLDTINIENYAAVIQYVAENTNYQNAGAT
FT                   ARGPENTPYEKPDTTVSSFASPFYTNWKDVPKTEIEASLESTVDPLLQSYEDMLYRMIF
FT                   TII"
FT                   /protein_id="YP_003958097.1"
FT   gene            complement(116143..117540)
FT                   /db_xref="GeneID:9882011"
FT                   /locus_tag="ELI_0110"
FT   CDS_pept        complement(116143..117540)
FT                   /locus_tag="ELI_0110"
FT                   /gene_family="HOG000126638" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative ATP synthase F0"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825741"
FT                   /db_xref="GeneID:9882011"
FT                   /translation="MNTLFTLKKYFTAVNKEKWSWFVTLLVPAIIMLIPENEVFTHEIK
FT                   VFSAITLTAIFIFAFGYIPQLVVGLILPIFYNITNLAPTEVVFSPWTSTVPWMFMGGMI
FT                   LSNILMRTGLLKRIAYMLIEHAGNTYYKLLLSITLSGFIMNFLAPGESYIPMAMLTYGI
FT                   CAALELGKSSTSAGIMLTGFFSSYMPKYFIYSSEINNLQTLGSTVTQTHLTFFQYFYHN
FT                   IPSILWIFILVFVTARLTKPEHKLNAVHHAQNELAQMGPMTKTEKKTALVSALVFLYFL
FT                   TSGLHHLPLAWGFPLVALIFFLPGVKLGRPEDLTSVNFGMIVFIASCLSIGYVANYIGF
FT                   GSLIAGLILPHLSASNITLTLMIIWIICVVTNFALTPLAIWATYTVPFVQAAQSLGINA
FT                   LVVYYQMYQASCQVLFPYEWALPLFYFSFGLIKTKDYTKIFGTVMILNFFYMLLVYIPY
FT                   WRLIGLI"
FT                   /protein_id="YP_003958098.1"
FT   gene            117594..117722
FT                   /db_xref="GeneID:9882012"
FT                   /locus_tag="ELI_0111"
FT   CDS_pept        117594..117722
FT                   /locus_tag="ELI_0111"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825742"
FT                   /db_xref="GeneID:9882012"
FT                   /translation="MILQRILKAVNVQKGIVNFLKLTVCGQNYKGRQKFCGAAEKY"
FT                   /protein_id="YP_003958099.1"
FT   gene            117845..119725
FT                   /db_xref="GeneID:9882013"
FT                   /locus_tag="ELI_0112"
FT   CDS_pept        117845..119725
FT                   /locus_tag="ELI_0112"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825743"
FT                   /db_xref="GeneID:9882013"
FT                   /translation="MRDKRRRSGWLRSGVIVIAAVLVVIGVSFIYVKSVERKVSEETGQ
FT                   YLEEVGIQSAALIRQKFDDDIENLKAAAVVIGATDLALGDDQIMEALRQTDEALDFRDV
FT                   AVVGADGVAYEIKDNAVYTFDVSDKEHFRYAMVGVPVISNPTMPKDNMEESIVMAVPVY
FT                   REGAIIGAVMGRYYLTDLTELLDVNTFDGKGYSYMARRNGEVFVTSNNENADKTLKNLN
FT                   TDFEDSYFEDPFALQTMQVNMLEGKSGSVSYEWNGTRRIMRYLPVGINDWYLLSVVPNE
FT                   VVESRAAGLVMQAAVFCCILFGVFTVLCLYVLGIQKRKNEELRRAHQELETNERRYEIV
FT                   MAQSKDIIFEWDIKTGHIYHSDTFRQKFGFESPSEHFPEAVIEAGGVPESDEAVFLQTY
FT                   RKIAGGEPYAEGEFRVYDSSHYPLWCRSRVSLIVDENGAPSKGIGILMDIDEEIREKEK
FT                   IMEAAEKDFLTQTFNKGAAESRIQLWMKENAGVQRAGLLMIDVDDFKQVNDTFGHISGD
FT                   RVLREVTRKISGIFRESDVVGRIGGDEFVVLMKNIQDTEVVTRKAQEIIRIFESCRVGV
FT                   QKKYCISGSIGIALFPENGTTYKELLGKADQALYFAKAHGKNQFIYFKEN"
FT                   /protein_id="YP_003958100.1"
FT   gene            complement(119766..120662)
FT                   /db_xref="GeneID:9882014"
FT                   /locus_tag="ELI_0113"
FT   CDS_pept        complement(119766..120662)
FT                   /locus_tag="ELI_0113"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825744"
FT                   /db_xref="GeneID:9882014"
FT                   /translation="MSYDTKKMKKRMLATRLILALILTAFFIYFVYQIALEDKGDAPQQ
FT                   ASAEAEDTFVSWMNNSLYSSNNYSIRLYLTGGCPGETLDFSSLEDLPFWSWVNAVAKGN
FT                   GGPLDIAVDRVNKTAAFSSGGEYQFLSVKDGRLLLSLPQEDGSYSTLQTSDPETLRAVD
FT                   GILFLDDPEFFKAYGKTILRPEPSPVNASKPVTLERTVKSEGFCQPFLQNSGRILEGRD
FT                   SIKGNWSYSDYPEKTLAISGNFSYYLDTVNALLHNLPFEDDNHFRWPGSISPEPPQCPI
FT                   QIVYSQINHTGPIEHNF"
FT                   /protein_id="YP_003958101.1"
FT   gene            complement(120830..122257)
FT                   /db_xref="GeneID:9882015"
FT                   /locus_tag="ELI_0114"
FT   CDS_pept        complement(120830..122257)
FT                   /locus_tag="ELI_0114"
FT                   /gene_family="HOG000250777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825745"
FT                   /db_xref="GeneID:9882015"
FT                   /translation="MQITNYQPVLSKTEMELIHEKSLYLLENNGEIIESDEILEICKKA
FT                   GFRVEGQRVYYPRQKVEAALEQAPKDFMLRGRDGRKAFSIREDGTKLAPALGPMNVLED
FT                   GHYRPTTMKDMVDFTVLHETSSLMRTVGANMLRPRDLPLSPLDNAMTRLAITLAYSTKP
FT                   LQTFCEGGEISDKSFEMIKQFYGGVRDEDVYAMICISTASPFRLTQDTCETLLSFCRCN
FT                   QLLWAQGSGMPGLTTPPTLAGTLLQGNAEKLGIITLSQTINPGNPVMYSLISMLSDLRY
FT                   TSCVVATPESPYRMMAEKDMADFYGLPSLGTTGLADAKELDYQCGAEAFMMFYFAYHSS
FT                   PDLVAQSLGVLDSYNTISYEKFIMDEENVQSILKLLSPVAIDEKRMKIDKILKAGPAGN
FT                   YLARTDKAYREDFYRSSLYFKESSAEWMAQGRPSLEAEARKKYLERIAEYEPGDFDRIQ
FT                   QKIIDQYIPKNLQLKNK"
FT                   /protein_id="YP_003958102.1"
FT   gene            complement(122279..123448)
FT                   /db_xref="GeneID:9882016"
FT                   /locus_tag="ELI_0115"
FT   CDS_pept        complement(122279..123448)
FT                   /locus_tag="ELI_0115"
FT                   /gene_family="HOG000166276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825746"
FT                   /db_xref="GeneID:9882016"
FT                   /translation="MLETYYIPVQQAFGFTNEQIGSMMTVFGIVSVILYFPGGYLSDKF
FT                   SVKALITVSYLGTAALGFCMLLIPPLPIMLVIQFGFAVTTIFTFWGAIIKFIRIMGDDS
FT                   EQGKLYGLFFAFSGIFGALEGFAATALYSGLGENITAFKALIIFFALVVAVPTLIFFVI
FT                   FKEKEALPDTGSEESKVNLRDLGKVLKMPIVWIMAIVVLCAYIPKSSQSYFQPYMSEYF
FT                   AVPVAWISVIAIFRQQVVRLVANPLAGWLRDKIGASSIVMRIAFVIGILAFAMVLFTPL
FT                   NPALAWVIVTSLCLVSALYNISVTCSFIPISEAGISAKYTGTISGFVSCVGYSSDIWFY
FT                   KVGGGMIDANGFSGYQQIFILCLVSCVVGIAATFVLKKSVLKTKTSNNQ"
FT                   /protein_id="YP_003958103.1"
FT   gene            complement(123458..123526)
FT                   /db_xref="GeneID:9882017"
FT                   /locus_tag="ELI_0116"
FT   CDS_pept        complement(123458..123526)
FT                   /locus_tag="ELI_0116"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825747"
FT                   /db_xref="GeneID:9882017"
FT                   /translation="MDFKKKRWIIILLVTISYGAVW"
FT                   /protein_id="YP_003958104.1"
FT   gene            123749..125155
FT                   /db_xref="GeneID:9882018"
FT                   /locus_tag="ELI_0117"
FT   CDS_pept        123749..125155
FT                   /locus_tag="ELI_0117"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825748"
FT                   /db_xref="GeneID:9882018"
FT                   /translation="MYKKYKPSKEYLAYLDSLPKSFFVTVLENSYNEHIVYDADGKILY
FT                   VNPACIRHYGLKPEEMINRNNADVYQGYWTPPGLDVFHSKKDTAFLRQYFIPSDSVFYT
FT                   IGVPVLNEAHCIEMIIGTVQEEPVKEWDVDYNKKSRSSKSHFKSEEIPLISVSYQYWKV
FT                   VSELKEVSESSIPIMLLGESGTGKTYMAKYIHENSHKEGLFMTLNCAAIPEALLESELF
FT                   GYAGGAFTGASKAGKVGLIEMANEGTLFLDEIGDMPLSIQAKLLDVIENKRYLPVGSTK
FT                   MKYVNTRIITATNKDIDQLVDKGEFREDLYWRICTFKAIIPPLRERVKDILPLANFFLK
FT                   HFNLSYNKSKRFSKEIINFFQEYPWPGNIRQLKNLIERLVVTGRGNEIAMKNLPDYLLE
FT                   ETKRLPDYQKTGMGLNKRVDAFKKELVQKAYEQYPTIRKLAQALEVSPTTAQRLVEKYC
FT                   KEVSERSSEM"
FT                   /protein_id="YP_003958105.1"
FT   gene            125370..126188
FT                   /db_xref="GeneID:9882019"
FT                   /locus_tag="ELI_0118"
FT   CDS_pept        125370..126188
FT                   /locus_tag="ELI_0118"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825749"
FT                   /db_xref="GeneID:9882019"
FT                   /translation="MFTEIETDVLLEEIAQGDELYESDANRAIDIWYSVFLKIANESKA
FT                   MKSTYLYAGIRDYWKAMEISGWFDDLVSAFFWSGRNREKEREEFCKIMMNDFDTGNIRN
FT                   VFQVNLADLFYLQGKENEANALVENALSDYPVNFFGWQRYAEHYTKKETKKDMNKAYRI
FT                   CERGAAAFLNSRMDASILIENGADIFIAGFAALCESLGKDEEMDYWQRTNKDLKVQCER
FT                   EIRNHRKYEAYNILYKEKEIIETLDERVLSEILDPCAGCRKRGKCKSKSA"
FT                   /protein_id="YP_003958106.1"
FT   gene            126385..127218
FT                   /db_xref="GeneID:9882020"
FT                   /locus_tag="ELI_0119"
FT   CDS_pept        126385..127218
FT                   /locus_tag="ELI_0119"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="preprotein translocase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825750"
FT                   /db_xref="GeneID:9882020"
FT                   /translation="MFTEKETADLMKEMRRGYSFVEKNIDKTIDVWYPIWEKFVEENRK
FT                   TGSRNFLACLDSKANSRACVSFGNWLGDLEMVFLNSGRGKAREREIFCTTMLGEFERSW
FT                   STGDIEQNLAELYYLLGKREEGDALFEKMLEEDPEDVYLWAGYAREYGGRHGDDNERAY
FT                   TIYKRGIDTVLAECAKQPELDLLHYRDIDLLYDEIAEVCTILGKTEEADEWLEKSRAIS
FT                   RSAEDRYTTVTEAPDFSCEPPKQQPIVAPPKVGRNDPCPCGSGKKYKKCCLNKAD"
FT                   /protein_id="YP_003958107.1"
FT   gene            complement(127267..127710)
FT                   /db_xref="GeneID:9882021"
FT                   /locus_tag="ELI_0120"
FT   CDS_pept        complement(127267..127710)
FT                   /locus_tag="ELI_0120"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825751"
FT                   /db_xref="GeneID:9882021"
FT                   /translation="MAFLFAFCGAAGLNPCPADKNTMTEERKMQELDHKAIGLRIRKQR
FT                   TFLNMSRDQLARKIGITPTFLADIELGTKGFSLKSLNYFCSTLKMSSDAILYGPREYMG
FT                   TKYSAILELLERCPKDKGKYAEEILTLFLLSHDPVEEVPRAQK"
FT                   /protein_id="YP_003958108.1"
FT   gene            complement(128143..130869)
FT                   /db_xref="GeneID:9882022"
FT                   /locus_tag="ELI_0121"
FT   CDS_pept        complement(128143..130869)
FT                   /locus_tag="ELI_0121"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825752"
FT                   /db_xref="GeneID:9882022"
FT                   /translation="MKQRVKRRLLACAVILLILAFTAALGMGMTRALTGIRRSDAEQIL
FT                   HFYSEDIQFQLQGRLNEADALAQMALIMDRSSTAWFENAAAPLLSQEQVRYVCLIEGDT
FT                   ITSALPRETFGYQTGQSLRDLSYIFTLSKVVKELVIEGPVVLEGASDDRPVFLFLQPFV
FT                   KDNAYLGEVALALDSEYVLGQLSLQYLSDQGYDYELWRVNPQNGGKDVIAVSGSNIDFS
FT                   NAVKTSFNLPTEWNISIQPTDGWISPANRAVIISSCFAAALLMLGMACAMYQSLTRKWI
FT                   LKKVSTVDIQTGLYNLPGFTAALDGWLSDDSSGPVYLFYFVYESYNQVSQLIGPAEESI
FT                   FLKSIPERLNAFIQSPFIAGRLGDGNFAIAVCEDMSLNQQEDFAKGVTLELLLRTRLNG
FT                   KKLFLTTHYQYRHCSAGRNQAEKEITALVHSYYEHRSSESPAHRLTEKCRQLIAGQNNV
FT                   TFDEYTDLEMMELSKTFNQYRKQVEQLAYFDPVFNVGNRSKYQRDANMLISYDKKRPFS
FT                   LFCVDICAFSQYNQLFSADIGDRILHEVVQRLSRLFGNYLYRINGDVFLGITLSGEDET
FT                   SFATKLQTLLSSPVTAGHATFTLRVRTAVCLYPANGPSPEILLDRIQSAMRYAKESGQK
FT                   IMFYNDELDEIIRSEADIITRLEAAIKEETLEVWYQPIMHLATGSFSTAEVLVRLPDGN
FT                   GGFFSAGQAVALAERSGMVDQLGNYVLSRAGRFINAQGKALGLKNIHVNLSVQQLLVEN
FT                   ISDHLLSIIRASGADNGQITLELTESVLIQSIEHASSTLEALRQAGIQIALDDFGVGYS
FT                   SLNYLFNLPVDVIKIDRSLTQQICTSHKQRALLNSIVEMAEVNALTVVAEGVETLEEQR
FT                   EVAASGVQYIQGYYYARPMCEEALTKFLSQKTRASDN"
FT                   /protein_id="YP_003958109.1"
FT   gene            complement(130877..132430)
FT                   /db_xref="GeneID:9882023"
FT                   /locus_tag="ELI_0122"
FT   CDS_pept        complement(130877..132430)
FT                   /locus_tag="ELI_0122"
FT                   /gene_family="HOG000122743" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825753"
FT                   /db_xref="GeneID:9882023"
FT                   /translation="MNKNNQKSKDGNWQISFSPIFRYVAVFCLLIFATIMLGGAVLSFS
FT                   QMKSNAQVLLSNVHAQTSQRIDESITLLESLASLPEFYDPNVPPIEKVKKLDQMSPYFD
FT                   YLMICYVDSNITVYSDGSEPASLASRDYMQRLFSTGQRQVTDSFAAGADGVTLNYTVAV
FT                   PLLDAQNNITGCLFCAIYFDEVVDILKQSAATSGYEATLIGSQGQIMSSTAGLPYGEPL
FT                   MKELQNARVIGTTPDKLQEQLLAAEPGDYWSLQNGSLVYTAYQRVEDTGWDLLCSVDFR
FT                   TAFLGILPSLLLVAALAALLCLGLSFLLRRYIAGQMHSVDLLVESVEKLEKKLYQDERP
FT                   ENVDFNEIIRLTSDGLSDALTGLVTRSVFLNQAETQLQKINPEYTSALCFVDMDNLKSI
FT                   NDTYGHYGGDVALKNVGYIFREYEKKYDGLVSRYGGDEFVMLLINLDDEAELRSVLEEL
FT                   VLRLHSEIGSAGQQINVQCSVGVSLCQPGMKLEKMIADADEALYFVKQNGKGYYKIHQN
FT                   "
FT                   /protein_id="YP_003958110.1"
FT   gene            132389..132514
FT                   /db_xref="GeneID:9882024"
FT                   /locus_tag="ELI_0123"
FT   CDS_pept        132389..132514
FT                   /locus_tag="ELI_0123"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825754"
FT                   /db_xref="GeneID:9882024"
FT                   /translation="MPVSVLAFLIIFIHGELAFLSGAIIYRPKYKLFFIKDQYFL"
FT                   /protein_id="YP_003958111.1"
FT   gene            complement(132695..133627)
FT                   /db_xref="GeneID:9882025"
FT                   /locus_tag="ELI_0124"
FT   CDS_pept        complement(132695..133627)
FT                   /locus_tag="ELI_0124"
FT                   /gene_family="HOG000115049" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Homoserine O-succinyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825755"
FT                   /db_xref="GeneID:9882025"
FT                   /translation="MPIKIPGDLPAFQILENENIFVMDQDRATTQDIRPLKIAIMNLMP
FT                   TKIVTETQLLRLVGNTPIQVDVTLLQSDTHDCKNTDQAHLDTFYKTFSDVRYEYFDGLI
FT                   ITGAPIETLPFEEVDYWDELVDIMDWSLTHVYSTLHICWGAQAALYHHYGVPKHNLDHK
FT                   LFGVFEHHLEEKYIPLFRGFDDIFYVPHSRHSEVRREDIEKVPELSMMAMSDDAGVYIV
FT                   TAREGRQIFITGHSEYDWDTLKKEYDRDVSQGKPINVPNNYYPGDDPSKKPVVRWRGHS
FT                   NLLFFNWLNYYVYQATPYDLDNNPDFDHH"
FT                   /protein_id="YP_003958112.1"
FT   gene            complement(133706..134632)
FT                   /db_xref="GeneID:9882026"
FT                   /locus_tag="ELI_0125"
FT   CDS_pept        complement(133706..134632)
FT                   /locus_tag="ELI_0125"
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine synthase A"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825756"
FT                   /db_xref="GeneID:9882026"
FT                   /translation="MKVYEELTELIGGTPLLKLNHLMEKEALEANLFGKLEFFNPGGSV
FT                   KDRIALSMILDAEEKGLLAPGGTIIEPTSGNTGIGLALVATLRGYHLILTMPETMSIER
FT                   RSLLKAFGAEIVLTDGDMAMQGSIDKARELNQKIPNSIILEQFENPANPIAHEKTTAVE
FT                   ILDDLDGSVDIFVAGVGTGGTLGGVGKGLKEKNPDVQIIAVEPWSSQVLKGEPAGFHAI
FT                   QGIGANFVPAVLDLDIIDEIIPVKDEDAYAYARVLTKTEGLLVGISSGAAVWAAIELAR
FT                   RPENAKKNIVVLMPDTGERYLSTPLFN"
FT                   /protein_id="YP_003958113.1"
FT   gene            complement(134654..135940)
FT                   /db_xref="GeneID:9882027"
FT                   /locus_tag="ELI_0126"
FT   CDS_pept        complement(134654..135940)
FT                   /locus_tag="ELI_0126"
FT                   /gene_family="HOG000246417" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825757"
FT                   /db_xref="GeneID:9882027"
FT                   /translation="MDKNLKFETLQLHAGQTPDPATHSVAVPIYQTTSYAFDSTEHAEN
FT                   LFGLKENGNIYTRIMNPTSDVLEKRMAALEGGVGALAVASGSAAITLTIMTIAQAGDEI
FT                   VAASTLYGGTFNLLDATLPKFGIRTTFVDPDDPANFEAAVNENTKAIYIESLGNPSINI
FT                   VDVEAVAKIAHDHKIPLIIDNTFATPYLFRALDFGADIVVYSATKFIGGHGTTIGGVIV
FT                   DGGTFDWAGSGKFPEFTEPDESYHGIVYTRDAGEAAFITKARVQMLRDTGACISPFNSF
FT                   LLLQGLETLSLRLGRHVENTRRVIDFLSGHPAVTWVNYPDQTDSKYHALAKKYFPRGTG
FT                   SIFTFGIKGGIEAARRFIDHIQIFTHLANVADAKSLVIHPATTTHQQLSGDALLAAGIT
FT                   EDMIRVSIGLENAGDLIGALDDALQLSQK"
FT                   /protein_id="YP_003958114.1"
FT   gene            136169..137431
FT                   /db_xref="GeneID:9882028"
FT                   /locus_tag="ELI_0127"
FT   CDS_pept        136169..137431
FT                   /locus_tag="ELI_0127"
FT                   /gene_family="HOG000082148" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825758"
FT                   /db_xref="GeneID:9882028"
FT                   /translation="MINTQGRLARVATVPESGKWKAATARQHTLYQKEGDIRTPFGRDF
FT                   TRILHSTAYRRLKHKTQVFFSPGNDHISTRIEHVNYVESVASTICEYMGLNVELARAIA
FT                   IGHDLGHPPFGHHGEKVLNDIVRDEKLWSGQNGQYYWHEKNGLHFVDNIELLEGPDRKK
FT                   YNLDLTYGVRDGIISHCGEVSEAALYPREEAIDLSTFKRVNQFSPFTWEGCVVKLADKI
FT                   SYLGRDIEDAQTLDILSDGQLEILDGIVAEYFEKQGQSRGNVNNTTVIHLLILDLGKNS
FT                   SVANGLRFSDEGFEVLKNIQDFNVKNIYHHERLNGYKDYGELIIHRVYDALKELYNRGE
FT                   IAEKLPYFQKQFPLLTTNFMNWISDYWNQTDRRTEGCPLQNQIIYHIPEEPLDFYRAII
FT                   DYISGMTDQFIEKIYQELIRF"
FT                   /protein_id="YP_003958115.1"
FT   gene            137447..137578
FT                   /db_xref="GeneID:9882029"
FT                   /locus_tag="ELI_0128"
FT   CDS_pept        137447..137578
FT                   /locus_tag="ELI_0128"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825759"
FT                   /db_xref="GeneID:9882029"
FT                   /translation="MYFYKNALTTRGNRSIMKNNLKNSVKEKRHEGFKNELKCILLL"
FT                   /protein_id="YP_003958116.1"
FT   gene            137535..137657
FT                   /db_xref="GeneID:9882030"
FT                   /locus_tag="ELI_0129"
FT   CDS_pept        137535..137657
FT                   /locus_tag="ELI_0129"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825760"
FT                   /db_xref="GeneID:9882030"
FT                   /translation="MKDLRMSLNAYFYFSQGYYYGAGYFACMKLSSPESRFAVS"
FT                   /protein_id="YP_003958117.1"
FT   gene            137800..138810
FT                   /db_xref="GeneID:9882031"
FT                   /locus_tag="ELI_0130"
FT   CDS_pept        137800..138810
FT                   /locus_tag="ELI_0130"
FT                   /gene_family="HOG000023020" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825761"
FT                   /db_xref="GeneID:9882031"
FT                   /translation="MIVVVKPGTPEEEVQKLAAAIENQGLKIHYSQGVDHTILGLIGET
FT                   QTIDVHKLRSNHIVEKVMRVQEPYKKANRAFHPDDSIIDVQGNLIGEGHVSVIAGPCSV
FT                   ESEEQIIEIARAVKASGAKFLRGGAFKPRTSPYSFQGMGADGLELLLLAKKETGLPIVT
FT                   ELMDMSQLPLFDEVDVIQVGARNMQNFTMLKELGKIDKPILLKRGLSATMREFLMSAEY
FT                   IMAGGNEQVILCERGIRTFENATRNTLDLSCIPLLKKKSHLPVVIDPSHATGINWMVES
FT                   MSKAAIAAGADGVMIEVHNKPEEALCDGDQAITPDEFNKIMTTLKKYAEFEGKVL"
FT                   /protein_id="YP_003958118.1"
FT   gene            138812..139714
FT                   /db_xref="GeneID:9882032"
FT                   /locus_tag="ELI_0131"
FT   CDS_pept        138812..139714
FT                   /locus_tag="ELI_0131"
FT                   /gene_family="HOG000043493" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prephenate dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825762"
FT                   /db_xref="GeneID:9882032"
FT                   /translation="METLKGKTVSFIGLGLMGGALAMGIRKQGPDKICAFDINEEVLED
FT                   ALRKEVIDWGVSEPEGIRQILGVSDLVVICLYPQLALDFILEYMEDFKENAVITDITGV
FT                   KKLLVDQLRGVLREDLDLILGHPMAGSEKEGFGNADDAIFKDRNYILVPQPENKPENLA
FT                   FIKEIIRNLGFVNIVETTAEVHDQKIAFTSQLCHVIASALVDSEEDLHITDYEGGSFGD
FT                   LTRIAMINAGMWTELFICNKEALVDQIEKFEKSMDTMKKMIQAEDSDGLTEILSNVRKK
FT                   RITMEVDRQNKTSARTQKA"
FT                   /protein_id="YP_003958119.1"
FT   gene            140111..140881
FT                   /db_xref="GeneID:9882033"
FT                   /locus_tag="ELI_0132"
FT   CDS_pept        140111..140881
FT                   /locus_tag="ELI_0132"
FT                   /gene_family="HOG000201526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TatD family hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825763"
FT                   /db_xref="GeneID:9882033"
FT                   /translation="MLADSHAHLDDERFENEVDTIIENAREAGIGFILNPGTEESTSVR
FT                   AIELSQTYDIVYAGVGFHPSDCASFDKNKHPKMIRKWCEQDKVLAIGEIGLDYYYDDGA
FT                   PRDLQKKVFEEQIGLANELKKPIIVHDRDAHGDCLDMVKSCLDPNVGGVFHSYSGSVEM
FT                   AKILLDFGLYLSIGGPLTFKNSRKAPDVVKYMPLDRLLIETDSPYLTPVPYRGRRNEPA
FT                   YVRFVAEKVAEIKEIPVEEVQETTFENCQRLFGV"
FT                   /protein_id="YP_003958120.1"
FT   gene            141100..141792
FT                   /db_xref="GeneID:9882034"
FT                   /locus_tag="ELI_0133"
FT   CDS_pept        141100..141792
FT                   /locus_tag="ELI_0133"
FT                   /gene_family="HOG000059314" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825764"
FT                   /db_xref="GeneID:9882034"
FT                   /translation="MQVYEGRLKVFLLKDISINSVQEKISALIDKALVQNEKMAAFHQK
FT                   ISYKNYCFSGFCPVESERVYRQDKIYTIQIRTIDENLMNYFKEHLINAYTEEMKSLTMA
FT                   VRRIKKIPISRIYTLTPVIQKFDGGYWKEIVTLDEFERRLKENLIKKYNNFTGEKCDED
FT                   FDLYTHLQFDNKGPISCPYKGITLLGDKITLQLAQNPMAQELAYMALGCGLGENNARGN
FT                   GFCGYRYL"
FT                   /protein_id="YP_003958121.1"
FT   gene            141807..143546
FT                   /db_xref="GeneID:9882035"
FT                   /locus_tag="ELI_0134"
FT   CDS_pept        141807..143546
FT                   /locus_tag="ELI_0134"
FT                   /gene_family="HOG000059303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825765"
FT                   /db_xref="GeneID:9882035"
FT                   /translation="MLKECLDVFKKIYEEKGESLILDTYVPAEGSYVLVDRDGAIKEIK
FT                   ELPKQKEPPEDFESFIEKDYLSALIDMNKPIDKKKVIHSNNYYAFWVKKDSIRPDKNGK
FT                   VKLTQEIIDDYYGLLKAPENKYRKKGLELYEVVEAEIGKPDLEMIERHKDWIKNNIFSI
FT                   VQDNHLKDDKSYLKIYFDANKEAYQRENRRYVIPNVYNTTDYNVPVEDKIFGLPNDNMG
FT                   LNAKKPYLENKTRKNTMPYLISTEEVAVQKKFFDYLYNQACLGKSNIYLNEKDGIIALS
FT                   NNESLKQSFKGYYLRIQKGKELEIHDFDEITGFEAEIEPIELKQYIPVPEKNATDLVYE
FT                   KVKKLEDVKILINSVFLKKFLITNFFTDAKDIRLNDTKVKEELLRCRTGYFNWFFKGES
FT                   VAVRSFFAESSLVLIKNSILNRHIPKAIEQFNVRESILNYFEGGERMEQTYEEIFERLS
FT                   EMINSDTRSTIEDDAMYYYAAGQIAQFLLSLNQSSKPTPALVNPVINARTAQQLQVVLE
FT                   RLYKKYNYAIKYPQRISRLYSMFLLHMPENKKTDSQMLIAGYLDRSLVYEKKNKNEGEA
FT                   ENE"
FT                   /protein_id="YP_003958122.1"
FT   gene            143539..144474
FT                   /db_xref="GeneID:9882036"
FT                   /locus_tag="ELI_0135"
FT   CDS_pept        143539..144474
FT                   /locus_tag="ELI_0135"
FT                   /gene_family="HOG000059292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825766"
FT                   /db_xref="GeneID:9882036"
FT                   /translation="MNKRVYGVLGIKSIMANWNADFSGMPKAISTGEVFGSDKAFKYPM
FT                   KKMWDEQGEKVLYIKSFKAEEDKKEGIKVRPRSLKERYEQIFEVEDLKKTNDNKAVLTN
FT                   LFKAIDVKNFGATFAEGGNNTSITGAVQITQGFNQYDGHNVEEQQILSPFRDGTKEDAE
FT                   QSTLGTKIVSNEAHYFYGFAINPTAYKDFMEMGVTEGYTEDDYEKFKEAALMAATAFNT
FT                   NAKVGCENEFGLFVETEADLYLPDLAQFIRFKKTEDNEKGVISLGLDELLNAFGDRILS
FT                   IEIYYNPLTTILEGSLDKAKAYHIFTKEAL"
FT                   /protein_id="YP_003958123.1"
FT   gene            144476..145216
FT                   /db_xref="GeneID:9882037"
FT                   /locus_tag="ELI_0136"
FT   CDS_pept        144476..145216
FT                   /locus_tag="ELI_0136"
FT                   /gene_family="HOG000059281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825767"
FT                   /db_xref="GeneID:9882037"
FT                   /translation="MKALRFLLRGKTAFFKQPDVNTYCYYTYGCIHKIALLGIFGAVMG
FT                   FRGYNGQTKAETYPEFYEKLKSLKVSICPLNEKGYIPKKVQTFNNSVGYASKEEGGNLI
FT                   VKEQWLENPKWEIAFLVDDPQSENLAERILESRFEFLPYLGKNDHTAVIENVEEVELEA
FT                   ETKRENLRVYGLFPANQGSLSENSVRRPLGREVPYKYQERLPVALEPACNQYVTQAMID
FT                   TNQRVSLTDAASVFRLEERHYVFF"
FT                   /protein_id="YP_003958124.1"
FT   gene            145203..147788
FT                   /db_xref="GeneID:9882038"
FT                   /locus_tag="ELI_0137"
FT   CDS_pept        145203..147788
FT                   /locus_tag="ELI_0137"
FT                   /gene_family="HOG000059270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825768"
FT                   /db_xref="GeneID:9882038"
FT                   /translation="MSFSKKVDSYFEKTPVFDFAGLIETDKPFYAHIKDEKKAENLQEH
FT                   LDLTLDYFGLLCREKHLESVFRCLEKNFFPDCARETVSLWREMILNILYLHDIGKINPN
FT                   FQRGKMQNKAFSRTESNNQNHSAFSARVYFDYYYQKIDAVEDDRQYDLFFVFLLLNTFV
FT                   IQKHHGSLTEFSVFLERFENDLSETREELEAYRNLTTFDTAAGLGLFFEERLNIIHKNN
FT                   PWKCVDFYIYTRFLYAILVACDFYATSEYMNGAPVDDFGVLDDVTPYLDAFNADPVTQN
FT                   IRKIKKDQAPDGDINILRSRLFLEAEENLLHSQEDNVVFLEAPCGSGKTKTSINLALQL
FT                   IKKDQQLNRILYVFPFNTLVEQTRDSLEECFGKALGEKMGVINSITPIKKYGETTDEGE
FT                   WDYTRQDKIDYEKSLLARQFMHYPIVLTTHVKFFEGIFGTGREAVFPLAHLANSVIILD
FT                   EIQSYKNQIWKEIIIFLKAYARILNFKVIIMSATLPDLNRLSVGDEKVTYLVKNREFYF
FT                   QNPLFKDRVELDFSMLELEPEETFDALLKKVLEVSNALRKNPDAENKIVVEFIKKASAV
FT                   DFYNRLKDVVENDRVSIELMTGDDHKAERKRIISQVRTAENIILVATQVIEAGVDIDMD
FT                   IGFKDTSILDAEEQFLGRINRSCRKKGAVVYFFNLDSPDMIYQKDIRKADNLRLTGANK
FT                   AMQEILINKEFSKFYACVLEGLEAQSRKENDLNLEVFRDRHLWTFNFPEIQERMRLIDD
FT                   NRRKVSLFLNTEVISEDGEVLVGSQVWKSYGALLQDAAMPYAEKRVRLSEVQAKMDYFI
FT                   YEVDKSFADACVLCQDELLGELYYFKDGERFFENGKFSREKLKRENDFL"
FT                   /protein_id="YP_003958125.1"
FT   gene            147799..148293
FT                   /db_xref="GeneID:9882039"
FT                   /locus_tag="ELI_0138"
FT   CDS_pept        147799..148293
FT                   /locus_tag="ELI_0138"
FT                   /gene_family="HOG000059268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825769"
FT                   /db_xref="GeneID:9882039"
FT                   /translation="MKVNGTLVNYYFHCKRQCWLHGNRINLESNSEDVKIGKALHEIRA
FT                   EESESTEISIENIRLDKITKDYLVEVKKSDADYEAVKWQVLFYLKVLKDKGIERRGKIE
FT                   FIEKKKAERKIYYEDLTQEREKELEEIIRAIETLLETPFPPERETGKKCRQCAYFDYCV
FT                   L"
FT                   /protein_id="YP_003958126.1"
FT   gene            148305..149303
FT                   /db_xref="GeneID:9882040"
FT                   /locus_tag="ELI_0139"
FT   CDS_pept        148305..149303
FT                   /locus_tag="ELI_0139"
FT                   /gene_family="HOG000059257" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825770"
FT                   /db_xref="GeneID:9882040"
FT                   /translation="MGTTKYLTSMGELSRKDNSLCFRVGSRNKYIPVEQVSEIYCMSEI
FT                   SLNTKLLDFLAKNEIIVHFFNYYGGYSGTFYPKEHLVSGKLLIAQVKAFENRRLGIAKA
FT                   IVGGIGKNIDELLYHYYKHDKKDVKPTIDWIRHDLPDRLGKAEDVKQVLQAEGEIWQRF
FT                   YSSFQYFLPEDFIMNKRVKRPPDNPINALVSFGNSLLYSKTVSVIYQTHLDQRISFLHE
FT                   PSEGRFSLSLDLCEVFKPAIVFKTIFDVVNNRKLQVDKHFEKKLNYCILNEEGRKIFIS
FT                   AFEARLDSVFEHPKLKRKTSYRTALKLDCYKLIKDILEEKPFIPFNMGEKL"
FT                   /protein_id="YP_003958127.1"
FT   gene            149300..149590
FT                   /db_xref="GeneID:9882041"
FT                   /locus_tag="ELI_0140"
FT   CDS_pept        149300..149590
FT                   /locus_tag="ELI_0140"
FT                   /gene_family="HOG000226098" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825771"
FT                   /db_xref="GeneID:9882041"
FT                   /translation="MSTDKNFNYNYAFVFYDINEKRVAKIFKICKKYLVHYQKSVFRGD
FT                   ITPSKLIALKNELKKIIVEDEDFVCIVKLLNGNVFGEEVMGISESSEDLFL"
FT                   /protein_id="YP_003958128.1"
FT   gene            complement(151593..151832)
FT                   /db_xref="GeneID:9882042"
FT                   /locus_tag="ELI_0141"
FT   CDS_pept        complement(151593..151832)
FT                   /locus_tag="ELI_0141"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825772"
FT                   /db_xref="GeneID:9882042"
FT                   /translation="MLIFNEVLLVVNPVDYHLNTSHVNLQPNLIFWDSDTFTYLNTSHV
FT                   NLQQQVLLESNAATPNLNTSHVNLQPPVPLRCQA"
FT                   /protein_id="YP_003958129.1"
FT   gene            complement(152758..152880)
FT                   /db_xref="GeneID:9882043"
FT                   /locus_tag="ELI_0142"
FT   CDS_pept        complement(152758..152880)
FT                   /locus_tag="ELI_0142"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825773"
FT                   /db_xref="GeneID:9882043"
FT                   /translation="MLIFNGDQPRKNSEKKEYLNTSHVNLQLSQLFPFYNSSNI"
FT                   /protein_id="YP_003958130.1"
FT   gene            complement(153636..155282)
FT                   /db_xref="GeneID:9882044"
FT                   /locus_tag="ELI_0143"
FT   CDS_pept        complement(153636..155282)
FT                   /locus_tag="ELI_0143"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825774"
FT                   /db_xref="GeneID:9882044"
FT                   /translation="MDKRNPESREVEELLEKKKDLFSLFSAFEDRIDHKISHLTDSTEI
FT                   PVESIKQKIVESTGHHLADPVEDLFEQAVLKSQQKTHESGIIGFHTEEILGVEEALAEL
FT                   KKAEPANSFEEEPAAEPAEVIEMPEDPVILTQTDPIPMPNPEISEAEPSGTDTQTPADI
FT                   WVETEISELDLSVENQDNADGPPEGRIARHDGEPMELPLGVDEPDLAEIDELLQEAEEL
FT                   MEDIPYSRYMAARAAVDKEVLDDNPLETSGDEEADFEAYDEESFEEYDPDDSDAFETDS
FT                   DEYGALFEEDDFDENDAFDDEDSFLEEHSKEATLFEENGPEDFPEGEDFEEEDFLAEDD
FT                   AIFQEAANDTTSEEASDHPFADFFEDTVETVKEDLFDELPLDKAPEEEYSDNNLDDVTY
FT                   ENVDAVSLGAFKYSAVSLRLILFVIAMLGMGVFTALSSGRFIAMDYLILFVLCIFVALT
FT                   MDMSFNATLIVTVVIMLGCFGGLIYTFFTGGEVSMFHMFWFVIIPACLLTASGLVQKIK
FT                   EVILANQLLNEELDSLYAEQEDTLFENSEEE"
FT                   /protein_id="YP_003958131.1"
FT   gene            155728..156519
FT                   /db_xref="GeneID:9882045"
FT                   /locus_tag="ELI_0144"
FT   CDS_pept        155728..156519
FT                   /locus_tag="ELI_0144"
FT                   /gene_family="HOG000194826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Predicted O-methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825775"
FT                   /db_xref="GeneID:9882045"
FT                   /translation="MDNFIKENERLEDLGIKGLKIIQNPDYFCFGIDAVLLSWFASGAV
FT                   RKKSRVIDLGTGTGIIPLLLYGRTGAQKIQALEIQENMVEMAGRSIACNGLEEKIEIIH
FT                   GDIRNPGEQVRPTSYDVVVSNPPYMKVGHGLKNPMETKAIARHEILCGIEDIAIFAKRM
FT                   LKDRGKLFLIHRADRLADIMSAMRDHRVEPKRLQFIHPYADKPANLVLVEGMKAGKPYL
FT                   ITEAPIVVYEKDGRYTQMINDIYGTSAPYDRIIKNKTAPEL"
FT                   /protein_id="YP_003958132.1"
FT   gene            complement(156537..157508)
FT                   /db_xref="GeneID:9882046"
FT                   /locus_tag="ELI_0145"
FT   CDS_pept        complement(156537..157508)
FT                   /locus_tag="ELI_0145"
FT                   /gene_family="HOG000054734" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825776"
FT                   /db_xref="GeneID:9882046"
FT                   /translation="MNERTKKVYDAFEQKQFRNKLELKRKQEALYASIPKLAELDHAIN
FT                   LQGIRMTREVSRKNPEAIAEFRQSVGALKKQKEALLLQNGYPLDYLTLRYDCPICKDTG
FT                   YVDGQVCSCLKQELIRAAFNNYDLNVHAQAENFDTFNPGYYANEAAEAQNGSPREKMCR
FT                   LKEKMQHYCLHFESQNDNYLFTGKPGVGKTFMSNCVANALIGQGYNVIYITAAHLVQDI
FT                   QSKIFNDNIPINEIYSPLFTADLLIIDDFGAEFYSDFSKKQLFEVINTRLQEHKKIILS
FT                   TNLTMPQILENYDERLTSRIRGNFLNIVFAGDDIRLIKKRMG"
FT                   /protein_id="YP_003958133.1"
FT   gene            complement(157501..158520)
FT                   /db_xref="GeneID:9882047"
FT                   /locus_tag="ELI_0146"
FT   CDS_pept        complement(157501..158520)
FT                   /locus_tag="ELI_0146"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA replication protein DnaD"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825777"
FT                   /db_xref="GeneID:9882047"
FT                   /translation="MNQFKFIIDNDNMAMTPVENIFINHYMPRARGDYVKVYLFGLKHC
FT                   FNHSLEPIDNLALSKLFDLTEGDVIKAWEYWEKEGILSLEYVGTKDIIVTYYNISARLM
FT                   SHHTKTEAETKKAETPQKQDPDSMEARVAHMYSKIQQMYGSRTITQKETQMFKNWITEY
FT                   HFTPETVILLVEYSMNLIGKKEKPFTAKQIINYLKSVAEGWYRAGIREAAEADAYIRKS
FT                   AGEQKLVYDVFKYLGLRRAPIAWEKEMIIRWADDYHFDMDIITAAMQRSSKQDIRYIDA
FT                   ILKRWSQKGYTSLEEINAEPKKGYHQSKGDVVISEDRKKVYEELDQLDEAWLWSDDNE"
FT                   /protein_id="YP_003958134.1"
FT   gene            158711..159988
FT                   /db_xref="GeneID:9882048"
FT                   /locus_tag="ELI_0147"
FT   CDS_pept        158711..159988
FT                   /locus_tag="ELI_0147"
FT                   /gene_family="HOG000075602" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825778"
FT                   /db_xref="GeneID:9882048"
FT                   /translation="MDTFIIEGGHPLNGEVAISGAKNAVLGIIPAAILCSCSSKIDNVP
FT                   DIKDVNKIVAILEKMGAEIYRENDTLIINTDKPINYDCSEYEEETGKMRASYYLLGALL
FT                   GRYHKAIVPLPGGCNIGDRPIDQHIKGFEALGAKVLIEHGQVKMTADRLIGADIYLDVV
FT                   SVGATINIMLAATRAEGMTIIENAAKEPHIVDVANFLNLMGANIKGAGTDTIKIKGVDE
FT                   MHGCEYSVVPDQITAGTYMMAAAATCGNVLVKNVIPKHMEAVTAKMREMGVEIIEEDNG
FT                   IRVIGKENIKGCKVKTLPYPGFPTDLQQPMAVLMSIASGQSVITESIFENRFKYVDELR
FT                   KMGAEIAINGRVANITGVPTLSGTKIKATDLRAGAAMVIAGLIAEGETRITDIQYIDRG
FT                   YEKLESNIRSLGGIIRREAIEKKVED"
FT                   /protein_id="YP_003958135.1"
FT   gene            159991..160866
FT                   /db_xref="GeneID:9882049"
FT                   /locus_tag="ELI_0148"
FT   CDS_pept        159991..160866
FT                   /locus_tag="ELI_0148"
FT                   /gene_family="HOG000166277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825779"
FT                   /db_xref="GeneID:9882049"
FT                   /translation="MKTRKRRRIRFKPRFYVWVAALAAVLMTAFFFIATHPAKKLEKNS
FT                   QTALQAVETLQTALSNAAEKGTSALKTEESKEQEAIKERIRNGDTDGLKVVFMTFDDGP
FT                   SEHTNEVLDILKKYHIKATFFTNGRDNEVARAAYKRIVDEGHTLGNHSWSHKYDLYKNP
FT                   PAFYEDVAKLDAFQLEVTGKGEISHMFRFPGGSLNANATCIQGILDRGYNYVDWNSSAG
FT                   DGGGNPASTDAVVNKIMSEVHQHNVSTVLCHAELRDTTRAALPQLFETLKAEGYTFLPM
FT                   ESDLSYPRQV"
FT                   /protein_id="YP_003958136.1"
FT   gene            161050..161838
FT                   /db_xref="GeneID:9882050"
FT                   /locus_tag="ELI_0149"
FT   CDS_pept        161050..161838
FT                   /locus_tag="ELI_0149"
FT                   /gene_family="HOG000223520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825780"
FT                   /db_xref="GeneID:9882050"
FT                   /translation="MKFCSLYSGSSGNSLFVSHSKTKLLIDAGLSGKRIEQALCAVDEL
FT                   PAQLGGILVTHEHRDHIHGVGVLSRRYDLPVYANFATWESMRDSLGKIAEHNVRVFETG
FT                   QAFVIGDLQIEAFNTSHDAVESVGFTIDSGCSSVGIATDTGVITPRIMEALKGRDLVVL
FT                   ESNHDPAMLEAGRYPFPLKQRIKGNHGHLSNEICGETVCTLVKEGLDKVVLAHLSEENN
FT                   YPLLAYQTTARILETEGIQPGEDLSLVVAGRKNSSEIYEL"
FT                   /protein_id="YP_003958137.1"
FT   gene            161877..162989
FT                   /db_xref="GeneID:9882051"
FT                   /locus_tag="ELI_0150"
FT   CDS_pept        161877..162989
FT                   /locus_tag="ELI_0150"
FT                   /gene_family="HOG000223641" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825781"
FT                   /db_xref="GeneID:9882051"
FT                   /translation="MYENNERPKRESHVSAAIAGGVVGGIIVAIILVAVLYFTGTLGGG
FT                   TRTETVAGQKVIVNDVNVDSQVEAVAQVVPESVAGIETTMTENTMMGTQEAVGVGSGFI
FT                   VTSDGYIVTNQHVISDNPKEIKVSLADGNNYTAQKVWADSSLDMAIIKIDAKNLPAVTL
FT                   GDSDNLKVGEVAIAIGNPLGLQFERSVTAGIISALNRSLVVDSSLVAEDLIQTDATINK
FT                   GNSGGPLVNANGEVIGINTYKNAQGEGMGFAIPINVVKPILNQVVTSGSFTPTVIGISG
FT                   YDKQQAAYYNDAEPIDKGIYVASVQAGGGAANAGIQKGDILLTIDGKDVNTMLKMKEIL
FT                   YGHKPGDTVKITYERGGQTKEADVTLQAGN"
FT                   /protein_id="YP_003958138.1"
FT   gene            complement(163023..163172)
FT                   /db_xref="GeneID:9882052"
FT                   /locus_tag="ELI_0151"
FT   CDS_pept        complement(163023..163172)
FT                   /locus_tag="ELI_0151"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825782"
FT                   /db_xref="GeneID:9882052"
FT                   /translation="MINVNGYKRKFHVFFYPPGQMPSFSGIFQCQLLALALPVNFLYLK
FT                   EPPH"
FT                   /protein_id="YP_003958139.1"
FT   gene            163137..163499
FT                   /db_xref="GeneID:9882053"
FT                   /locus_tag="ELI_0152"
FT   CDS_pept        163137..163499
FT                   /locus_tag="ELI_0152"
FT                   /gene_family="HOG000232011" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lactoylglutathione lyase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825783"
FT                   /db_xref="GeneID:9882053"
FT                   /translation="MKFSFVTIHVNHLEESIRFYEEILGLKVLRRFKAGPEKEIAFMGG
FT                   EGAELELIGDARDSEVNVNEKISLGFEIASVEECMETLQKKGVPVLSGPFQPNPKTRFF
FT                   FIQDPDGVMLELIEQN"
FT                   /protein_id="YP_003958140.1"
FT   gene            163575..163832
FT                   /db_xref="GeneID:9882054"
FT                   /locus_tag="ELI_0153"
FT   CDS_pept        163575..163832
FT                   /locus_tag="ELI_0153"
FT                   /gene_family="HOG000236029" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825784"
FT                   /db_xref="GeneID:9882054"
FT                   /translation="MEKFCQSCGMPISEEVCGTNADGSANDDYCQYCYEKGAFTAPDMS
FT                   MEEMIEICVGPMVENNAEMTEEQARGMMKEFFPALKRWRV"
FT                   /protein_id="YP_003958141.1"
FT   gene            163958..164401
FT                   /db_xref="GeneID:9882055"
FT                   /locus_tag="ELI_0154"
FT   CDS_pept        163958..164401
FT                   /locus_tag="ELI_0154"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825785"
FT                   /db_xref="GeneID:9882055"
FT                   /translation="MELPTQDEILKLISIIQRKTQMYLNKQTSELGLTSGQAPFIMITC
FT                   ENEGIPQNRFVELLDMNKSTVTKMVAKLEENGYLTREANACDSRSFDVYPTEKAYEVLP
FT                   ELQRIGTGWVDEITAGMTEIERAIFFDLLRRSAERAGRYFDDH"
FT                   /protein_id="YP_003958142.1"
FT   gene            complement(164434..165231)
FT                   /db_xref="GeneID:9882056"
FT                   /locus_tag="ELI_0155"
FT   CDS_pept        complement(164434..165231)
FT                   /locus_tag="ELI_0155"
FT                   /gene_family="HOG000052780" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825786"
FT                   /db_xref="GeneID:9882056"
FT                   /translation="MNIIAVDDEALALGYMLKILKEAAPGSRFKGFEDPFAALDYLREN
FT                   PVDIAFLDIEMYGLNGIELAKRFKEAAPSVKIIFSTGFPDYALDAFSVHASGYLLKPPT
FT                   VEAVKSEIDNLGLPPAVSQKRVRVQTFGNFEVFVDNAPLRFGRAKAKELFAYLVDRKGS
FT                   GSTTAELISVLWEDRDLSHSLQSQFQTVAADMIKTFKAVNAGDILIKKRNYLSVDTEKL
FT                   DCDYYNFLKGDIRAINSYAGEYMRNYSWAEFTTGFLSQKAGIL"
FT                   /protein_id="YP_003958143.1"
FT   gene            complement(165228..166760)
FT                   /db_xref="GeneID:9882057"
FT                   /locus_tag="ELI_0156"
FT   CDS_pept        complement(165228..166760)
FT                   /locus_tag="ELI_0156"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal transduction histidine kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825787"
FT                   /db_xref="GeneID:9882057"
FT                   /translation="MSNIRVQLYKNGTEIYSFGQPGAYPSFSKSPGNQWDVLLAPGGVA
FT                   ASDTITIRLENIYPSNNEQAFNLFLENLFMGDSGVLFRDLVTTSGSSLLLGGFILLMGL
FT                   VLLAAVIILKIIRTPLSWAPFHLSLFTIASGLWIFLDFHIISLLVTTNVFTNILDILSL
FT                   SLIMPFLGLYLLDFVKSRARYAISGCVYAGLAFTLFFLLVQSLGIWDGYELLTPLTLLD
FT                   AAAVIIILFSLIYENAHNPQRDTRFILFSCGICFIGFGDIVNYYLGFLPFNLFFKLGFT
FT                   LFILAQLSYMVRYTRNTLAAARKTQALEKELVQNRIAIMLSQIQPHFLFNALTAIKQLC
FT                   AIDPEKAEEAVGQFAGFLRGNLDSLSHTGAIPFEKELTHIENYLSLEKMRFGKRLSIAY
FT                   DIGVSDFSLPPLTVQPLVENAVRYGVTKKPSGGMVTLSTQETEDSVILTISDDGVGFDP
FT                   SVKKEDGRSHIGIDNVRSRLENQCGGRLTVTTVLGSGTTATIILPKKGGSTE"
FT                   /protein_id="YP_003958144.1"
FT   gene            complement(166786..167037)
FT                   /db_xref="GeneID:9882058"
FT                   /locus_tag="ELI_0157"
FT   CDS_pept        complement(166786..167037)
FT                   /locus_tag="ELI_0157"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825788"
FT                   /db_xref="GeneID:9882058"
FT                   /translation="MKSNIVLKILALVIALFSVTLLAYTIAEEHRTDELNTVLDPLTFT
FT                   GTWQASDGAAPQPLTADTKIDSDQNPSVILTGHFSQNI"
FT                   /protein_id="YP_003958145.1"
FT   gene            complement(167129..168322)
FT                   /db_xref="GeneID:9882059"
FT                   /locus_tag="ELI_0158"
FT   CDS_pept        complement(167129..168322)
FT                   /locus_tag="ELI_0158"
FT                   /gene_family="HOG000277074" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825789"
FT                   /db_xref="GeneID:9882059"
FT                   /translation="MTRATGTVSRGVRAPIIREGDDLAGIVVDSVLEASQSEGFDLNDR
FT                   DVVGITEAVVARAQGNYASVDAIAEDVKAKFPDGEFGVIFPIMSRNRFAICLRGIARGA
FT                   KKLTIMMSYPSDEVGNHLVDLDQLDEKGVNPWTDVLDEARYRDLFGSNPHTFTGVDYVS
FT                   YYRTLCEEENAEVRFVFANDCRSILPYEKHVLTCDIHTRERSKRLLKAAGALTVLGLDD
FT                   LLTKPVDGSGYNADYGLLGSNKATEEKVKLFPKECEHFVHEVQARLHQATGKSIEVMVF
FT                   GDGAFKDPVGKIWELADPVVSPAYTDGLNGTPNEVKLKYLADNNFADLSGDALKSAISE
FT                   YIANKPKESLVGKMETQGTTPRRLTDLLGSLCDLTTGSGDKGTPIVLIQGYFDNYAD"
FT                   /protein_id="YP_003958146.1"
FT   gene            complement(168474..169352)
FT                   /db_xref="GeneID:9882060"
FT                   /locus_tag="ELI_0159"
FT   CDS_pept        complement(168474..169352)
FT                   /locus_tag="ELI_0159"
FT                   /gene_family="HOG000103590" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825790"
FT                   /db_xref="GeneID:9882060"
FT                   /translation="MFRIKDSDAMLHNLIDQSAAAFFDQYRFVTPADYCVYNCKNACLE
FT                   AEDIPCYAIWQRDTPCHNCSSIRALSLKEPVIKLEYLENKVFLILSTPHTLDGRRCVLE
FT                   LAKDVTASLMINDDRHCDNTIITDVIAELNNLSVRDLYTGLYNKNYAEREVSRCINEKK
FT                   SFTAAMMDIDDFKIINDTYGHQTGDVVLREMASLLTDAAANGKGWAARIGGDEFILIFP
FT                   SLSLEQAEPVLSALSRDIKEHLFYKGDSRFSVNASMGIKEYHPGEMNAADFFDQVDMRM
FT                   YAEKRRNKSGR"
FT                   /protein_id="YP_003958147.1"
FT   gene            169504..170106
FT                   /db_xref="GeneID:9882061"
FT                   /locus_tag="ELI_0160"
FT   CDS_pept        169504..170106
FT                   /locus_tag="ELI_0160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825791"
FT                   /db_xref="GeneID:9882061"
FT                   /translation="MVAGIPAFRDRINKKLIIQEEKMEPKGKALLKGAGIVFLIWGILI
FT                   TIFGVVLFSTAAMLQQLGDSHEIQQIATEGGLTMEGLVHTVNMMSVSLIVNGVCIVILG
FT                   ILGIIFCKSIGKARFLRFLSILVIVFSAVNLGMSILYGLTAMIPHMVSIVLGIAYFIGA
FT                   DRNVKTIDLSVEEVDAEDADTLAEEVQEQETEEVKEK"
FT                   /protein_id="YP_003958148.1"
FT   gene            170108..170224
FT                   /db_xref="GeneID:9882062"
FT                   /locus_tag="ELI_0161"
FT   CDS_pept        170108..170224
FT                   /locus_tag="ELI_0161"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825792"
FT                   /db_xref="GeneID:9882062"
FT                   /translation="MIIPLRADAALRWDFFDFKKVYYFYKIKNVNIFSEEYP"
FT                   /protein_id="YP_003958149.1"
FT   gene            170385..171335
FT                   /db_xref="GeneID:9882063"
FT                   /locus_tag="ELI_0162"
FT   CDS_pept        170385..171335
FT                   /locus_tag="ELI_0162"
FT                   /gene_family="HOG000243107" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825793"
FT                   /db_xref="GeneID:9882063"
FT                   /translation="MKKVIDDERLMVKICDMYYNQDLNQKVISAQLGLSRPTVSRIISN
FT                   GKERGIVKIIIDNLEGTDYVELEREIENLYGLREVIVVDTKKDIEDQKNEIGRAAAQYL
FT                   ERVVKDGNIVGVSMGTTLGYIARHVVGNATKNITFVPLIGGMGHLRMELHSNYIVEDLA
FT                   KVFGGEFMLMHAPARVSGKQIKEELLKEDGISKIIRMGDKLDVALVGIGVPNSTSAIMA
FT                   TGYYDRVEMNKMREKHVAGDICMQFYDINGSTTPFKIDNNVVGIEIKKLRRVPHSIGVA
FT                   CGIEKVDAIKGAINGKYINTLVTDVESARKLIEEE"
FT                   /protein_id="YP_003958150.1"
FT   gene            171394..172575
FT                   /db_xref="GeneID:9882064"
FT                   /locus_tag="ELI_0163"
FT   CDS_pept        171394..172575
FT                   /locus_tag="ELI_0163"
FT                   /gene_family="HOG000269695" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825794"
FT                   /db_xref="GeneID:9882064"
FT                   /translation="MNEILNLAINEMANTEFDCSCGRHHNFSIHDIAIGKGAIKELPRV
FT                   AEPFKEGKILIVYDDNTYKAAGREAKQLLDDAGFNVKELLFDRGGELLIPDESVVGRIL
FT                   EEQELDVSLMVAVGSGSLNDSVKYVSSRTKVPYIIVCTAPSMDGYVADGAPLICNGYKY
FT                   SYPACLAYGVVGDTDIMKEAPMELIHAGFGDVVGKITALADWDLSVKVNDEYRCETCVE
FT                   LVQRALDKCFGQAEALKERNDEATLYLIEALTLTGVAMGLVNISRPASGAEHMLSHYWE
FT                   MDYIARGLTPIHHGTQVGVATPVIAMFFEEMADLLPEGTGALCPPHKEIEALLRKAGCP
FT                   VTPKDIGIDRDLFHRSLIEGYKVRPRYSVMEFAKAHGRLEEIADKITNTIYGE"
FT                   /protein_id="YP_003958151.1"
FT   gene            172578..173372
FT                   /db_xref="GeneID:9882065"
FT                   /locus_tag="ELI_0164"
FT   CDS_pept        172578..173372
FT                   /locus_tag="ELI_0164"
FT                   /gene_family="HOG000068103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825795"
FT                   /db_xref="GeneID:9882065"
FT                   /translation="MRFEKDQALNDVKLFVLDMDGTVYLGNNLIEGSLDFIHKVKETGR
FT                   SFIFFTNNASRVPSFYKEKLAKMGLEVEESDVVTAGDVTAEFLKTYYPGKRVYLNGTPL
FT                   LENSFKEKGINLVDDEPDVAVQSFDTTLTYEKLDKICRFVRNGVPFVATHMDTNCPTED
FT                   GFMPDCGAMCDLITSSTGVKPRFLGKPFKETVDMVLEITGFKRDEVAFVGDRIYTDVAT
FT                   GVKNGAKGFLVLTGEADMQTVAESEVEPDCIYDSLYEMSKYL"
FT                   /protein_id="YP_003958152.1"
FT   gene            173587..174156
FT                   /db_xref="GeneID:9882066"
FT                   /locus_tag="ELI_0165"
FT   CDS_pept        173587..174156
FT                   /locus_tag="ELI_0165"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825796"
FT                   /db_xref="GeneID:9882066"
FT                   /translation="MNDGLKYFIFLAFAMMVLQSFLSYLQYKSYQKAVSALQGRGWILG
FT                   IGMRKGGFHIKGGAIIVLAWDRGTNQVMACKRLQGIAMWKRFEDVDDYNGMTLNEVRKI
FT                   GIEEDLAINPRLREKEPYSPLLVDKRRKKGALIQAIEAIDRRLAKEMEKEEQKKVVQDD
FT                   GLERQELQARLRARQREIRKEQSGKG"
FT                   /protein_id="YP_003958153.1"
FT   gene            174305..174877
FT                   /db_xref="GeneID:9882067"
FT                   /locus_tag="ELI_0166"
FT   CDS_pept        174305..174877
FT                   /locus_tag="ELI_0166"
FT                   /gene_family="HOG000242767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825797"
FT                   /db_xref="GeneID:9882067"
FT                   /translation="MEALQTFGQGFMGLFQNGANYFIQLYVLQLLPWVIIMITFMHILF
FT                   KLIGLERIEKLVKLCNKFFLTRWILSPVIAMVFSGNPMTYPYARFLPENQKVAFFDPGI
FT                   SFCHPVTGLFPHANPGELFVWLGIASGVYVQGLQFGIGIESLGGLAVEYFLLGMVMVLL
FT                   RSIFTQVIYNAKYKAKYGHAQGSETEA"
FT                   /protein_id="YP_003958154.1"
FT   gene            174881..175849
FT                   /db_xref="GeneID:9882068"
FT                   /locus_tag="ELI_0167"
FT   CDS_pept        174881..175849
FT                   /locus_tag="ELI_0167"
FT                   /gene_family="HOG000242653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825798"
FT                   /db_xref="GeneID:9882068"
FT                   /translation="MYNAVRIEKGHGGWGGPLVIQPTEKKNKIVSITGGGIDPLTRKIA
FT                   KLTGAEAIDGFSNGVPDDEMACVIINCGGTLRCGVYPKKGVMTVNITPVGQSGPLAEFI
FT                   KEDIYVSGVVESGITPADGSEVPVEEDTAEEEVVEEAAPAADAPKENWVARGGKALAGF
FT                   ATKCVQGGKEAIDITIKDILPFMAFYSLLIGLIEFSGLGALMGQYVYPYLGTLPGLLIL
FT                   VIICALPMISPLVGSGALIGQVLSVLVGYGIMIGAFPVVLALPALFAVDAQVGCDFIPV
FT                   GLSMGDAASDTVDIGVPSVLLSRLFTGPIMVLIAYFVATML"
FT                   /protein_id="YP_003958155.1"
FT   gene            175874..176233
FT                   /db_xref="GeneID:9882069"
FT                   /locus_tag="ELI_0168"
FT   CDS_pept        175874..176233
FT                   /locus_tag="ELI_0168"
FT                   /gene_family="HOG000242539" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825799"
FT                   /db_xref="GeneID:9882069"
FT                   /translation="MGYKSTVTEIGPMVQDFIGEKMIIVFNDNAPAALREMAVLHSIEE
FT                   MEKDIAVNDIIAIGGQEFVVTAVGSEANETFRTMGHCTFCFNGGDTAKIPGHIELLGEG
FT                   MPEITVGCTIEIIHT"
FT                   /protein_id="YP_003958156.1"
FT   gene            176252..176527
FT                   /db_xref="GeneID:9882070"
FT                   /locus_tag="ELI_0169"
FT   CDS_pept        176252..176527
FT                   /locus_tag="ELI_0169"
FT                   /gene_family="HOG000278399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825800"
FT                   /db_xref="GeneID:9882070"
FT                   /translation="MYSKETVIINKTGLHARPASDFTKKASGFKSAINVKNLDEDKEGN
FT                   AKSIIAVMAMCLSKGTRVAVSAEGDDEQQAVDTLIELIDSGFGEEE"
FT                   /protein_id="YP_003958157.1"
FT   gene            176682..177890
FT                   /db_xref="GeneID:9882071"
FT                   /locus_tag="ELI_0170"
FT   CDS_pept        176682..177890
FT                   /locus_tag="ELI_0170"
FT                   /gene_family="HOG000223060" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminotransferase class I and II"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825801"
FT                   /db_xref="GeneID:9882071"
FT                   /translation="MQISKRVMGMGEPALLKYYPLVDKAEAEGKKVYYLNIGQPDICTP
FT                   PSFMKKVNEMKENVLAYAAPEGENALREEACKYYRKYGLTYHKGDMLITNGGSEALLFT
FT                   FLTICNPGDQILTPEPLYSIYKEMASATSIDLRGIKTYAEEGFALPDRETIEAAITPAT
FT                   RAILITNPGNPTGKVFSREEIERVRDIALAHDLYVIADEVYREFIYDGLAYVSPGHYPE
FT                   LDQNCIIIDSISKRYSACGARIGFILSKNYAFMNQIKKLCQMRLAVSSVDQLGAAELFK
FT                   LDTSFFDDVLKEYTHRRDIVYDCLKTIDGVVCKKPTGAFYYVAKLPTKNACDFIEWMIT
FT                   DFDYEGKTVLLSPANDFYIHPEDGADEVRIAYVLKDTDMADAVETLKQGLNTYKEKFPE
FT                   RCK"
FT                   /protein_id="YP_003958158.1"
FT   gene            177900..178844
FT                   /db_xref="GeneID:9882072"
FT                   /locus_tag="ELI_0171"
FT   CDS_pept        177900..178844
FT                   /locus_tag="ELI_0171"
FT                   /gene_family="HOG000010260" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825802"
FT                   /db_xref="GeneID:9882072"
FT                   /translation="MEIKNLQKGQPFLGYLFIKSQVTKTAANGSRYFNMKLTDTNFDEI
FT                   DGKMWDVKEADEEEFVTGKLVKIKGAVQEYNGHLQLIANRMRLANEGDDVSIDDFVECA
FT                   PKNVNEMIGEINTTIDAFANEDIKKLTKAIFEDKTKVLSYFPAAKSNHHALKGGLLYHT
FT                   YSMLQIGKSLTPLYPFLNADLLYSGIILHDIGKITEMESDENGSVSDYTEEGKLLGHIV
FT                   TEIVEIDQYGQKLGVSEEVLLLLKHMILSHHYEAEYGSPKKPMFPEAELLHHIDIIDAR
FT                   MNTMEKVQNSLEPGAFSEKIWGLDGIQLYRSKL"
FT                   /protein_id="YP_003958159.1"
FT   gene            complement(178826..179083)
FT                   /db_xref="GeneID:9882073"
FT                   /locus_tag="ELI_0172"
FT   CDS_pept        complement(178826..179083)
FT                   /locus_tag="ELI_0172"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825803"
FT                   /db_xref="GeneID:9882073"
FT                   /translation="MFCQALFKIYFLNFSSAGLKALRCCTLRDSLLSIPRTLPFVKRFL
FT                   TFILIFFDFILTWIFKKTDARRHLLFSTLYRVSVDYNLLR"
FT                   /protein_id="YP_003958160.1"
FT   gene            179417..180928
FT                   /db_xref="GeneID:9882074"
FT                   /locus_tag="ELI_0173"
FT   rRNA            179417..180928
FT                   /db_xref="GeneID:9882074"
FT                   /locus_tag="ELI_0173"
FT                   /product="16S ribosomal RNA"
FT   gene            181146..184007
FT                   /db_xref="GeneID:9882075"
FT                   /locus_tag="ELI_0174"
FT   rRNA            181146..184007
FT                   /db_xref="GeneID:9882075"
FT                   /locus_tag="ELI_0174"
FT                   /product="23S ribosomal RNA"
FT   gene            184085..184200
FT                   /db_xref="GeneID:9882076"
FT                   /locus_tag="ELI_0175"
FT   rRNA            184085..184200
FT                   /db_xref="GeneID:9882076"
FT                   /locus_tag="ELI_0175"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(184435..185523)
FT                   /db_xref="GeneID:9882077"
FT                   /locus_tag="ELI_0176"
FT   CDS_pept        complement(184435..185523)
FT                   /locus_tag="ELI_0176"
FT                   /gene_family="HOG000028743" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825804"
FT                   /db_xref="GeneID:9882077"
FT                   /translation="MTKNILNFHKETARIFATNLLQWFYKSKRALPFRETKKPYNIWIS
FT                   EIMAQQTQIDTLIPYYHRFVEAFPDVTALAEAPEDKVLKLWEGLGYYSRAKNLHKAAKI
FT                   IHEEYNGIFPDHYDALIKLPGIGPYTGGAIASIAFKEKVPAIDGNVLRVISRFNNYNGD
FT                   IANVKVKNAITDWVAQALPDTPGDFNEGLMELGALVCTPTNPKCMICPEQNICEAFREG
FT                   TMNQLPVKSKKKRQKKLEMEVGIVDMGGALYLVKRPDKGLLSGLWSFPIIEKEKTKPGN
FT                   AIRQALETIFPNLPEGKNIGNSKHVFSHIIWNMTVYYFEINSVMAAEAPEKYGDTQAAF
FT                   KDREQLAALALPTAFSKLLVLL"
FT                   /protein_id="YP_003958161.1"
FT   gene            185665..186777
FT                   /db_xref="GeneID:9882078"
FT                   /locus_tag="ELI_0177"
FT   CDS_pept        185665..186777
FT                   /locus_tag="ELI_0177"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825805"
FT                   /db_xref="GeneID:9882078"
FT                   /translation="MNKLTLVKRFLKRYKKETAIISGLFVLVVIIGVTCAFNATKDVKL
FT                   VLDENKATAADAVKTEVINAQLQKSVEEVLQDQGYPVSEEYTISVDPDKKVKDVDTVTV
FT                   KKNAVGQIKVDGKTVDYKSAAETVGDLLSDNNVQYDDDDIVTPAPSTALTTDVSNVTIT
FT                   RIEVKEEAGERDIPFESEEKENAELEEGTRNVVTQGVVGKADFVDKVTYQDGVEVKREN
FT                   ISSNIKVEPVKEVVEVGTKKAVPESLASSPSPSAGNATQTAGSDFDLICAIVAHEGGTS
FT                   YEGAMGVISCVMNRVDAGWGPDAVSVLTAPGQFASYLDGYYTQYLGNAPAAVQQAVTDC
FT                   MEGGIRSHNFTSFRSYQTSGSVCIAGNWYF"
FT                   /protein_id="YP_003958162.1"
FT   gene            186914..187975
FT                   /db_xref="GeneID:9882079"
FT                   /locus_tag="ELI_0178"
FT   CDS_pept        186914..187975
FT                   /locus_tag="ELI_0178"
FT                   /gene_family="HOG000276704" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825806"
FT                   /db_xref="GeneID:9882079"
FT                   /translation="MEITITKRTQLKPKPDENNLVFGTEFTDHMFIMDYTEGKGWHDAR
FT                   IVPYGPIELSPAAMVLHYAQEVFEGMKAYKTPEGDIQFFRPMENFARMNRSNVRMCIPQ
FT                   IDEEFVFDALKQLVALDQDWVPHAPGTSLYIRPFVFATDPFIGVRTSHHYKFIIILSPV
FT                   GAYYATGLQPAKMHVEDIYSRTVVGGTGEAKCGGNYAGGLAAQEKAHDEGFEQILWLDG
FT                   AERRYIEEVGTSNIFFKVDGKFITPELHGTILPGITRKSVIELLRSWGEEVIERRITID
FT                   EFVDMYHKGQVEEVFGTGTAAVVSPIGGLEYQGEDMSFNNGEIGEYTQRIYDTLFGMQT
FT                   GTVEDKLGWTVKL"
FT                   /protein_id="YP_003958163.1"
FT   gene            188068..188156
FT                   /db_xref="GeneID:9882080"
FT                   /locus_tag="ELI_0179"
FT   tRNA            188068..188156
FT                   /db_xref="GeneID:9882080"
FT                   /locus_tag="ELI_0179"
FT                   /product="tRNA-Ser"
FT   gene            188215..188306
FT                   /db_xref="GeneID:9882081"
FT                   /locus_tag="ELI_0180"
FT   tRNA            188215..188306
FT                   /db_xref="GeneID:9882081"
FT                   /locus_tag="ELI_0180"
FT                   /product="tRNA-Ser"
FT   gene            complement(188376..188549)
FT                   /db_xref="GeneID:9882082"
FT                   /locus_tag="ELI_0181"
FT   CDS_pept        complement(188376..188549)
FT                   /locus_tag="ELI_0181"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825807"
FT                   /db_xref="GeneID:9882082"
FT                   /translation="MILNQKTTDFVPYIIPFIIIIVNIADIFLTAADIPLTEISHFLPF
FT                   SAMFFRNFFFLI"
FT                   /protein_id="YP_003958164.1"
FT   gene            188427..188624
FT                   /db_xref="GeneID:9882083"
FT                   /locus_tag="ELI_0182"
FT   CDS_pept        188427..188624
FT                   /locus_tag="ELI_0182"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825808"
FT                   /db_xref="GeneID:9882083"
FT                   /translation="MTDFCQWNVSSGQENVSNIHNNYNERNDIRYKIRCFLIQNHGRVL
FT                   EFLYSINYKDYRIVKKQINF"
FT                   /protein_id="YP_003958165.1"
FT   gene            188671..189663
FT                   /db_xref="GeneID:9882084"
FT                   /locus_tag="ELI_0183"
FT   CDS_pept        188671..189663
FT                   /locus_tag="ELI_0183"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc finger CHC2-family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825809"
FT                   /db_xref="GeneID:9882084"
FT                   /translation="MKKKFTDDQIDYVNTINIIDYMEHRGLDLKRTNRRVKVKGWNGLD
FT                   VTPDGRKWKDFASGQGGYVIQFVAWLNTCSWKEAVQELLDFSHHVPPVQLSATWPEPPP
FT                   PKPFCLPPKAKSYRNLFAYLLKTRKLDPKIIQYCVDQKLIYQDERCNCVFVGYDDSGEP
FT                   ASAFLRGSNEYAPFKMLVEGSRAEYGFTLPGANSRLFIFESPIDLLSYMTLKNIHNPLY
FT                   FDNRGDHYLSCNGLKYLPILHYLSTHYEISQIVFGVDNDPVNEYGNRPGQDFIKSATQE
FT                   IMEAFPDRFTTSKQFITDLPGQKDWNQELVTFRKNQEYKKSNRARQPCR"
FT                   /protein_id="YP_003958166.1"
FT   gene            189654..189773
FT                   /db_xref="GeneID:9882085"
FT                   /locus_tag="ELI_0184"
FT   CDS_pept        189654..189773
FT                   /locus_tag="ELI_0184"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825810"
FT                   /db_xref="GeneID:9882085"
FT                   /translation="MPLKAADQSQLKAAFSLLKTENKRHMAVEIDIFKKEVQT"
FT                   /protein_id="YP_003958167.1"
FT   gene            189804..191816
FT                   /db_xref="GeneID:9882086"
FT                   /locus_tag="ELI_0185"
FT   CDS_pept        189804..191816
FT                   /locus_tag="ELI_0185"
FT                   /gene_family="HOG000166278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825811"
FT                   /db_xref="GeneID:9882086"
FT                   /translation="MIHRFKQAVVLLMALLMLFYGCGFRTEVSANTETENPSPAIEQPS
FT                   QTDAAPTRADQDTKKKSPELDAGEQAILDANGITATEDTGKIDASGNYILGETSTGGTV
FT                   SCSTSLRTLASRSFGDEPCYKKFQRAAGWDDGVIYSSDFASPDGSDIITTTTPILRISD
FT                   NGVDQIAYCADPSLNIPSEVVGPNGLVTYNRESWNVQSWRIRNVMWHGFHDGQNGEYYV
FT                   QTWAAIRVIAGIGAYTDYYMTDPTVANLVNTLSYQNPNNWDASWSIVPEREEAVWNANT
FT                   KRQETGWFQTYCSNIADHGNYTVALPNGVHAIARNTSGQTYGDYTGSMTLYDDDDFMLY
FT                   ADGSYQGEVSVTITPTTVKRHSSDAGNPDACVIYAPDVPDTQRLFVSLAVGQSPLSSSF
FT                   RANFTGATGDAQLQKTDKRTKEKLAGATFGLYDTKDNLLKQGVTDENGQWNVTDLVFGD
FT                   YYFKEIAAPKGYELDQTKLHFTIDGIRDMVTVSKTNEPKKVPFNFKKLDTETQQPLKGV
FT                   TFVLYGCDEKHTHNNQQDDKIKSCWQTIIGTRISGTDGKIDFGNLYAGEYQLVETKTVP
FT                   GYAKPMGQWRVTIDPEAAETVKITAKGTAPAFVKDGSVLKVDNQKNYKLPFTGGDGDHR
FT                   VALMLAGIVLLIAAGILALVLKKRNSRNSKGKRKG"
FT                   /protein_id="YP_003958168.1"
FT   gene            191822..193336
FT                   /db_xref="GeneID:9882087"
FT                   /locus_tag="ELI_0186"
FT   CDS_pept        191822..193336
FT                   /locus_tag="ELI_0186"
FT                   /gene_family="HOG000166279" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative surface protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825812"
FT                   /db_xref="GeneID:9882087"
FT                   /translation="MNLKNKPLFKKIGGLALSIAVLCTSCGPAFAATGSPDTSAARSLT
FT                   IHKYRMEDIKKATTEGSGQQTDQVPADAIPLPGIQFKVTKMQDTDNTKVDTTWNIQIIT
FT                   TGADGSVTIQGNDNLPMGVYRIEEQTNPAVAEKADPCLVSIPLTNPAGDGWIYNVHVFP
FT                   KNQIKPGPDIDKFVTELENKHDTADISERVKWIVETTLPDDIATCKNYTVSDVIDTRLD
FT                   YVTGSVKVYRVDTGKKRVLMTPDCYTVTEPNTANNRTLTVSLTDTGKKTAAKSLLNTKD
FT                   KNAVLNIEYNTFVNKTAEGSLGKPIPNGATIHYTNNLDIFFEPQSVPEDKKPEVHTGGI
FT                   NLLKVDADDNTLKLQGAKFKIYRTEADAKKNINAVKDPANNAIDWEVTTDANGIAHFWG
FT                   LAYGQKGQDAYYGDSTNYWIVETQAPIDNEGKPYNLLKYPVKVTVNSNSHAEANKIIVE
FT                   NIKHYDLPYTGGTGSLTPLYMGAALILMASGMSILFIRNKRNTGNK"
FT                   /protein_id="YP_003958169.1"
FT   gene            193356..194171
FT                   /db_xref="GeneID:9882088"
FT                   /locus_tag="ELI_0187"
FT   CDS_pept        193356..194171
FT                   /locus_tag="ELI_0187"
FT                   /gene_family="HOG000099306" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825813"
FT                   /db_xref="GeneID:9882088"
FT                   /translation="MRNKAMLLLIIVLISAGAGCILYPDMVYLLASQKQGQVIEDYQVS
FT                   TEEMNQQRMDEEYQKAINYNEKLINPIIGDPFSEDAQDNAMDYAEILNVDGVMGTLEIP
FT                   KIKVNLPIYHGTSESALSRGAGHLKNTALPVGGTGTHAVLTGHRGYEGARLFTDLDQLV
FT                   IGDRFYLHVLDKTLTYEVDQILVVTPEQTEALKPVEKQDFVTLLTCTPYQINSHRLLVR
FT                   GKRIKELPAEAEPETMEEPTPVKELLFSFVSLVGIASGIWHLKRRKKRE"
FT                   /protein_id="YP_003958170.1"
FT   gene            194164..194478
FT                   /db_xref="GeneID:9882089"
FT                   /locus_tag="ELI_0188"
FT   CDS_pept        194164..194478
FT                   /locus_tag="ELI_0188"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825814"
FT                   /db_xref="GeneID:9882089"
FT                   /translation="MNEWDLGAVLTLTGMMTFGLILLWGIRKREKKCRSYPPWLAVQIV
FT                   SILSLLICVPVYLMFNNGYSGVRILSASLSLAIVIIGLGRAVSRLKRHYFHWKDRKGVI
FT                   "
FT                   /protein_id="YP_003958171.1"
FT   gene            194564..195202
FT                   /db_xref="GeneID:9882090"
FT                   /locus_tag="ELI_0189"
FT   CDS_pept        194564..195202
FT                   /locus_tag="ELI_0189"
FT                   /gene_family="HOG000120077" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825815"
FT                   /db_xref="GeneID:9882090"
FT                   /translation="MQLDWNFCLSVVTVVIAIIALLQTKQQIKLSNKQHLFDERIENYG
FT                   IAIGLIQLYEKNRDFFDENEDDKAMLSISYWFELMTNNTYLEQIASVIKNPLKQPDHKE
FT                   FLVKLEMLSSVATKIELLFNKKEATLLSEFVFCYQKSLMIMYQYQILLDDMKKAAQDHQ
FT                   WTFEECQQKMGEDQQRDQVHTILNALKKAYTMLEQENVNEKIKKQIKLK"
FT                   /protein_id="YP_003958172.1"
FT   gene            195316..195420
FT                   /db_xref="GeneID:9882091"
FT                   /locus_tag="ELI_0190"
FT   CDS_pept        195316..195420
FT                   /locus_tag="ELI_0190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825816"
FT                   /db_xref="GeneID:9882091"
FT                   /translation="MIRYSIVAKQKVKLLHDYYYVDVKDEDKKDFIKS"
FT                   /protein_id="YP_003958173.1"
FT   gene            195711..196538
FT                   /db_xref="GeneID:9882092"
FT                   /locus_tag="ELI_0191"
FT   CDS_pept        195711..196538
FT                   /locus_tag="ELI_0191"
FT                   /gene_family="HOG000019422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825817"
FT                   /db_xref="GeneID:9882092"
FT                   /translation="MAKTKVITISNQKGGVGKTNVTVNLGVGLANEGKKVLLVDSDPQG
FT                   DLTTSLGWYDHYALDATLTTMMQGMVADQPIDPKAVILHHPENVDLIPADLDLAGMEMS
FT                   LLVAMNRESVLRMCLQDIKKDYDYILIDTMPSLGILSINAMAAADSIIIPVQAQYLALN
FT                   GMTQLIQSINKVKRQINPNLKVEGALITMADINTNMTKEVAEALHEQYGKQLYIFRNAI
FT                   PRATKAAETSAAAKSIYTYDKGTKICEAYKALTREVITHGSKQKDKHAASQCR"
FT                   /protein_id="YP_003958174.1"
FT   gene            196492..197418
FT                   /db_xref="GeneID:9882093"
FT                   /locus_tag="ELI_0192"
FT   CDS_pept        196492..197418
FT                   /locus_tag="ELI_0192"
FT                   /gene_family="HOG000295178" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825818"
FT                   /db_xref="GeneID:9882093"
FT                   /translation="MAANKKINMPLPSADDLFKTDAERQNDGLEKVMEIPIEEISSFPD
FT                   HPFKLQMDEAMSEMVESIREYGVLSPALVRPKEGGGYEMVSGHRRKMASEIAEKTTIPC
FT                   IVRNLTDDEATILMVDSNLQRENILPSEKAYAYKMKLEALKHQGKKMDETSRPVVGKSE
FT                   SAEIVGKESGDSGRQIQRYIRLTELDSPILDMVDEGRIAFRPAVELSYLKPAEQKQLLE
FT                   VMESEECTPSLTQSTKLKQFSKEGKLTNNVILSIMKEVKPNQKETIKIQKEKISKYFRK
FT                   GTTDKKIEDTIIKALELYQKRQKQMER"
FT                   /protein_id="YP_003958175.1"
FT   gene            197473..198054
FT                   /db_xref="GeneID:9882094"
FT                   /locus_tag="ELI_0193"
FT   CDS_pept        197473..198054
FT                   /locus_tag="ELI_0193"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825819"
FT                   /db_xref="GeneID:9882094"
FT                   /translation="MLETDWMYKDYQITQAIDIHRRMVIFGECRSDDKPTAFLCGYYEP
FT                   LLLKDAYSEMQTGDYLEMMELFLQRVQGQIDKVRAEQQEMDVPLDVITREMCVSYQENT
FT                   GIRGQMVAIDPMRFRPEDRIGPKQIGYVIADQTPSKNSMVFRRLYDGREMCCFYGDILG
FT                   VIKSEYQPDWAKEVVCQFEKNEKNRKGETR"
FT                   /protein_id="YP_003958176.1"
FT   gene            198054..198320
FT                   /db_xref="GeneID:9882095"
FT                   /locus_tag="ELI_0194"
FT   CDS_pept        198054..198320
FT                   /locus_tag="ELI_0194"
FT                   /gene_family="HOG000284679" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical membrane associated protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825820"
FT                   /db_xref="GeneID:9882095"
FT                   /translation="MEKQENKGYQITDSIQVGNTAFVIGHSEKLPYPYVVWKKTEAQGY
FT                   NYGHYKNHHQEAVEDLCRRALKELKVQRNKEMWKMRKEQSENE"
FT                   /protein_id="YP_003958177.1"
FT   gene            198313..198600
FT                   /db_xref="GeneID:9882096"
FT                   /locus_tag="ELI_0195"
FT   CDS_pept        198313..198600
FT                   /locus_tag="ELI_0195"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825821"
FT                   /db_xref="GeneID:9882096"
FT                   /translation="MNKLPEQCYNTLRSTGELVTIRKNEKGYFPSELSTPDMLTNRAIA
FT                   ERANRKAGITKAQTAAMVGGSLFGWSSPAANPDNYDANGNFVRGCFKDEP"
FT                   /protein_id="YP_003958178.1"
FT   gene            198612..198878
FT                   /db_xref="GeneID:9882097"
FT                   /locus_tag="ELI_0196"
FT   CDS_pept        198612..198878
FT                   /locus_tag="ELI_0196"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825822"
FT                   /db_xref="GeneID:9882097"
FT                   /translation="MAKNTKGFRALTRLIEAGYNTEKAIAGMTMTEMLALPGVSVSELV
FT                   QFDELQKSVKAGKVVTYLGTTEQKEKKKEEGAKAHDSTNDTVY"
FT                   /protein_id="YP_003958179.1"
FT   gene            198850..199428
FT                   /db_xref="GeneID:9882098"
FT                   /locus_tag="ELI_0197"
FT   CDS_pept        198850..199428
FT                   /locus_tag="ELI_0197"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825823"
FT                   /db_xref="GeneID:9882098"
FT                   /translation="MTAPMIRFIDTRYNDLFTLQDSGLITETRLDGTTNTHQCYYLDDY
FT                   HTKIGRNVFHIHEYAKRMEAIGARYFPTQPKEKDVMDYYEIYQIPDRMNTDYGFCTYAE
FT                   ARTKIKPEDYACVYMAVLAADVNQEDLYMQHNMDDRPFRNRIHALSLGDVLVFHRGGQT
FT                   RAYYVDTIGFPEVPQFLTPEKQNKKEQVR"
FT                   /protein_id="YP_003958180.1"
FT   gene            199434..199829
FT                   /db_xref="GeneID:9882099"
FT                   /locus_tag="ELI_0198"
FT   CDS_pept        199434..199829
FT                   /locus_tag="ELI_0198"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825824"
FT                   /db_xref="GeneID:9882099"
FT                   /translation="MLNARITYGDKQLLTKLWYTQDTIKCSLYDMGIRKPMDKIYPDDP
FT                   EIHIQYLPDSPQGQQLSSLITCRHSLMEVNTACRAYYCTGDYRVMDRMDERLEKGIIKT
FT                   LEDYIKTAQRIKRKLDKDPIRRKTDAR"
FT                   /protein_id="YP_003958181.1"
FT   gene            199853..200860
FT                   /db_xref="GeneID:9882100"
FT                   /locus_tag="ELI_0199"
FT   CDS_pept        199853..200860
FT                   /locus_tag="ELI_0199"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Antirestriction ArdA family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825825"
FT                   /db_xref="GeneID:9882100"
FT                   /translation="MYEGVINAYVTNLGRYNEGCLVGESLALPANTEEVQALFERIGID
FT                   GKRYEEYFITDYETEVSGLGDCLGEYENLDALNYLASCLDELTEEEMRKYEIALEEGDY
FT                   TSSIVDLINLTDNLDCYDIVQDIDNDYALGEYYINECGAYLDIPEGLSSYIAYDAYGRD
FT                   ARMSDCGSYINSCYVCDTGANFYPFFDGSEIPEEYRITFFPEPREVDALMVRVGQPPEK
FT                   IRIENGLEGIENVFEGTLCAYPLTDEVIIIAQMSAKRVPNRAVFDTAEHEKINIYGDFL
FT                   LCNWDFEALKARDLTPKQIEKYRDQLEYPEKYNGDVQRKIAFPEKEKHRDTMER"
FT                   /protein_id="YP_003958182.1"
FT   gene            200981..201151
FT                   /db_xref="GeneID:9882101"
FT                   /locus_tag="ELI_0200"
FT   CDS_pept        200981..201151
FT                   /locus_tag="ELI_0200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825826"
FT                   /db_xref="GeneID:9882101"
FT                   /translation="MSTAINLNELMKLYEGEDVEITLIIPSSPLIVDVSEPSETTEGKG
FT                   KKNDKQYHESE"
FT                   /protein_id="YP_003958183.1"
FT   gene            201123..201569
FT                   /db_xref="GeneID:9882102"
FT                   /locus_tag="ELI_0201"
FT   CDS_pept        201123..201569
FT                   /locus_tag="ELI_0201"
FT                   /gene_family="HOG000166281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825827"
FT                   /db_xref="GeneID:9882102"
FT                   /translation="MTNSITNPNEITDKKDKITILMIRAGEPPEEMTIENTLEAKQKLV
FT                   GGYIEMYYLPTDDDAVIICNEEGKINGLPLNRGIFDEKKRLVEIIAGDFFLCNAPRDSE
FT                   DFTSLSPKQIEKFSEQFKYPEQFIRLNQGIVAVPIKDKHKDYER"
FT                   /protein_id="YP_003958184.1"
FT   gene            201576..201983
FT                   /db_xref="GeneID:9882103"
FT                   /locus_tag="ELI_0202"
FT   CDS_pept        201576..201983
FT                   /locus_tag="ELI_0202"
FT                   /gene_family="HOG000166281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825828"
FT                   /db_xref="GeneID:9882103"
FT                   /translation="MKRTINVLYIRAGESPRAVTIPNNLKFMQKLVGGNIERYALPTDD
FT                   DAVIICNDEGKISGLPLNRGIFIDNSELIDIIAGDFFICNARNDRKGFSSLTPEQIQKY
FT                   AEEYKFPERFCRVNREIVVVPLMPKIKYYER"
FT                   /protein_id="YP_003958185.1"
FT   gene            202133..202459
FT                   /db_xref="GeneID:9882104"
FT                   /locus_tag="ELI_0203"
FT   CDS_pept        202133..202459
FT                   /locus_tag="ELI_0203"
FT                   /gene_family="HOG000284681" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="relaxosome component"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825829"
FT                   /db_xref="GeneID:9882104"
FT                   /translation="MRKRNVEILFRLTRREAQELDKKVKKSGLSREAFLRAMIEGYQLH
FT                   EKPGPVFYETMRQMSAIGNNLNQIAAKANALGFVDQPLYEKEALKWRKFQTEVKEKFLV
FT                   PEKS"
FT                   /protein_id="YP_003958186.1"
FT   gene            202461..203819
FT                   /db_xref="GeneID:9882105"
FT                   /locus_tag="ELI_0204"
FT   CDS_pept        202461..203819
FT                   /locus_tag="ELI_0204"
FT                   /gene_family="HOG000124498" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Relaxase/Mobilization nuclease domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825830"
FT                   /db_xref="GeneID:9882105"
FT                   /translation="MATTKIWDIRGRLDRVVDYAKNPDKTKNKNYGEADLQALRDVMDY
FT                   VSQDVKTEKQFYVTGLNCSPETAREEMTITKKQYRKEGGIIAYHAYQSFKPGEVTPEIA
FT                   HEIGIKLAEELWGSRFEVIVATHIDKAHIHNHMVLNSVSFSDGLRYYDNKESYRKMREV
FT                   SDRLCLEYKLSVIEKPMNKSMQYGEWQAEREGKPTWRGLIIKDLDDTISECVTMRQFLY
FT                   RLRQKGYAIKYDAKYFTLKPPGKARYVRIDRKHPEYSLSNIEQRIYEQQQIKQYRPGPK
FT                   AAKKKMLLHGSFEKARHTSGLRGLYLYYCFKLGVFQKKKDRKTNALPFLYREDVRKMEQ
FT                   ISREARLLCKHKIDTIEALENYKTSNEQQIKKLCTERKKLWNRTQRTPDEKAVSKIKAD
FT                   IAGLSAQIKTLRKEVKYCDGIAARSIPMREKIKVVKLEEKNNAKEKSKNEHKR"
FT                   /protein_id="YP_003958187.1"
FT   gene            203803..204690
FT                   /db_xref="GeneID:9882106"
FT                   /locus_tag="ELI_0205"
FT   CDS_pept        203803..204690
FT                   /locus_tag="ELI_0205"
FT                   /gene_family="HOG000124499" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825831"
FT                   /db_xref="GeneID:9882106"
FT                   /translation="MNTSGDAAEQVIRISLEGADFLLRLTGTGLKNLAFLLISALKSAD
FT                   IHKTKGKTRLTAMLKSGKPLTVFSINNADLEVFAKEARHYGVLYCALGNPSGSPDGVTD
FT                   ILVKQEDAVRINRIVERFQLAAVNTAEIKSEILNEREGQTHEEAQAEEALLDDLFGASD
FT                   PEAKAGEEQLLDDLLGFAASKEENALPPKEEKLVSRKEDQKAIQAEKPYAEAPQAQEPE
FT                   KSPPSENSSKPPAEGESKPSVRAELRAIKAEQEKARAEPEHRAPETKKETKRREPKRKT
FT                   KKEIPKKSKGDKTR"
FT                   /protein_id="YP_003958188.1"
FT   gene            204687..205574
FT                   /db_xref="GeneID:9882107"
FT                   /locus_tag="ELI_0206"
FT   CDS_pept        204687..205574
FT                   /locus_tag="ELI_0206"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825832"
FT                   /db_xref="GeneID:9882107"
FT                   /translation="MSNLYDLFGQEETEPKPRNNQKWQAEQKANREYCYAQIEKSLETV
FT                   GKSPELFQGYLNVQANFEYYTARNALLIQAQRETATKIADNTAWKEQGIFVKQSEFRNP
FT                   ILILEPGNPYTRDDGTTGQSFKAKKMYDITQTTCRVRSQKTGKLDDRMLIKSLISKAPV
FT                   KILTAEAVNHPLAVDFDMDKECVVVEKGLEPDAMYQGIAAALAKAELALNGEDSGNIDF
FT                   KAQAAAYMLCRQAGVSTACFDFSKLSDFLTSAEPQQVGAELTTIKDAMAEVSMRVKYNL
FT                   QQMVQPKSRADPAR"
FT                   /protein_id="YP_003958189.1"
FT   gene            205583..205777
FT                   /db_xref="GeneID:9882108"
FT                   /locus_tag="ELI_0207"
FT   CDS_pept        205583..205777
FT                   /locus_tag="ELI_0207"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825833"
FT                   /db_xref="GeneID:9882108"
FT                   /translation="MKEVKRILTLDHVEYVVLINALNQMRNGLIRQKRSTDAVDDLLLK
FT                   AIDAPTEKTGKRKERGHAR"
FT                   /protein_id="YP_003958190.1"
FT   gene            205767..207275
FT                   /db_xref="GeneID:9882109"
FT                   /locus_tag="ELI_0208"
FT   CDS_pept        205767..207275
FT                   /locus_tag="ELI_0208"
FT                   /gene_family="HOG000285695" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825834"
FT                   /db_xref="GeneID:9882109"
FT                   /translation="MQDNFSKNIMLYIALLVPVIGLALRIAPFIDEGLYAFILKFPEAM
FT                   EHPFKITWCESSLKSILILMILYVMGIGIFYATKKNYRRGEEHGSAKWGDAQSINRKYR
FT                   EKHFEDNKLLTQNVRMGLDGHRHRRNLNVLVCGGSGAGKTRFYAKPNVMQANTSMVILD
FT                   PKGEILRDTGQLLREKGYEVRILDLINMEKSHCYNPFVYLKTDNDVQRLVTNLFKATTV
FT                   KGAQSSDPFWDTAASMLLLSLVFFLKYEAPTEEQNFPMVMEMLRNGDIPEDVDGYMSPL
FT                   DELMDRLEAREPDHIALKYYRNYRSGAAKTVKSIQITLAARLEKFNLESLSALTVTDEL
FT                   DLASMGEKKVALFALIPDNDTSFNFLISILYTQLFQQLFYTADRKYGGLLPVHVHFIMD
FT                   EFANVSLPDDFDKILSVMRSRGVSVSIILQNMAQLKALFEKQWESIAGNCDTFLYLGGN
FT                   EQATHKYVSELLGKQTIDTNTYGKSSGKSGNYSTNYQNSGRDMP"
FT                   /protein_id="YP_003958191.1"
FT   gene            207365..207748
FT                   /db_xref="GeneID:9882110"
FT                   /locus_tag="ELI_0209"
FT   CDS_pept        207365..207748
FT                   /locus_tag="ELI_0209"
FT                   /gene_family="HOG000290245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825835"
FT                   /db_xref="GeneID:9882110"
FT                   /translation="MEKLKKHIHDDSNGLDYVLVGDYYIPDLQLPEESRPIGRWGRMHR
FT                   EYLQEYCPDRYNELLLSGKLWTYLADLDEQAQNRLDCIIAQIKETEGVTEELKAKDQLA
FT                   WVGHMNSIRHRAEEVIRSEMIFV"
FT                   /protein_id="YP_003958192.1"
FT   gene            complement(207799..208647)
FT                   /db_xref="GeneID:9882111"
FT                   /locus_tag="ELI_0210"
FT   CDS_pept        complement(207799..208647)
FT                   /locus_tag="ELI_0210"
FT                   /gene_family="HOG000156842" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825836"
FT                   /db_xref="GeneID:9882111"
FT                   /translation="MYTKLSIPERLKDLRVVDKHLTLEQLAEQTGLSKSALGKYESDDY
FT                   KDISPFAIATLAKFYGVSTDYLMGVSENKNHPNTELQALHLSDAMVELLSSGKINNRLL
FT                   CELATHPNFLRLMVDMEIFIDQIADMRVNQMNLILEATRQTIFKEHAPGENDLYMRTLE
FT                   LGQVQENDFYSHILHDDLDSIVRDIREAHLKDKTTADPQPTLDEVKENFEQAIQMGTDT
FT                   EAMIHEFCDKMQIPFEKISSEDFSAFLRILSLSKLLKNPNNMRGKAKSQPYYMPKKKKR
FT                   R"
FT                   /protein_id="YP_003958193.1"
FT   gene            208815..208982
FT                   /db_xref="GeneID:9882112"
FT                   /locus_tag="ELI_0211"
FT   CDS_pept        208815..208982
FT                   /locus_tag="ELI_0211"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825837"
FT                   /db_xref="GeneID:9882112"
FT                   /translation="MTDCKGDDLRGSDATIRAHQRGQYAGRESGQEYFADRPADRKIND
FT                   AEHTASNEWR"
FT                   /protein_id="YP_003958194.1"
FT   gene            208989..209282
FT                   /db_xref="GeneID:9882113"
FT                   /locus_tag="ELI_0212"
FT   CDS_pept        208989..209282
FT                   /locus_tag="ELI_0212"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825838"
FT                   /db_xref="GeneID:9882113"
FT                   /translation="MKLNMKEKKILYAYACPSHHNTVTRLKWLTALTVDPEAKSQMLHL
FT                   ARKIETETEERWYEAFYHHLRMEMDEYRRIRRSLRALKANTDYEEELYEEAV"
FT                   /protein_id="YP_003958195.1"
FT   gene            209266..209571
FT                   /db_xref="GeneID:9882114"
FT                   /locus_tag="ELI_0213"
FT   CDS_pept        209266..209571
FT                   /locus_tag="ELI_0213"
FT                   /gene_family="HOG000164350" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825839"
FT                   /db_xref="GeneID:9882114"
FT                   /translation="MRKLSKYEKETIINWNEGETIASIYTFNASLKRRLEDFSRKYPLL
FT                   CRLERSTPEGSVTYVMDKSRLSIRLVPPYSEERLAAARECAKEHGFQVIQTEEKIA"
FT                   /protein_id="YP_003958196.1"
FT   gene            209673..209798
FT                   /db_xref="GeneID:9882115"
FT                   /locus_tag="ELI_0214"
FT   CDS_pept        209673..209798
FT                   /locus_tag="ELI_0214"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825840"
FT                   /db_xref="GeneID:9882115"
FT                   /translation="MYGYGAGETGKNRFCGEGQLRRCGSTEGSQPFVPGALPRES"
FT                   /protein_id="YP_003958197.1"
FT   gene            209798..209911
FT                   /db_xref="GeneID:9882116"
FT                   /locus_tag="ELI_0215"
FT   CDS_pept        209798..209911
FT                   /locus_tag="ELI_0215"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825841"
FT                   /db_xref="GeneID:9882116"
FT                   /translation="MPASTCTGYYLTQNFAGLAALPPSPAQNIFAGRRKNI"
FT                   /protein_id="YP_003958198.1"
FT   gene            209908..211152
FT                   /db_xref="GeneID:9882117"
FT                   /locus_tag="ELI_0216"
FT   CDS_pept        209908..211152
FT                   /locus_tag="ELI_0216"
FT                   /gene_family="HOG000015466" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825842"
FT                   /db_xref="GeneID:9882117"
FT                   /translation="MKLTRHNGRSGKHGTYNPRHNDRRFDVENSEHIDAERARQNVYWD
FT                   CYRGFTTHDFRENSEQPDFSFEEIERMYYYEHYADHVNAQNARNEKTRHIERNRTVDDL
FT                   LKNNKTCPEESIYQIGTMEESVPPETLALIVSEFYEEFENRFGSHIHILDWALHLDEGT
FT                   PHIHERHVFDCENRYGELCPQQEKALEELGIPLPKPEQPKGKHNNRKQTFDAVCRIILF
FT                   DVAKRHGLHLEQEPSYGGRDYLEKQDYILMKQKEQLATQEQKLEELTLKIEDVETLLED
FT                   VSGAAYDKAVEVVTDKVREQTQLEDMEVIEKYRKSVVSPNAKNSPEVVKIANTLLSRVR
FT                   EKLQQSAEKVLKKVQAVLLKPEVKQAGKEQIKNKARKSIKEKLAQGKLDADRENRVRWE
FT                   REGRIAPTRKQDMEL"
FT                   /protein_id="YP_003958199.1"
FT   gene            211168..211854
FT                   /db_xref="GeneID:9882118"
FT                   /locus_tag="ELI_0217"
FT   CDS_pept        211168..211854
FT                   /locus_tag="ELI_0217"
FT                   /gene_family="HOG000015467" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825843"
FT                   /db_xref="GeneID:9882118"
FT                   /translation="METGCLLHCLEVEETNVFEAVKQSVTTRQAALVYGISVGRNGMAC
FT                   CPFHDDRHPSMKVDRRFHCFACQADGDVIDFTSRLFGLSSKEAALKLAEDFSISFDRKG
FT                   HDPPQKRVIKRKISEEMRYRQAEQKCFRVLCDYLRLLERWKEEYAPKQPEDDWNPLFVE
FT                   ALHRQPYIEYLLDLLLSDSIEERAFVVAEYGKEVRKIEQRISEFIASHPAGCDERSRSH
FT                   SDGTER"
FT                   /protein_id="YP_003958200.1"
FT   gene            211814..213172
FT                   /db_xref="GeneID:9882119"
FT                   /locus_tag="ELI_0218"
FT   CDS_pept        211814..213172
FT                   /locus_tag="ELI_0218"
FT                   /gene_family="HOG000008593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825844"
FT                   /db_xref="GeneID:9882119"
FT                   /translation="MSAAEAIATEQSVDEVRQSLSVTDKGKTANTIDNCRIVFCCDPLL
FT                   RDAIRLNLLTDRVDIVQDLGWRRNTSALTDTDVKYLLLYFERNYELTSEKKITAALSIV
FT                   ANENCYHPIQDVLNSLVWDGTPRIRSCLHHFLGADESDYVEEMLKHFLLGAIRRVFRPG
FT                   SKYEEMLCLVGGQGAGKSTFFRLLAIRDEWFSDDLKKLDDDRVFQKLQGHWIIEMSEML
FT                   ATSSAKSIEEIRSFISRQKETYRTPYESQPKDRLRQCVFGGSSNTLDFLPLDRAGNRRF
FT                   LPIMIYPENAEVHILEDEDASRAYLLQVWAEAMSIYHSGKYSMKFSKSIQRQLVEVQKD
FT                   FMPEDTEAGQIQGFLEHYTGNMVCSKQLFKEALGHTFDEPKRWQLHNINEIMNTVVTGW
FT                   KPFSNPRMFAGYGRQKGWERDTSGNELPSNEGGFVELSEEECRQLELPQEWIA"
FT                   /protein_id="YP_003958201.1"
FT   gene            213441..213608
FT                   /db_xref="GeneID:9882120"
FT                   /locus_tag="ELI_0219"
FT   CDS_pept        213441..213608
FT                   /locus_tag="ELI_0219"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825845"
FT                   /db_xref="GeneID:9882120"
FT                   /translation="MEKNKKQNKKVQFVVVREFSGDKTMREAFEQLIERQTCEHFEEWL
FT                   EHREMAQKAA"
FT                   /protein_id="YP_003958202.1"
FT   gene            213680..215332
FT                   /db_xref="GeneID:9882121"
FT                   /locus_tag="ELI_0220"
FT   CDS_pept        213680..215332
FT                   /locus_tag="ELI_0220"
FT                   /gene_family="HOG000060280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825846"
FT                   /db_xref="GeneID:9882121"
FT                   /translation="MSRKKQVNQKITALYCRISLEDGGDNESMSISNQKLMLRDFAEKN
FT                   GMFQYEYYVDDGYTGRNFNRPSFQRMIADIQAGKIGCVITKDLSRLGRNYIEAGSYIEI
FT                   FFPKHNVRYIAITDGVDSLTRQEMDITPFKNILNDMYSRDISKKVLAGRMTRSRQGKFC
FT                   GGQPPLGLMRDPEDKGHLIRDPETAPVIRKIYDMALDGWGCMRIAKQLMDDKVPITRVK
FT                   SNTECDVNYYSWGSARISHILRNPFYKGAHLVCRTHQKGIRSNTYDIIPREDWEIIEDC
FT                   HEAIISPEEWEQVQEIIDRRPTIMKGNSCPFYNLFHGIIYCATCGKSMQVRYEKVGRTG
FT                   KNRFTGEQREPIDKAYYICQTYNRLGKNACTSHKIEARDLYNLVLKDIQELAKTALKDA
FT                   DAFYQRLSSRMERRYLLDASQTQKECQRLESRNREIDEMFLSLYTDKAKGILTEQRFMK
FT                   LTATLEQEQEANQKRLQDLLLMMRHSDEQENEVRTFIKEIRRYAAIEELDEAVLNRLIS
FT                   KILVGEVKKIDGQKVQEVRIVYNFVGEIPEITA"
FT                   /protein_id="YP_003958203.1"
FT   gene            215449..216285
FT                   /db_xref="GeneID:9882122"
FT                   /locus_tag="ELI_0221"
FT   CDS_pept        215449..216285
FT                   /locus_tag="ELI_0221"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative Ribonuclease III"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825847"
FT                   /db_xref="GeneID:9882122"
FT                   /translation="MTKDDANAIMFAYRYDNLTISESLFKQMIGDIAIMRNPWPIFSIA
FT                   ALSGVACLIYDHFFSYETMWIAVVVFLALLALCFFAYCKYEHWLAKKLNPYVVAYQSDH
FT                   NLDNLKQGLDRWRPWAFSKHSKNIITANWFSALLDQQRWTEAEEILEQFLHRAKNTQDK
FT                   IGYHLLRGDYARAIGDTKLEEQERLLSEQLKTQLGNKKGESRVPANAKESKYAFFCWLS
FT                   FSFGLALFGIISNIATGDSILGSVGAGLFILGLFSFPVCLIWLILWLIRRRKEVVK"
FT                   /protein_id="YP_003958204.1"
FT   gene            216282..216869
FT                   /db_xref="GeneID:9882123"
FT                   /locus_tag="ELI_0222"
FT   CDS_pept        216282..216869
FT                   /locus_tag="ELI_0222"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825848"
FT                   /db_xref="GeneID:9882123"
FT                   /translation="MTYILPVLYVIVSYTFFLLAGCFDNAIKLQILSILLPFIMGIVNL
FT                   IVVLTVGRKWSRKTLLNCTLIIKYGLIPFYLVGGSITVYVTLMAFFPLPLMALFGLVTI
FT                   VFLIFGYGILLGAAPYAIAYLIKSCKDGIHPKWLAVLAGICQFFFSFDVLAMMVLTLKE
FT                   RHRVKTTIAVFCAMCLALLLIVLYVVMTLIGA"
FT                   /protein_id="YP_003958205.1"
FT   gene            216944..218056
FT                   /db_xref="GeneID:9882124"
FT                   /locus_tag="ELI_0223"
FT   CDS_pept        216944..218056
FT                   /locus_tag="ELI_0223"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825849"
FT                   /db_xref="GeneID:9882124"
FT                   /translation="MKKQWIALLTGCVLVCSMLAGCGSKPQTSAPAAAGSDKGCTDEAI
FT                   LSQLKNDGTPEFVLDGTYYTLPLETSQLIQAGWSLETEEYDAAEVSLQPGERIYGELSK
FT                   DDQEIDVAIVNAGTEPCKPAEGGTVVELEYSADKDQPNPDFFVTLNGINCAMSNAALQK
FT                   ALEGVDGYKLNSAGNIDINRTVDDDEIAVYKVILDDDYTAITLASDNVFEYKDYQPQEV
FT                   KEQASNEKIAAYKDTTKAEMEPYAQDFNAIIEGYEENMVVGFYSEGTIWGEEVGEYKSI
FT                   AGTPLASDVSLYIAEDTTGQLYCIANQILNEDGTVSTAIELEEGDQVKVWGYASQYLEL
FT                   QEGLKIVVVQPGIIERNGELVILDKNLKAD"
FT                   /protein_id="YP_003958206.1"
FT   gene            218137..218595
FT                   /db_xref="GeneID:9882125"
FT                   /locus_tag="ELI_0224"
FT   CDS_pept        218137..218595
FT                   /locus_tag="ELI_0224"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825850"
FT                   /db_xref="GeneID:9882125"
FT                   /translation="MLTMNEKDKNEMLEAILKENEAYQCKLWAVIMAGADTYALIGGLS
FT                   TLTGGAAAALGALSNAYCYLGVTEKHLNMVIVNSVNVSKIENRLSLPLSSITKAEVKGG
FT                   LLPGRKVVMLHFGKEKMKISLMNNAIGSDIQGQKENVEMFCQIVSKLG"
FT                   /protein_id="YP_003958207.1"
FT   gene            218626..219213
FT                   /db_xref="GeneID:9882126"
FT                   /locus_tag="ELI_0225"
FT   CDS_pept        218626..219213
FT                   /locus_tag="ELI_0225"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825851"
FT                   /db_xref="GeneID:9882126"
FT                   /translation="MKKILIVLLTMVLLLAGCGKNGASSPQSPSDESVADRQKPSSSET
FT                   EISSEDHAIPGSYTVPEGWEKSEKHSTDSQIFYIEEGHENDEKPDNISIHVGKNKYSLE
FT                   EHEQFRDAIVQQILMQLDGIEAQLNGDGTYTEQGDLLYIFTIDEGDIVTTQYYIVKDYG
FT                   FCLIQLTNFSGSETTEQAARDMVDSFVWDTEG"
FT                   /protein_id="YP_003958208.1"
FT   gene            219254..220459
FT                   /db_xref="GeneID:9882127"
FT                   /locus_tag="ELI_0226"
FT   CDS_pept        219254..220459
FT                   /locus_tag="ELI_0226"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825852"
FT                   /db_xref="GeneID:9882127"
FT                   /translation="MEKQKLSGKTILKLVGALLALAYLGFCLYAGITGKFPNMHKAEHV
FT                   MRFGDLKNWVSGGISAVMIFALCITSALNDLNLQKGRKKSFLPFFLTMILPIILLLLLE
FT                   SYLDIGWIGIALYAGIAVFLFGVAWTPQLLNQWIARRLLRDEPMSGKQQVQIIEWIHFH
FT                   PLKKLLIFGLWGFGVVLVLRGIWVTATGKIEMDGELFLFLLGTAVLVVALFQKMRRYIC
FT                   APYRNIPVLNQILSKNQLELLLDGEHFEPIEFEDEGMKKYLEIYQSQNWMLIGGKLLSK
FT                   KLALWFTMNRFRNHTSLKVLYLNGMTAKATVDLDIRGDRYKEFTAVLKELIGYEGTLKL
FT                   YEKEEQLAQKFASFFPEQTSEQDRVAAFLSQDVTLIRQDYIQTFSPPPDSRKKKRSRRE
FT                   RE"
FT                   /protein_id="YP_003958209.1"
FT   gene            220529..221074
FT                   /db_xref="GeneID:9882128"
FT                   /locus_tag="ELI_0227"
FT   CDS_pept        220529..221074
FT                   /locus_tag="ELI_0227"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825853"
FT                   /db_xref="GeneID:9882128"
FT                   /translation="MNYDMNMIKYRKNGFFRIAAAILIICFTLLGLTACAGTTDSKDNN
FT                   DDNALIQGTWEIDTGSGAGYKFVDDKFMWLKSIENVNDNYWYGDVEYYKGAEAMDIAGL
FT                   TEEELKSSLPGLKPENIFVTKLDPEKIITDGEDKTATNMNDQTLWTRLWLIEENEDSVA
FT                   AVVFDLETFSMESYTKVK"
FT                   /protein_id="YP_003958210.1"
FT   gene            221134..221547
FT                   /db_xref="GeneID:9882129"
FT                   /locus_tag="ELI_0228"
FT   CDS_pept        221134..221547
FT                   /locus_tag="ELI_0228"
FT                   /gene_family="HOG000002314" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825854"
FT                   /db_xref="GeneID:9882129"
FT                   /translation="MVGFKVKYYWFQIGSEDFLFSFFSTVAYNLENKKWGTKFPVIMNE
FT                   LYLGELNSSRIPEAINELEQMKQGLAKYSPNKVIWNIKNLSAQPPWGTNISDDITDLSN
FT                   YFVTSDGEDFITIFNHALLKAEELNCALKITSI"
FT                   /protein_id="YP_003958211.1"
FT   gene            221777..222118
FT                   /db_xref="GeneID:9882130"
FT                   /locus_tag="ELI_0229"
FT   CDS_pept        221777..222118
FT                   /locus_tag="ELI_0229"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825855"
FT                   /db_xref="GeneID:9882130"
FT                   /translation="MTPDEVRMLDNRYALLFIRGERPIKDEKYNLLKHPNIHLTTDGGM
FT                   LPYEHGRVDHAVASMSLVPYSPDMVIEEMEISEEITCMLWSEEDLETYFEKLKEIQLNE
FT                   PNNETKKEA"
FT                   /protein_id="YP_003958212.1"
FT   gene            222084..222437
FT                   /db_xref="GeneID:9882131"
FT                   /locus_tag="ELI_0230"
FT   CDS_pept        222084..222437
FT                   /locus_tag="ELI_0230"
FT                   /gene_family="HOG000253063" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825856"
FT                   /db_xref="GeneID:9882131"
FT                   /translation="MNQTTKRKKKHKALTPRLSVNTKMHRHFSVYMAVVLCVLCTTTVC
FT                   AADDPIAVVNNLSTFIFGLVRAVGMILIGYGIVQIGLSLKSHDPSQRANGIMTVAGGIV
FT                   VTFAKEILNTIAG"
FT                   /protein_id="YP_003958213.1"
FT   gene            222503..223342
FT                   /db_xref="GeneID:9882132"
FT                   /locus_tag="ELI_0231"
FT   CDS_pept        222503..223342
FT                   /locus_tag="ELI_0231"
FT                   /gene_family="HOG000253064" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825857"
FT                   /db_xref="GeneID:9882132"
FT                   /translation="MESDNWIVQNLQNALDTWNGKLSEIWQLLTQSPQTFKGGGIWEVI
FT                   VNINGTLQAIGYALLVLFFLVGMVKTCGSLAEVKKPEHALKLFVRFAIAKGIITYGLEL
FT                   MIALFTIVQGIVSKIMVTAGLGGATQTVLPPEIVEAVENCAFLESIPLWAVTLIGGLFI
FT                   TVLSFVMIMSVYGRFFKRFLYTAIAPVPLSTFAGEPSQNIGKSFLKSYAGVCLEGAIIV
FT                   LACVIFSLFAASPPQVNPDASAVTMVWAYIGELVFNMLVLVGTIKLADHCVKEMMGL"
FT                   /protein_id="YP_003958214.1"
FT   gene            complement(223369..223749)
FT                   /db_xref="GeneID:9882133"
FT                   /locus_tag="ELI_0232"
FT   CDS_pept        complement(223369..223749)
FT                   /locus_tag="ELI_0232"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825858"
FT                   /db_xref="GeneID:9882133"
FT                   /translation="MVYVAFISLIITIVLIVLSFVLKLAGKLRLTLPVVYFLLISTFLN
FT                   PWAAAHETLAFAILFILLGFSLISWIRSFKEYWDERQYYKTMKEDIAWQARTARERGIS
FT                   TRDFYIDSEGTMRYNKDDKPVF"
FT                   /protein_id="YP_003958215.1"
FT   gene            223840..224220
FT                   /db_xref="GeneID:9882134"
FT                   /locus_tag="ELI_0233"
FT   CDS_pept        223840..224220
FT                   /locus_tag="ELI_0233"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825859"
FT                   /db_xref="GeneID:9882134"
FT                   /translation="MEVKINREIREYTESMFFGLSMRQFVFSVMACGMAVGLYFLLRPY
FT                   FGMETLSWACILAAAPFGALGFIKYHGMSAEQFLWAWIKDRFLMPKILIFDADNLYYRM
FT                   LTTPANKKRDKKRKKDQGAKND"
FT                   /protein_id="YP_003958216.1"
FT   gene            224213..226537
FT                   /db_xref="GeneID:9882135"
FT                   /locus_tag="ELI_0234"
FT   CDS_pept        224213..226537
FT                   /locus_tag="ELI_0234"
FT                   /gene_family="HOG000285690" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825860"
FT                   /db_xref="GeneID:9882135"
FT                   /translation="MIKTLKNSNHQEKEKFKIPKSVQQAVPIQIIYPDGIFCIGKNKYS
FT                   KTFRFTDINYAVAGREDKEAMFLEYSELLNSFDSGTTTKLTINNRRLNRADFEKSILIP
FT                   MKEDGLDIYRKEYNQMLLDKATGTNSMIQEKYVTVTVIRKNYEEAKTYFARVSTELTAH
FT                   FSRLGSRCTELDAEERLRVLHDFYRTGEETGFTFDLLQTMKKGHDFRDFICPDTFEFES
FT                   DFFKMGDRYGRVLFLREYASYIRDSMISELTQLNRNLMLSIDVIPVPTDEAVREVENRL
FT                   LGVETNITNWQRRQNQNQNFSAVIPYDMELQRKESKEFLDDLTTRDQRMMFGLLTLVHT
FT                   AKSKKQLDADTDTLLTTARKHLCQFAILRYQQQDGLNTALPIGHRKINALRTLTTESLA
FT                   VLMPFRVQEIMDTGGIYYGENAISHNLIMCNKANLLNQSAFLLGVPGSGKSFSAKELIV
FT                   FLALATQDDILVCDPEREYVSLITALGGEAIRIAAGSEDHINAMDMVEGYGDGGNPIVD
FT                   KSEFILSLFEQLDKKGLGAKEKSIIDRCVALVYDDYQRGGELPTLCVLREKLMDQPEPE
FT                   AQELALELELFTDGSLNAFAHKTNVDTQNRMVVYDIMDLGKQLKTMGLLVITDAMINRV
FT                   TENWKKGKRTHLFLDEFHVVFENEYSGAFFNSAWRRFRKRNAFPTAITQNVEYLLDSVL
FT                   ASTMLSNSEFIVMLNQAASDRQKLANLLNISREQLSYITNADEGCGLIRYGSALVPFVN
FT                   KFPRKTRLYRLMTTKPGEETL"
FT                   /protein_id="YP_003958217.1"
FT   gene            226565..228412
FT                   /db_xref="GeneID:9882136"
FT                   /locus_tag="ELI_0235"
FT   CDS_pept        226565..228412
FT                   /locus_tag="ELI_0235"
FT                   /gene_family="HOG000124500" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="antigen-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825861"
FT                   /db_xref="GeneID:9882136"
FT                   /translation="MLSIGKAIKTREVKKDIRVLDKAGTAAERIREATIRTKDAAERSP
FT                   SPQETSANDYAINRTSDYADRAAHGAARQVQDQSRRAVQRVQAHRADRMAESAENARAE
FT                   AEQGVRNIGDEVRIKTRERADGMVKAKGSTEPSIKALPEKEKNIRQSIYSAAKSRRAAR
FT                   TGLEKAPKRTIKTSDQTGRLRIKTASEARKLGKNSIRTAKASKRAIKSGRATAKTARES
FT                   SRAAAKASQAAAKAAAKTSQTSAKVAVKASQAATKAAITTGKLAAKAAAAAAKAAATAG
FT                   KALASALAAGGWVAVLILVIIVLFGGALCLVGAGNANAVEPVSAEVQAYELLIAKYARE
FT                   HGIQEYVELIKAVMMQESGGRGGDPMQCSACGYNDQYPGGITDPEYSINIGIRYLADCL
FT                   HAAGVTSPMDLEHIKLGLQGYNFGAGYIDWALENYGGYTQANAQEFANLHGGSYGDVSY
FT                   VPNVLRYYPFGRIPTGAGNSNIVNVAASQIGNVGGQPYWSWYGFSGRVEWCACFVSWCA
FT                   DQCGYIDAGVIPKFALVSDGVNYFQSKGQWQDGSYTPKAGDIIFFTWSGDGSADHVGFV
FT                   ENVTDGTVNTIEGNTTDSCARRSYPLGGYMILGYGVPAY"
FT                   /protein_id="YP_003958218.1"
FT   gene            228441..228533
FT                   /db_xref="GeneID:9882137"
FT                   /locus_tag="ELI_0236"
FT   CDS_pept        228441..228533
FT                   /locus_tag="ELI_0236"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825862"
FT                   /db_xref="GeneID:9882137"
FT                   /translation="MKIGQKQGTGRKVFRVPFYFCAKNQDSRGF"
FT                   /protein_id="YP_003958219.1"
FT   gene            complement(229370..229537)
FT                   /db_xref="GeneID:9882138"
FT                   /locus_tag="ELI_0237"
FT   CDS_pept        complement(229370..229537)
FT                   /locus_tag="ELI_0237"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825863"
FT                   /db_xref="GeneID:9882138"
FT                   /translation="MRCDRTKSDAAFLFVRLRFHSIFKFPHFQTSFILKSSNWKIKYIF
FT                   PYPFDFLFIG"
FT                   /protein_id="YP_003958220.1"
FT   gene            229865..230203
FT                   /db_xref="GeneID:9882139"
FT                   /locus_tag="ELI_0238"
FT   CDS_pept        229865..230203
FT                   /locus_tag="ELI_0238"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825864"
FT                   /db_xref="GeneID:9882139"
FT                   /translation="MEELDHKAIGLRIRKQRTFLNMSRDELARKIGITPTFLADIELGT
FT                   KGFSLKSLNRFSNVLKMSADAILYGPKEYMGTKYAALLELLERCPAEKGKFAEEILTLF
FT                   LLSHDPVE"
FT                   /protein_id="YP_003958221.1"
FT   gene            complement(230275..230568)
FT                   /db_xref="GeneID:9882140"
FT                   /locus_tag="ELI_0239"
FT   CDS_pept        complement(230275..230568)
FT                   /locus_tag="ELI_0239"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825865"
FT                   /db_xref="GeneID:9882140"
FT                   /translation="MDSESLSVKILKAMGHPIRLKIVKFLLDKPHCVCELKENLDFSQP
FT                   NLSQHLKILKEAGIIASEKVGVQTHYHVCLKNTEALIAAAEAMSQEYLNQFK"
FT                   /protein_id="YP_003958222.1"
FT   gene            230729..231274
FT                   /db_xref="GeneID:9882141"
FT                   /locus_tag="ELI_0240"
FT   CDS_pept        230729..231274
FT                   /locus_tag="ELI_0240"
FT                   /gene_family="HOG000126629" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825866"
FT                   /db_xref="GeneID:9882141"
FT                   /translation="MSENCFDKKMKRTTDSELRCNYEKRREVILDFLYLDLNTCERCKA
FT                   TGASFDLAVTLLLDIFKLLDFHVEIHKINVTTKELAEQYHFISSPTIRVNGIDICDEVK
FT                   ENRCQDCGDLCGETVDCRIFIYQGEEYEEPPVAMIVEGILEVVFGHINQKEKNYQLPDN
FT                   LKRFFSGKDQKNVKKGCC"
FT                   /protein_id="YP_003958223.1"
FT   gene            231387..231758
FT                   /db_xref="GeneID:9882142"
FT                   /locus_tag="ELI_0241"
FT   CDS_pept        231387..231758
FT                   /locus_tag="ELI_0241"
FT                   /gene_family="HOG000276346" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825867"
FT                   /db_xref="GeneID:9882142"
FT                   /translation="MNDNLPGFLMCVCTGKCPGFQAMDIWDFINQVRVELPVEYAIIHP
FT                   QMCEEDGDRFFADFLKTGRKVVIGACAPNMQRKMFKDAFKDAGLDIEKDAVMLDIRDMT
FT                   NEQAFEKVEKALEDMGLEV"
FT                   /protein_id="YP_003958224.1"
FT   gene            231761..232045
FT                   /db_xref="GeneID:9882143"
FT                   /locus_tag="ELI_0242"
FT   CDS_pept        231761..232045
FT                   /locus_tag="ELI_0242"
FT                   /gene_family="HOG000044615" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825868"
FT                   /db_xref="GeneID:9882143"
FT                   /translation="MSDTTFMGVERKRIDWSPRIDYSKCNDCMDCFDFCPHQVFEKQEN
FT                   GVHKLVVKNPDNCVVFCRACGKTCGLDAISFPDKPATTKLIKAIRKEGK"
FT                   /protein_id="YP_003958225.1"
FT   gene            232047..232895
FT                   /db_xref="GeneID:9882144"
FT                   /locus_tag="ELI_0243"
FT   CDS_pept        232047..232895
FT                   /locus_tag="ELI_0243"
FT                   /gene_family="HOG000126640" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825869"
FT                   /db_xref="GeneID:9882144"
FT                   /translation="MEKDFCILPCNGLDKFAGSLTREVALEILEEGNNELICPVLYHAA
FT                   QKRYNKILEEKPLLVIDGCNTRCASKLASENNLKVTERINVSEKAKDAGLSLGDYLEID
FT                   EELKDFINGIAEDFQAKPEEGEQSVFVMPQAVDYASFSKGKFVFKVPKEAYYFNENDCW
FT                   VFIENGFAHVGVTDFVQQNLSDILFVDFPEIGREIEQFDDVGSVESGKSIFELVSPVSG
FT                   IVTAINDVLEEEPERVNESPYEKGWIAEIKLTDWDEDIEMLISYEEYFEIMKKKVEEIN
FT                   E"
FT                   /protein_id="YP_003958226.1"
FT   gene            232888..233286
FT                   /db_xref="GeneID:9882145"
FT                   /locus_tag="ELI_0244"
FT   CDS_pept        232888..233286
FT                   /locus_tag="ELI_0244"
FT                   /gene_family="HOG000126641" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825870"
FT                   /db_xref="GeneID:9882145"
FT                   /translation="MSKVKIIPCSGIGKVLGLIARESALKVTGELLPEDTERLCLAHIV
FT                   TGDEEIVSKIEGQPCITIDGCAKCCAQKSVEAAGGAICGKHRVIDFMKAHRGEEHGTGT
FT                   YLSEDGWKFADELAAVMADEVKAMKKGE"
FT                   /protein_id="YP_003958227.1"
FT   gene            233291..233689
FT                   /db_xref="GeneID:9882146"
FT                   /locus_tag="ELI_0245"
FT   CDS_pept        233291..233689
FT                   /locus_tag="ELI_0245"
FT                   /gene_family="HOG000128794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825871"
FT                   /db_xref="GeneID:9882146"
FT                   /translation="MGEQNIGIIACSGEECLGGTISRLAVRKMMETLRPGAVSTLCLPL
FT                   FIAGGDQERAFAQNHPTISVDGCSKCCAKRAIEKYSNAVAGIVDVEAILGEEIALDHQT
FT                   ISTKDLTPEQLQYVDQVAAEICKIFDTL"
FT                   /protein_id="YP_003958228.1"
FT   gene            233710..234351
FT                   /db_xref="GeneID:9882147"
FT                   /locus_tag="ELI_0246"
FT   CDS_pept        233710..234351
FT                   /locus_tag="ELI_0246"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825872"
FT                   /db_xref="GeneID:9882147"
FT                   /translation="MYMDKINVYGGKMGNRKLHLINMEKIKDGHFIKNFKLTFLNTNGR
FT                   QKEYEMISFNELVNPDDIGKTNNGVAIIALYKGKLLLLREFRMAVNDYVYNLVAGRIEP
FT                   GENIEDCVHREIYEETGLEVSNIVTVLPSTFAAASMTDLRMTFVVAEVTGEISDAFMNE
FT                   HEEIHGGFYTPEEVKELLQSPNFNANCQLVAYFYSMLSVFTDAFEKAQTE"
FT                   /protein_id="YP_003958229.1"
FT   gene            complement(234410..234946)
FT                   /db_xref="GeneID:9882148"
FT                   /locus_tag="ELI_0247"
FT   CDS_pept        complement(234410..234946)
FT                   /locus_tag="ELI_0247"
FT                   /gene_family="HOG000294963" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fe-S cluster domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825873"
FT                   /db_xref="GeneID:9882148"
FT                   /translation="MYLDHIAIVFMEPCTTGHGRIKIRAQLARNIDDLLPYLNAVIKTA
FT                   NYNPKAPSFSYKTGNHIITVQGDTLSATQMENESDAYEFLEQFQIIVNDTADNKAHITP
FT                   LNKQRERLKPFELYRYLPKTNCKSCGEATCMAFATKLVDGSQKLDRCTLLKEQENSLNY
FT                   QHLAFILKESGYDLH"
FT                   /protein_id="YP_003958230.1"
FT   gene            complement(234937..236103)
FT                   /db_xref="GeneID:9882149"
FT                   /locus_tag="ELI_0248"
FT   CDS_pept        complement(234937..236103)
FT                   /locus_tag="ELI_0248"
FT                   /gene_family="HOG000017510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825874"
FT                   /db_xref="GeneID:9882149"
FT                   /translation="MVAYLDNAATSFPKPSNVIESMTAFMAQNGATSGRGAYQKALLSD
FT                   QLVFQARSKTARFFNHPDPKTVVFTKNVTEAVNIALKGFLKSGDQVVTSAVEHNAVWRC
FT                   LKMLEKNKGVCINVVPADKNGQTSPESVERALTFKTKLIVFNHASNVLGTVQPIQAIGE
FT                   MANLRHIPLMVDTAQTAGHFPIDMQDSHIDILAFTGHKGLMGPMGIGGLVLSPNLDIEP
FT                   LISGGTGGDSAYPYQPDYYPNHLEAGTLNVPGIIGLSSGIDFINETGLEGIHSKIKMLY
FT                   NYAVHQLDTIPGIELYGPLDAQKTVGVIPFNLKGCPPEEIAFYLDQKHHVMIRAGLHCA
FT                   PSAHQLMGTLERGACRIGLGYYNSKMDVDQLVNGLRGYLRNKGAVLCI"
FT                   /protein_id="YP_003958231.1"
FT   gene            236253..236624
FT                   /db_xref="GeneID:9882150"
FT                   /locus_tag="ELI_0249"
FT   CDS_pept        236253..236624
FT                   /locus_tag="ELI_0249"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative arsenate resistance operon repressor
FT                   ArsD"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825875"
FT                   /db_xref="GeneID:9882150"
FT                   /translation="MKDETKFEIYEPARMTNEQKEQLRKITPLLDALIERDYSISIFNF
FT                   ATDEEEFLDHPIIGQALIMEGEGLLPITLINGEVKRMGTFPNNAEIGEWLQLNSEELLD
FT                   ILKVFREESGVGCSCGTCC"
FT                   /protein_id="YP_003958232.1"
FT   gene            236686..237417
FT                   /db_xref="GeneID:9882151"
FT                   /locus_tag="ELI_0250"
FT   CDS_pept        236686..237417
FT                   /locus_tag="ELI_0250"
FT                   /gene_family="HOG000035714" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamine amidotransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825876"
FT                   /db_xref="GeneID:9882151"
FT                   /translation="MNKKPLIGVLPQYQVAEHKIRIFPEYMDAIMDAGGIPFLLPFARR
FT                   KKDLKKIVQKLDGFLFTGGQDVSPELYHQDMCHCSNEILPIRDELETQLFKEILKVNRP
FT                   VLGICRGLQLINVVLGGTLFQDVNIQNKRKMPLQHEQKAAVNVPVHSITIKAASLLYAI
FT                   TKEEHIDVNSFHHQGIKKLGNHLEVVARSNDGLIEAVQIKTLDFGLAVQWHPELLYSDN
FT                   VHAQKLFKAFIKASKKNSKNR"
FT                   /protein_id="YP_003958233.1"
FT   gene            237504..239219
FT                   /db_xref="GeneID:9882152"
FT                   /locus_tag="ELI_0251"
FT   CDS_pept        237504..239219
FT                   /locus_tag="ELI_0251"
FT                   /gene_family="HOG000236816" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenical pump-driving ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825877"
FT                   /db_xref="GeneID:9882152"
FT                   /translation="MYEVFNPENAGLTKYLFYTGKGGVGKTSTACATAVSLADKGKKVF
FT                   LISTDPASNLQDVFETELDNKGVSIKQVPNLVVANLNPEEAAAEYRESVVGPYRGKMPE
FT                   SIIANMEEQLSGSCTVEIASFNEFAHFITDDKINNQYDYIIFDTAPTGHTLRMLQLPSA
FT                   WDSFIDESTHGASCLGQLSGLGDKKEMYAHAVKTLSDKDMTTLILVSRPEKAPLDEAAR
FT                   ASKELSDIGVNNQELIINGVLERVNNSDPVSESFFEKQQKAMAGIPESLKAMPVFVLPL
FT                   RSYNVSGIDNIRRMLISDDLSELDDFNNNFEFPGLTTLINDLHKSKKKVIFTMGKGGVG
FT                   KTTIAAAIALGLAKFGEKVHLTTTDPAGNISAQAIANRNVEVSNIDEAEELQKYKDEVI
FT                   SKAIAGGVSKEDLDYIKEDLRSPCTQEIAVFRAFADIVEKAEEKVVVIDTAPTGHTLLL
FT                   LNSTESYHKEMERSNAEIPESVMKLLPRLKNKNETEVVIVALPEATPYFEAYRLEEDLN
FT                   RADIDNKWWVINASLLAADTNDPFLKARAANEEKWINRIAEETKGNYVVIPWQK"
FT                   /protein_id="YP_003958234.1"
FT   gene            239282..239689
FT                   /db_xref="GeneID:9882153"
FT                   /locus_tag="ELI_0252"
FT   CDS_pept        239282..239689
FT                   /locus_tag="ELI_0252"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825878"
FT                   /db_xref="GeneID:9882153"
FT                   /translation="MCVGMEKIMIINILKTLSDVNRLRILNLLNQKPLCVCEIEYLLEL
FT                   NQSNLSRHLRNMNQLGLLDTWRENKFAYYKINEDFVKANPFIMEVFDRLTEEKQLQEDL
FT                   DNFNAYIAENIPCACVTKMLLEKKYEQKEGS"
FT                   /protein_id="YP_003958235.1"
FT   gene            239691..240077
FT                   /db_xref="GeneID:9882154"
FT                   /locus_tag="ELI_0253"
FT   CDS_pept        239691..240077
FT                   /locus_tag="ELI_0253"
FT                   /gene_family="HOG000276043" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative arsenate resistance operon repressor
FT                   ArsD"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825879"
FT                   /db_xref="GeneID:9882154"
FT                   /translation="MKKIEIFDPAMCCSTGVCGPGVDPELLRMATMVSNLQKAGKEIKR
FT                   HNLSEEPQAYIDNAAVNDVILKEGADALPVTVVDGAVLKKGEYPTNDELLDWSGMSKEE
FT                   LVTLLIQEKVAQNGGCCSGGSGCC"
FT                   /protein_id="YP_003958236.1"
FT   gene            complement(240216..240605)
FT                   /db_xref="GeneID:9882155"
FT                   /locus_tag="ELI_0254"
FT   CDS_pept        complement(240216..240605)
FT                   /locus_tag="ELI_0254"
FT                   /gene_family="HOG000273093" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825880"
FT                   /db_xref="GeneID:9882155"
FT                   /translation="MKKVAFICVHNSCRSQIAEALGKHLASDVFESYSAGTEPKSNINP
FT                   DAVRIMKTYYHIDMEQTQRPKLLESLPPIDIVVTMGCNVTCPHIPCSIHMDWGLDDPTG
FT                   KDDTVFLKTIKEIETKILLLKSKLK"
FT                   /protein_id="YP_003958237.1"
FT   gene            240704..241015
FT                   /db_xref="GeneID:9882156"
FT                   /locus_tag="ELI_0255"
FT   CDS_pept        240704..241015
FT                   /locus_tag="ELI_0255"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825881"
FT                   /db_xref="GeneID:9882156"
FT                   /translation="MSILDNMFGNEDSMEKAMKEMGEQFFYIKVLGAEEPECTRLLQKA
FT                   QDALAILKKEGQCERIKDSENIAGCKVTSQAVLVINDCVIKNGSNLEIEDIVELLKKF"
FT                   /protein_id="YP_003958238.1"
FT   gene            241047..242795
FT                   /db_xref="GeneID:9882157"
FT                   /locus_tag="ELI_0256"
FT   CDS_pept        241047..242795
FT                   /locus_tag="ELI_0256"
FT                   /gene_family="HOG000295127" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825882"
FT                   /db_xref="GeneID:9882157"
FT                   /translation="MNENIHWEYDDCEFDNRVSNLMWTICGDYTAQMGPKEKASLSKNI
FT                   ALYYGIMAGGRRKFIDWLKVNGYVKGRIRQNFNLEKLQTLIFLAVNPMVIRQISKERPG
FT                   VADIQKEACSEIVTLLKNPKSQQFLDLVEFAIFEALAEISSKAEKNVLAMSQKILEISR
FT                   SDTTEEFINGVDNLYIEWQNVKEVEPIQYLLDENSKKEVINTEEFINKSVDDLLQIKEL
FT                   REVEREEDNREEEEWEIGKTEVVLVNQNDVDNMQKQVAHFCGSPYLEIYQTKKLQNTLC
FT                   KGAHRDCCLHFTDGVLRSKCDSDFKKKYALRDQHRNINVYQENLRIYTRTIKRLRDALL
FT                   RTLTMERSKYPVLSDWGSINARTVWRVGKTPTSRLFEHFESNDKGGFVVDLLLDSSMSQ
FT                   KGREPLVAIQAYIIAMALLESGIPCRVTGFNCFMNFTVMKRFRDYSDSIKTTENIFEYY
FT                   CEGSNRDGLAIRSICDGLYRRSEENKILIILSDGKPNDVHMESTDRTNPFRGILAYNGG
FT                   LGVADTAKEVRVARQRGISVLGVFTGDERDLEAEKHIYGKDFVFSRNINHFADIVTTYL
FT                   KRVITN"
FT                   /protein_id="YP_003958239.1"
FT   gene            242822..243736
FT                   /db_xref="GeneID:9882158"
FT                   /locus_tag="ELI_0257"
FT   CDS_pept        242822..243736
FT                   /locus_tag="ELI_0257"
FT                   /gene_family="HOG000003451" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825883"
FT                   /db_xref="GeneID:9882158"
FT                   /translation="MTIFEKLEEQGVNEKLIKDVECFRKEYLVAENLKDRIPKCETIFY
FT                   GKDIWSMCITAILEGENILLSGPKATGKNVLADNLCEVFGRPQWNTSFHVNTDSTSLIG
FT                   TDTFIDNEVRLRRGSVYECAANGGFGVFDEINMAKNDALVVLHSALDYRKIIDVPGYEK
FT                   ISLDPATRFIGTMNYEYAGTKELNEALVSRFMTIDIPQIDEETLMVILKQEFSDAKEDM
FT                   LRQFAGIFLDLQEKAMNSEISTKSVDLRGIMGSLRTIRRGLKPMLAINMGVIGKTFDQY
FT                   EKEIVYDVIRTRIREDWLPEDIF"
FT                   /protein_id="YP_003958240.1"
FT   gene            243737..243784
FT                   /db_xref="GeneID:9882159"
FT                   /locus_tag="ELI_0258"
FT   CDS_pept        243737..243784
FT                   /locus_tag="ELI_0258"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825884"
FT                   /db_xref="GeneID:9882159"
FT                   /translation="MYFFVMIALKFDILF"
FT                   /protein_id="YP_003958241.1"
FT   gene            244177..244677
FT                   /db_xref="GeneID:9882160"
FT                   /locus_tag="ELI_0259"
FT   CDS_pept        244177..244677
FT                   /locus_tag="ELI_0259"
FT                   /gene_family="HOG000290244" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825885"
FT                   /db_xref="GeneID:9882160"
FT                   /translation="MKATAKCFVKNEVGQYDEITYDELCKYCEAYPEEYASKKFFPLQG
FT                   MLLEVTPEQYKSLYRDLERQRYLKNLDDYYNPISLNELKNDKSMLIKANVDVFKIVETG
FT                   MLLESLENALNQLNEQEMFIINALFFEQKTDTALARETGIPRSTITSRKIKILKKLKSI
FT                   IEK"
FT                   /protein_id="YP_003958242.1"
FT   gene            245178..245564
FT                   /db_xref="GeneID:9882161"
FT                   /locus_tag="ELI_0260"
FT   CDS_pept        245178..245564
FT                   /locus_tag="ELI_0260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825886"
FT                   /db_xref="GeneID:9882161"
FT                   /translation="MDNSILKIQNEILSRKNICHELIIRKKSATIELNNVTLKNAVKKE
FT                   QEEYYSNLLKALNVTITNESSRLQKNYDKEILGSKELKDFFQVSDKTIQEKLYHDPTFP
FT                   SIFITSKRKGITPLRLVVYTLANT"
FT                   /protein_id="YP_003958243.1"
FT   gene            245618..246973
FT                   /db_xref="GeneID:9882162"
FT                   /locus_tag="ELI_0261"
FT   CDS_pept        245618..246973
FT                   /locus_tag="ELI_0261"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825887"
FT                   /db_xref="GeneID:9882162"
FT                   /translation="MTMSDVLEARRNAILSAIEILRSKKIVSMESIDNQRREKGSGGLR
FT                   YREERKIWEASIDLGIDSNGKRIRKVRTGKTKEIAFKNLETAVMDHYSKLEETLHKELL
FT                   EIESQIEKEKINKNGILLSEFYKEFVNQKKRGYVTDRTLGTYVDNYKTIQKYLKNVTLQ
FT                   ETVDNIEIFEKFAKDLLLGKKPIVKTTFLRKLNFIEQTLDYAVKKKLIESNILKKEKLE
FT                   LPLCKKKSRVVREVSVEDYHKLIECSRKENFFVYVMVTALLATGLRIGELAGLKIQDID
FT                   KENKKIAVTKTLTYNIEIDEDFNITKRGVITVPPKTVSGNRFVYVPDEIIDNFIKLHES
FT                   YREDKKLMEKIRQKGNKDFIFISQRGTAVQPNVLALKLRNFAERCGIEGIHPHRFRHNF
FT                   ATAMARGKVSPTVGAKVLGHSNPNMFLKVYTDVNEEDKKQACKAAVEMIQGL"
FT                   /protein_id="YP_003958244.1"
FT   gene            247086..247176
FT                   /db_xref="GeneID:9882163"
FT                   /locus_tag="ELI_0262"
FT   tRNA            247086..247176
FT                   /db_xref="GeneID:9882163"
FT                   /locus_tag="ELI_0262"
FT                   /product="tRNA-Ser"
FT   gene            complement(247469..248962)
FT                   /db_xref="GeneID:9882164"
FT                   /locus_tag="ELI_0263"
FT   CDS_pept        complement(247469..248962)
FT                   /locus_tag="ELI_0263"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825888"
FT                   /db_xref="GeneID:9882164"
FT                   /translation="MAKNRTRFGKVMALLDITLNEISEYLHIDKTTVSKWRTGSRKLTP
FT                   RSPYFDPILSLIIERNNALPQRPLVGFLYDLYPDELFDNPKQIYDFLKLYLSTPLDVKQ
FT                   DSEAAPQERNLSHQVLTGVEGRQKALDLVLSQAEKMVVPGTIKILELEQISWLCRDPVY
FT                   LKSVVTRLKQLAEKNFRIDFAFSSAQLRPNYIGFISAVGGLRFHKNIHKYIIDNDRIQG
FT                   LLPCIYLVSDGCVSIGLDSDEPSIPIHTNFFSDPLNLHKYSKLFDKVVQLYGNRVLVTS
FT                   SAKDVDHILENINFFSTKKEDFLFYGSYPSVTTMSAALLSEILDNNNIHGNVRNRCIHY
FT                   YTSLRHIMTSTPTNYLGVYNLILGSLEKALSFEYHIEYELSAITNRQIQKTPDQYRKHL
FT                   SETVEFLEDHPNVRAMLLSNGYQKGTPCVWVKRNLWSLIFNTTNLPSEYQIIFWDDVNL
FT                   VNMAMDASKFFVTNNYSIEHRQKEYNLQILQALSEGKII"
FT                   /protein_id="YP_003958245.1"
FT   gene            249036..249161
FT                   /db_xref="GeneID:9882165"
FT                   /locus_tag="ELI_0264"
FT   CDS_pept        249036..249161
FT                   /locus_tag="ELI_0264"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825889"
FT                   /db_xref="GeneID:9882165"
FT                   /translation="MFNVNYGVNAIFQIKMAPNKILPIYCQVLYFYIQNEFVFVK"
FT                   /protein_id="YP_003958246.1"
FT   gene            249239..250255
FT                   /db_xref="GeneID:9882166"
FT                   /locus_tag="ELI_0265"
FT   CDS_pept        249239..250255
FT                   /locus_tag="ELI_0265"
FT                   /gene_family="HOG000199852" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825890"
FT                   /db_xref="GeneID:9882166"
FT                   /translation="MEEIIISSTITFILTFFVFYILSVKINKHKKGLNFRQSRKNMPEK
FT                   EKTSNVTNEVRETNICRQDEEVFIKYMTDVSMNAALEEKAFEAFLQPKYELKGETIVGA
FT                   EALVRWITEGEIFLYPNNFIPFFEKNGFIINLDLYMFEKVCEIIHSWRSAGIKEVAVSI
FT                   NFSRRHLANEGFAEELGKIADSWKVPRSLLEIEVTESIAMENIVQIQRSFAALRRLGFS
FT                   VALDDFGSGYSSLGFLKNMPIDTVKLDKSFFDRIENQQKFETIIKHILLMAHELDLRVV
FT                   AEGIETEEQVNLLRHFDCDMVQGFYYAKPMKEALFKEELKKQSKEMEVDYSATYAVL"
FT                   /protein_id="YP_003958247.1"
FT   gene            250233..252749
FT                   /db_xref="GeneID:9882167"
FT                   /locus_tag="ELI_0266"
FT   CDS_pept        250233..252749
FT                   /locus_tag="ELI_0266"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825891"
FT                   /db_xref="GeneID:9882167"
FT                   /translation="MLRMRFYNRKKPKDIFSELKFWINRSIAMLTIILFCFVFLLSAAS
FT                   NADAAGAYSNQVIYNPEFQTSDSTLLSYRKSIEQSDKDTFRITLEAVTGQDIKTIGGKS
FT                   GSIVLVLDNSGSMGWGSSPTPADYARDALKEFANEFLKNGNSGNKLGLVTYSSGSGVPI
FT                   YDAYDEIKYVQGYSMTENSDIFGQVVDGLQTPSGETDVQMGIKTARDILAADTSGNPQF
FT                   ILVFSDGATNRSARPTSAGELGGANISPCTFGDKIYDMTFKFDGFDYGAQGSAVYNDGV
FT                   YTTNGNVNAHTVAAVSEALLAKDQGIDIYSVFYHNPALNDLEYGAGVFVMKNSASSGQY
FT                   TEISPGNAGAFAEIFTEIEKQIQESIAPWFVEDPMADYIEFAGFADEQTSSEAFFDADT
FT                   GILKWNLLAVNGTPEEAGRFRYKLSYNVFLKSDDEGFENGTDYPTNGKTTLTYQKITGE
FT                   ITESNTVDFEVPIVRGDSSNMNLIHVKALDMIAYQEGNSTSGDPFPRPYFAFFWDDNGQ
FT                   PGKALISEELNALNYTIDGQPFEEGSHTFFIYPYPFRSQYVNEQTGIVHNDPRALDEAP
FT                   GIYQIKLTTQDFETAHHYTVNAFDTQGKQYDFRLSQEGRLEVRAQSETPTQYTPYTAGP
FT                   LPENFESATPAVFVEAEAQLYNTAGILLNASQIANVTLMSDGVLPDEANGIASILSQRA
FT                   DMENKTYEMKYLQLVDNEDGNIVVESNKDVIIFYPYPQGMNHNDDFMVFHFYETNRAAG
FT                   EAPVYTSSGPLAITKLTGGIQFTTNGSMEGFGPFVVAYSKANNGVSAELPEAGGPGNAV
FT                   FAAVGILMSIAGIGMVLLILKNKKVI"
FT                   /protein_id="YP_003958248.1"
FT   gene            252859..254376
FT                   /db_xref="GeneID:9882168"
FT                   /locus_tag="ELI_0267"
FT   CDS_pept        252859..254376
FT                   /locus_tag="ELI_0267"
FT                   /gene_family="HOG000063758" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825892"
FT                   /db_xref="GeneID:9882168"
FT                   /translation="MLQKIKKISFSSFLAVLLFLAAGLTAFAAPVTAGNGNLTIDSMGN
FT                   TKQSFENRTINAYNLFTITSVNGENIVYEVNPEFKTALIAVTNIETAGKTDAEINAALV
FT                   DWLEGAMPSNSQEIKEFAQNLKSEIGVAEPTVTVTGMAGATNVEFSGLDWGYYLIVDAD
FT                   DISANSRMAASFPILHSFHLNNETVYVKSDLPAIDKTVNGKRGTSAQIGDTVNYTITGK
FT                   VPNTTGFGDYTYKIFDTFSEGLSFNNDLKVSVGGIDVTATTVVTTPDAPHTFTVAVPMV
FT                   NGTGAAIYTIGEEVIITYTATVNENAAIGESGNNNDAKLVYSNDPGDESLTEIYEIPEL
FT                   PKVYSFGLNVNKIDQDGNPLDGAVFTLSGNSSQAPYYASWSGNSGTNGSFTFYGLKSLE
FT                   NYTLTETGNPTGYKPLTAPITFNLEAQYDTVGALVTVEAKNVSGGYTIDVTPADKGILE
FT                   MTVVNISGSKLPNTGGSGTIMYLLIGGVLIGSAVVLLVVSRIKKRKV"
FT                   /protein_id="YP_003958249.1"
FT   gene            254379..255215
FT                   /db_xref="GeneID:9882169"
FT                   /locus_tag="ELI_0268"
FT   CDS_pept        254379..255215
FT                   /locus_tag="ELI_0268"
FT                   /gene_family="HOG000099306" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sortase family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825893"
FT                   /db_xref="GeneID:9882169"
FT                   /translation="MRRRYSIKRWIIPIVAVFMMVGGLAVFLYPALSNFLFEYEQRSAI
FT                   ASYKKQVAETDSNKLSEMASKAQEYNNALLELPSPLVSAQRDLTEGDDILDLGASGIIG
FT                   YIDIEKLGLHLPIRHGTDEKTLQTAVGHLKGSSFPIGGQGTHSVLVAHNGLPSAKLFTD
FT                   IDQLKKDDVFRVTVLAQVYDYRIDQILIVLPEEVEKELAILPGEDKITLMTCTPYGVNT
FT                   HRLLVRGTRYLPETDEKMSGKVHSDSFWGGIIGMVLLSVSSAGVIFWFQKHKKEIH"
FT                   /protein_id="YP_003958250.1"
FT   gene            255425..256453
FT                   /db_xref="GeneID:9882170"
FT                   /locus_tag="ELI_0269"
FT   CDS_pept        255425..256453
FT                   /locus_tag="ELI_0269"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative glycine cleavage system T protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825894"
FT                   /db_xref="GeneID:9882170"
FT                   /translation="MEEKPMRKNETNVRKEHEAIRNSVGYYDFTHQLLEVKGPDAQAFL
FT                   NKMLVASIGKMEIGEAKYTTMLNDDGIIIDDVIVFRVEKEVLWISTLYIDALIAWFDAH
FT                   KENAKVEYRDITEKTTMYAVQGPDSRAVLNDFLKDNIDSMKYFTIENNMVGDIPVKIAR
FT                   SGYTGELGFEIYCFPEDKTFIEEKLADSGKQFDIKKITTDVIITSLPREKGFVLMSDLA
FT                   GTNPLEADFGWTVDWNKDFVGKSALEKVKANGAKRKLIGFTVEDDAAQVKPGADVKVGG
FT                   IVAGKVTMFTYGYTVEKNIGFALVDVDKAKIGDAAVVGDGIDAVLSERVFYDPENRRVR
FT                   GK"
FT                   /protein_id="YP_003958251.1"
FT   gene            complement(256534..256989)
FT                   /db_xref="GeneID:9882171"
FT                   /locus_tag="ELI_0270"
FT   CDS_pept        complement(256534..256989)
FT                   /locus_tag="ELI_0270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825895"
FT                   /db_xref="GeneID:9882171"
FT                   /translation="MEKITTNLLLKAGISYPFNDLFQAYFYYRQACCAFEIGYALNPDK
FT                   MIFNFSDCLLSYMTTKCIGEFPLDVLYPPEILELIEHDKSSSVKYVETLKVYLDSSLSI
FT                   TNTSKTLGIHRSTLIARIKNISSVLAGSLDDPDYRLLLNILLKAYQK"
FT                   /protein_id="YP_003958252.1"
FT   gene            complement(257095..257217)
FT                   /db_xref="GeneID:9882172"
FT                   /locus_tag="ELI_0271"
FT   CDS_pept        complement(257095..257217)
FT                   /locus_tag="ELI_0271"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825896"
FT                   /db_xref="GeneID:9882172"
FT                   /translation="MPLSIVFDSAVEISQIRLSVSKSKLFMKTLTFPLNTSALF"
FT                   /protein_id="YP_003958253.1"
FT   gene            complement(257362..258027)
FT                   /db_xref="GeneID:9882173"
FT                   /locus_tag="ELI_0272"
FT   CDS_pept        complement(257362..258027)
FT                   /locus_tag="ELI_0272"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825897"
FT                   /db_xref="GeneID:9882173"
FT                   /translation="MELNTDILFEALSKIYKVEAAGCTLTNLSLDLPEHYLGGGSAFKK
FT                   DHVYIARTDQLPPSPELEGPALLICLGGSPPNWYFNSEFSLLIVKTAPDILTLFNKVQA
FT                   IYRKYNEWADALDKILETTADIQELIDVSLPVFNNFMAVIDGQMNYLAYTREMSCKTCK
FT                   SFLPDYSGKVPIMIFKNLAKIQKAETLQPESDFIPTGSSFSTAKFSLVSSRFSLYTIH"
FT                   /protein_id="YP_003958254.1"
FT   gene            258212..258439
FT                   /db_xref="GeneID:9882174"
FT                   /locus_tag="ELI_0273"
FT   CDS_pept        258212..258439
FT                   /locus_tag="ELI_0273"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825898"
FT                   /db_xref="GeneID:9882174"
FT                   /translation="MGDLLGRKITIINELKQEKIINLKKQIRIAYYFNIKAEFFDLKRS
FT                   ASCDLSKYWYNQKKNRQIHRNMNTLKTDGF"
FT                   /protein_id="YP_003958255.1"
FT   gene            258470..259111
FT                   /db_xref="GeneID:9882175"
FT                   /locus_tag="ELI_0274"
FT   CDS_pept        258470..259111
FT                   /locus_tag="ELI_0274"
FT                   /gene_family="HOG000252208" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825899"
FT                   /db_xref="GeneID:9882175"
FT                   /translation="MTKEKRALAIIDRLKKEYPDAECSLEYDPKEAWRLLVSVRLAAQC
FT                   TDARVNVVVKELYAKFPDVAALAQAEPEEIEAIVRPCGLGKSKARDISACMKILRDQYD
FT                   GMVPDDFDALLKLPGVGRKSANLIVGDVFGKPAIVTDTHCIRLVNRMGLVENTKDPKKV
FT                   EMALWKLIPPEEGNSFCHRLVLHGREICTARTKPHCDRCCLADICEKNGV"
FT                   /protein_id="YP_003958256.1"
FT   gene            259199..259363
FT                   /db_xref="GeneID:9882176"
FT                   /locus_tag="ELI_0275"
FT   CDS_pept        259199..259363
FT                   /locus_tag="ELI_0275"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825900"
FT                   /db_xref="GeneID:9882176"
FT                   /translation="MTLKMSFKPAAKNEYADSAECVKGNGKTSWKKRFAGCVVYSDLEI
FT                   SQCDKAGTM"
FT                   /protein_id="YP_003958257.1"
FT   gene            complement(259598..259924)
FT                   /db_xref="GeneID:9882177"
FT                   /locus_tag="ELI_0276"
FT   CDS_pept        complement(259598..259924)
FT                   /locus_tag="ELI_0276"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825901"
FT                   /db_xref="GeneID:9882177"
FT                   /translation="MEKKFNLIAGIFIILFFLMILIITSTMKIQPGTWESESDSTLRIT
FT                   LYPDDTFESSIYGNGTYAVQKTGVTLHSNTDITLTVIRKPLKLVLYDRQSQNYFYPANT
FT                   DLKK"
FT                   /protein_id="YP_003958258.1"
FT   gene            260250..260798
FT                   /db_xref="GeneID:9882178"
FT                   /locus_tag="ELI_0277"
FT   CDS_pept        260250..260798
FT                   /locus_tag="ELI_0277"
FT                   /gene_family="HOG000228810" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825902"
FT                   /db_xref="GeneID:9882178"
FT                   /translation="MIEIRWHGRGGQGAFTAARLLGDAVVCDDKSALAFPSFGPERRGA
FT                   PVLAFTRIDDAPIKDRSDVVDCDCAIVLDETLLGAPVKAGLKPGAKVIINTMKPAEVFD
FT                   FSDCEDCKVITVDATGLALKILGRPITNVPLLGALTAATELTSLDSIYKAIDTQLPEKV
FT                   RAKNKTLLEETYNTVKEAL"
FT                   /protein_id="YP_003958259.1"
FT   gene            260799..261101
FT                   /db_xref="GeneID:9882179"
FT                   /locus_tag="ELI_0278"
FT   CDS_pept        260799..261101
FT                   /locus_tag="ELI_0278"
FT                   /gene_family="HOG000044614" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825903"
FT                   /db_xref="GeneID:9882179"
FT                   /translation="MNRPKLSPPQPSGTIEQLPMGPSTRSGHLIDVSSGMRTFRPVIDA
FT                   EKCVNCLRCFLVCPDGTIDKSGDILEIDYDYCKGCGVCAKACKVEAITMIKEADA"
FT                   /protein_id="YP_003958260.1"
FT   gene            261098..262282
FT                   /db_xref="GeneID:9882180"
FT                   /locus_tag="ELI_0279"
FT   CDS_pept        261098..262282
FT                   /locus_tag="ELI_0279"
FT                   /gene_family="HOG000230983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825904"
FT                   /db_xref="GeneID:9882180"
FT                   /translation="MSEKLFVSGDEAVALAVRQAKPHVIAAYPITPQTIVVERLADYVE
FT                   DGSLDCQYMYVESEHSAMSAVIGSAAMGARSFTATSSQGLLYMVEGLHYASGSRFPIVM
FT                   MNANRSLAAPWNIYGDQRDSLSQLESGWIQLYVENVQEAFDTTIQAFKIAEDPEVMTPV
FT                   MVNLDGFVLTHTYEPLEMTDQAAVDAYIPYQDYINKLNLEDPVSTCITAGPTYNTEFRY
FT                   QQQIAMLKAEKVIDESDEEFGRLFGRTYGGMVEAYQCEDAEAILVTIGSVTGTARVVVD
FT                   ACRAEGKKVGLLKLRCVRPFPTEKVAEIVKNAKAVGVMERDISFGFEGAVYSDFNSALK
FT                   QQGVDVPTCNYVGGLGGRSISKEDISGIFDALLAGNTEKPVEFINVRRDIDYGA"
FT                   /protein_id="YP_003958261.1"
FT   gene            262272..263162
FT                   /db_xref="GeneID:9882181"
FT                   /locus_tag="ELI_0280"
FT   CDS_pept        262272..263162
FT                   /locus_tag="ELI_0280"
FT                   /gene_family="HOG000230970" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825905"
FT                   /db_xref="GeneID:9882181"
FT                   /translation="MALNAKTIPNEELFYGHKACGGCGGALAIRLALKVLGERSIAVIP
FT                   PNCMSTVAFVYPHMPLFVNGIIPPFAATAAVMSGVLAGAKALGLEDYHVVGFAGDGGTS
FT                   DIGLQALSGAIDRNDKEIFICYDNEAYMNTGIQKSGLTPYGAKTTNTPAGKNIHGAARP
FT                   KKKIFEIIAAHEIPYAATASVGYPEDYLRKLEKAKNCDGPSFIHVLAPCPTGWQTPTDI
FT                   SIELAKEAVDNGLWYLAEYENKEFTLNRNPKEFTDISDYLSKQGRFSHLDENDIALITE
FT                   GRDETWEKIRRDWVK"
FT                   /protein_id="YP_003958262.1"
FT   gene            263172..264632
FT                   /db_xref="GeneID:9882182"
FT                   /locus_tag="ELI_0281"
FT   CDS_pept        263172..264632
FT                   /locus_tag="ELI_0281"
FT                   /gene_family="HOG000016514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Vinylacetyl-CoA delta-isomerase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825906"
FT                   /db_xref="GeneID:9882182"
FT                   /translation="MKTARDYIDSLRDRDIKVYIKGELIDSDKVIDHPFIKGHVNAASM
FT                   TYALAGSPQYEDLMTTTSHLTGKKINRFTHIHQSVSDLVKKVKMLRMISQKTGTCYQRC
FT                   VGFDAMNATYSVTYDMDKAMGTEYHERFKKFLLYVQENDLMIAGAMTDPKGDRSLRPSQ
FT                   QADPDLFVHVVDKNEEGIVIRGAKAHMTGMVNSHEMLIMPTMGMKEDDADYAVCCALPV
FT                   DAPGVIHIFGRQTNDDRKMEGEIDQGNAKFGIVGGECLTVLNDVFVPWERVFMCGETSC
FT                   SGLLVERFACYHRQNYGGCKGGVSDVVVGAAALMADYSGYGKAGHVKEKINEMIHLTET
FT                   LYACSLACSCEGKPTESGAYFVDPLLANVGKHNVTQLIYDIDRLAQDIGGGIIATMPSE
FT                   SDLRNPEIGKYVDKYLKGVADVPTEDRMRIGRLIENMTGGTALVESMHGAGSPQAQKVM
FT                   YSKLSNLEKKKEFAAHLAGIHSDKSEEE"
FT                   /protein_id="YP_003958263.1"
FT   gene            264635..265813
FT                   /db_xref="GeneID:9882183"
FT                   /locus_tag="ELI_0282"
FT   CDS_pept        264635..265813
FT                   /locus_tag="ELI_0282"
FT                   /gene_family="HOG000223062" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative aspartate transaminase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825907"
FT                   /db_xref="GeneID:9882183"
FT                   /translation="MSNEINTYFSQVANEYPASGIRKMFEIAAQYDPKEIVNLTVGEPN
FT                   FDTPQNVKDAAKKAIDDGFTHYNPNAGMPALREAVAQSYAHYNCGYQADNVIITVGALE
FT                   ALTLGLLTIVNPGDEVLVPDPCFPNYLGQIMITKAKPVTVPVYEENDYKIQAEDIEKAI
FT                   TPKTKAIILNSPSNPLGSILEEEDVRAIARVVEKYNLYVFSDEVYDKIIYDGHKHFSMA
FT                   QIPELTDQVMVMNSFSKAYAMTGWRIGCLLADSALTKRMAQIQEGMVSCVSTFTQVAAI
FT                   EALKGPQTAVQQMIADYTRRREILIDGLNAIPGFSVKKSPGSFYAFANIKAFGKTSQEF
FT                   AEDLVREAKVITVPGSAFGSMGEGYMRFVFANSDENLKEALQRIDAYVKKNY"
FT                   /protein_id="YP_003958264.1"
FT   gene            265948..267219
FT                   /db_xref="GeneID:9882184"
FT                   /locus_tag="ELI_0283"
FT   CDS_pept        265948..267219
FT                   /locus_tag="ELI_0283"
FT                   /gene_family="HOG000243801" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825908"
FT                   /db_xref="GeneID:9882184"
FT                   /translation="MNSQKSEYNPYDNFLEVVDTAAGKLGLDKNEYITITYPERELQVA
FT                   VPVHMDDGSIRVFKGYRVQHSSGRGPSKGGIRFHPNVNIDEVKALAAWMTFKCAVVNIP
FT                   YGGAKGGVEVDPSELSRGEMERLTRRYTAAILPLIGPERDIPAPDVNTNAEVMGWIMDT
FT                   YSMFKGYSVPGVVTGKPIDIGGSLGRNEATGRGVSIVAMEAFKYLGIDSPSLRIAVQGM
FT                   GNVGGTTARLLSEAGYKIVGVSDVSGGYYKADGLDIRDLEAYIANSSSHSLEGYSAEGV
FT                   EKIDNDGLLCCDCDVLIPCALENQITADNADRIQAKLIVEGANGPTSVEADEILTKRNI
FT                   AVIPDILANAGGVVVSYFEWVQNTQNLTWDEDNVNSTLRKIMVDSFGEVQNIHDTDGVT
FT                   FRVAAYILGLKRLSMATRIRGIFP"
FT                   /protein_id="YP_003958265.1"
FT   gene            267511..268896
FT                   /db_xref="GeneID:9882185"
FT                   /locus_tag="ELI_0284"
FT   CDS_pept        267511..268896
FT                   /locus_tag="ELI_0284"
FT                   /gene_family="HOG000219544" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamate mutase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825909"
FT                   /db_xref="GeneID:9882185"
FT                   /translation="MEYRILFDFGSTFTKAAVICKEEKAVVFTTRHPSTVKEDARIAMK
FT                   ACLSDIRRAIGGSAADRAEKYASSSAAGGLRIVVVGLTYNLSISAGRNAAFGAGAKIIH
FT                   VTSGALTKEEIEKIEGLPAEMILLCGGYENGNQTIIRHNAEMIAQSQISCPVIYGGNSQ
FT                   VAQEIRAKLLQNKKECFQAPNIIPQVGVLDIDVAEEIIRHLFMNRIVDMKGLGDIIKLV
FT                   DGPIVPTPAAVLDAGLLLSQGTSGHDGLGELMLVDIGGATTDIHSYAEHTSYEGARLVG
FT                   ADEPYARRTVEGDLGMRESSDVLVRELGMEFFANEIGVPEEVLEKSISYRVHNTKFLPG
FT                   TSLEKRIDQIIAESAAYLAARRHAGVIEHKSSNYCRRIQHGKNLTHVRTIIGTGGPIIN
FT                   SENPEAILKHVLRRKKGEKDALLPSAGDFVVDRDYILYAVGLLSYVDKDLAFAVGMNSI
FT                   IKK"
FT                   /protein_id="YP_003958266.1"
FT   gene            268919..270664
FT                   /db_xref="GeneID:9882186"
FT                   /locus_tag="ELI_0285"
FT   CDS_pept        268919..270664
FT                   /locus_tag="ELI_0285"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825910"
FT                   /db_xref="GeneID:9882186"
FT                   /translation="MEIKMKKRFEYKNLPDMKSILDEVDKVAADTVIGKTLFMKEKGVT
FT                   SEAEYKRKMAEEGHIMKHSHIGWNSWDATAKGVEEVYNTLQKRGSYVDRFGFCLDWVMG
FT                   VPAEYRDKLPVGTGLTFKNPDEWQKLGQIVPVQPHLGDHMIASCNSFENTRYALAAGVT
FT                   TIGNVSHYYTYEYPGVDIEEQRVIDMLKAIVLMGKFKNQGTIIHSNVDDGFGSQFHDLA
FT                   NLVGWCIMERYIVEELLGGRMCHCFGNLFSDPVLRMTFNQAMWEINTYKTPGSMIYGNT
FT                   IDFGFDYDRNFGALSSFVMADSMGQSKCPTGHAVTPIPVTEAARVPSIEEIVQAHMTVD
FT                   MMIEKGRYYLPYINWTEINAEKNLLVACGRIFFERIMNGLDDLDVDITHAGEILGALKS
FT                   IGSEQLEEVFGVGKADKLAMRGRVPVRPTNIVMTINERQREISDQIQNLEGALQDVNVI
FT                   IGSTDGHEFGKEIVKSILLQAGANVFDLGKSVPVQDILDTMIESESRFIVMSSFNGIAL
FT                   SFAREMLEGLEKSGMDAHLIMGGLLNENKDGSDLAVDVSDDLRALGVSCDNNAEGLVDT
FT                   IRAFL"
FT                   /protein_id="YP_003958267.1"
FT   gene            270755..271594
FT                   /db_xref="GeneID:9882187"
FT                   /locus_tag="ELI_0286"
FT   CDS_pept        270755..271594
FT                   /locus_tag="ELI_0286"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825911"
FT                   /db_xref="GeneID:9882187"
FT                   /translation="MRNTAKNENNTAAKGKTAEKETSFSKSILKTLSILEQYSKADELG
FT                   IKELSESTGIPASTVQRIVNTLVMKQYLVQNPHTLKYQLGIAFFNISSRYSNSRDWVEV
FT                   AKAHMEEQVEKTQETVNLAILQGKSVIYLTKVDSPHILRPNFTVGTAYPALNTALGRCL
FT                   LAYQPWDKVERMIRLQPNFNKDINEFHEMLEEVERNGYATEDEEFQPGLFCIAAPVWDA
FT                   NDRVVAAISTSIPKIRLNESNKENIIGMMQSTASQISLDLKKRFTYIDVDKLSSTIR"
FT                   /protein_id="YP_003958268.1"
FT   gene            271765..272451
FT                   /db_xref="GeneID:9882188"
FT                   /locus_tag="ELI_0287"
FT   CDS_pept        271765..272451
FT                   /locus_tag="ELI_0287"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825912"
FT                   /db_xref="GeneID:9882188"
FT                   /translation="MKEKYSEEKSLTEQVYSKIKERILTLDYPPGIAITEANLAEEFSV
FT                   SRMPVHIAIQKLTNEGWIETGFRKKVYVKGISVKDVREIYEIREILEVKALDTIFEKKL
FT                   NWDFSFKLEEKFVRMKASYHDYYAFEYADSEVHRTMVSVLDNKRIDQIYLNLQDELVRI
FT                   MVLIFKYRKRDNDYAKQVIESMRKIIIGIRENHYDDALYQLKNEHLASGVEEALEAVDF
FT                   YNERIM"
FT                   /protein_id="YP_003958269.1"
FT   gene            272621..273826
FT                   /db_xref="GeneID:9882189"
FT                   /locus_tag="ELI_0288"
FT   CDS_pept        272621..273826
FT                   /locus_tag="ELI_0288"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HAD-superfamily hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825913"
FT                   /db_xref="GeneID:9882189"
FT                   /translation="MSVVSIQKTEGNDYASIQASVQKAIADCGGLSDIVKPGYKVLIKP
FT                   NLVAVPDDRLSGGVTRWEVVKAIAEMVKEEGGVPIIAESSAAGVDTEEVIKACGYDQLR
FT                   EEGYSVIDLKKQAKKVKIPVPDGKLISELSSWDVVAEADAIITVPVMKTHDQTEVTLGL
FT                   KNLKGLIGDVQKKEFHSIGVINGVIDIIQTVKPVLNVIDGTFCQQGLGPIFGETVVMDL
FT                   IVASKDVVACDAVASVIMGYKVDEPMLTVEANARGLGEMDLDKIEIKGKPIEDVKHRFK
FT                   RSSEVEIEGLPPYKLIFAEGACTGCRNTVISSLMDLKSQELTQYLEGKILVVGPVKEEE
FT                   LPPESTPENTVLIGKCTNPLKGKGRSVKGCPPGNVFVVQGIVGDEVKVGRRYSDADEEK
FT                   IN"
FT                   /protein_id="YP_003958270.1"
FT   gene            273861..274760
FT                   /db_xref="GeneID:9882190"
FT                   /locus_tag="ELI_0289"
FT   CDS_pept        273861..274760
FT                   /locus_tag="ELI_0289"
FT                   /gene_family="HOG000026216" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding-protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825914"
FT                   /db_xref="GeneID:9882190"
FT                   /translation="MFKKMVAIERLNLTPEAENRLSQYAEKVQFYYSIPEDNPAIIKRI
FT                   GDADAVLLSYTSQIDSEVLNACPNIKYIGMCCSLYAPENANVDIAAAEEKGIVVKGVRD
FT                   YGDEGVPEYVISELVRLLHGFGGTMWKSFPMELTNINVGIMGLGTSGTMVAKALKFFGA
FT                   NVHYYSRTRKPDVEEQEGFIWMNKEGLLEKVDILCTCLNKNVILMNEREFEIFGAGKIF
FT                   VNTSIGPSHNINALKRWLSNEKNYALSDTAGGLGAEELLRYPNVFCPNKTAGTSTLSKV
FT                   RLSEKVLENLRVYLEAPL"
FT                   /protein_id="YP_003958271.1"
FT   gene            275096..275197
FT                   /db_xref="GeneID:9882191"
FT                   /locus_tag="ELI_0290"
FT   CDS_pept        275096..275197
FT                   /locus_tag="ELI_0290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825915"
FT                   /db_xref="GeneID:9882191"
FT                   /translation="MSIGTWIMLIFYGVVLGGGSIALIAHSLRNKEI"
FT                   /protein_id="YP_003958272.1"
FT   gene            275213..276526
FT                   /db_xref="GeneID:9882192"
FT                   /locus_tag="ELI_0291"
FT   CDS_pept        275213..276526
FT                   /locus_tag="ELI_0291"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825916"
FT                   /db_xref="GeneID:9882192"
FT                   /translation="MSDKKSRGAWGSRIGYILSTLGMAIGVGAMWRFPMLTAKYGGGAF
FT                   VLAFFLISIIIVIPAAWGEVGLGRHTKSGVAGALESLAGKKGKVIGTFIALIPLLLMFY
FT                   YPVIMANVVQYIYYTVAGSPFLADPEGFYNVVANNKIVVFLVVAGLDILTGVICLGGIK
FT                   GGIEKACKILLPALFVILVVLVVRICTLPGIMEGIEFYVRPDFSQWANPKLWVEAAGMA
FT                   LFAIGCGPGYLITFGSYCSDKADIGTDLVTVNITQMLICVLSGFAMIPAVILFGMNPDA
FT                   GSGLIFMVLPKVFEQLAGGPVWLVFFLIALLFAGLSTTISAWEVPVTVLIDSFGMKRRT
FT                   AVIIVTLVAIIGAVPCIWISEFLEHFDYLVGTFLYTAAATGLAVYLAWFYKAKRVREEW
FT                   INPTSVVKYGAWEDVLYKFLTVPVFIYFLATGFIGFFS"
FT                   /protein_id="YP_003958273.1"
FT   gene            276606..277352
FT                   /db_xref="GeneID:9882193"
FT                   /locus_tag="ELI_0292"
FT   CDS_pept        276606..277352
FT                   /locus_tag="ELI_0292"
FT                   /gene_family="HOG000230756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-
FT                   carboxylate (AIR) carboxylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825917"
FT                   /db_xref="GeneID:9882193"
FT                   /translation="MNAKKLKDLLGEVKSGQTSVDSAFEKIKDIPYHDLEYAKVDYHRE
FT                   LRNGFPEVVYSPGKSLEQVRGIVKDMIERTDGNIMATRADENVYKTIAELSDETEYYED
FT                   ARIVVVKRQAFKVSEKSITVVSAGTSDIPVAEEAAVCAEVMGNCVDRIYDVGVAGIHRL
FT                   LDNVERINRAGVIIVIAGMEGALASVVGGLTDKPVIAVPTSIGYGANFGGVSALLGMLT
FT                   SCASGIGVVNIDNGFGAACLASKINR"
FT                   /protein_id="YP_003958274.1"
FT   gene            277366..279291
FT                   /db_xref="GeneID:9882194"
FT                   /locus_tag="ELI_0293"
FT   CDS_pept        277366..279291
FT                   /locus_tag="ELI_0293"
FT                   /gene_family="HOG000200401" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionyl-tRNA synthetase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825918"
FT                   /db_xref="GeneID:9882194"
FT                   /translation="MKEKYYVTTPIYYPSSDLHIGHTYTTVAADTLKRFKALQGYDAYM
FT                   ITGIDEHGQKIEKVAEEKGMSAQAFVDEEAARIAELWKLMRIDHDQLIRTTDPEHMKTI
FT                   QRIFKKLYDQGDIYKGKYEGWYCTPCESFWTESQIVDGKCPDCGLPVEMASEEAYFFKM
FT                   SKYADRLLEHIETHPDFIKPESRKNEMINNFIKPGLQDLCVSRTSFSWGVPVDFDPKHV
FT                   VYVWIDALPNYLSALGYLNDKPDLMERYWPANVHLVGKDIIRFHTIYWPIMLMALDLPL
FT                   PNQIYGHGWILLKGGKMSKSVGNVVNPVELAGKYGVDALRYYLLREMKDGADGVYSEEL
FT                   LINRINSDLANDLGNLLSRTAAMTVKYFDGKIPGQREAAALDSELIKLAQDTPEVFAGY
FT                   MDKVDFSRALEAVWRLVGRTNKYIDETEPWILYKDPKNHSRLAAVMYNLTEALRFTAVM
FT                   VGPVMPETGRKILESLNVPETLRTWKSLEVFGQYPENIKIENCDVLFPRVETEKQNKKN
FT                   KAAQKEKQKKAEIQNSDKITIDDFSKVELKIGVILACEKHPDADKLLVFQIDLGSEKRQ
FT                   IVSGIAEYYKPEDLIGMTVVVCVNLKPIVLRGVESNGMILSAIGGKRLSLLTVEDSTMP
FT                   AGSKVC"
FT                   /protein_id="YP_003958275.1"
FT   gene            complement(279417..280073)
FT                   /db_xref="GeneID:9882195"
FT                   /locus_tag="ELI_0294"
FT   CDS_pept        complement(279417..280073)
FT                   /locus_tag="ELI_0294"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825919"
FT                   /db_xref="GeneID:9882195"
FT                   /translation="MAVSKSKRGLKTQKLILQTAKEFFYEKGYEKTTIKEICEKIDIRT
FT                   GNLAYYYKTKDDLVKAIYDDLFLESYTFVSTHLEHKTSALERNTINSLVDFRARLRDKN
FT                   TTRFYLDNLKKKQLSLYLDNNLIRFVKQFITELKLDISEKELQDILYAEYGLRRELTIR
FT                   MIENPEENDFWDYFTTINIFRCRLYKIDENLMRAFLFNAMEFERKNDFSQIRLLI"
FT                   /protein_id="YP_003958276.1"
FT   gene            280318..281478
FT                   /db_xref="GeneID:9882196"
FT                   /locus_tag="ELI_0295"
FT   CDS_pept        280318..281478
FT                   /locus_tag="ELI_0295"
FT                   /gene_family="HOG000294981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825920"
FT                   /db_xref="GeneID:9882196"
FT                   /translation="MGERKFTESQAERIELFQDVYEGRIPKRVPVEVSVSWEAAIRYSG
FT                   LELKEAQWNTELYGVFFDKVCKEFNTDKSPIMPTLRNPVHYWLLGSKAIIMSESGYMQH
FT                   PEIYCLEPEEYDLFIEDPYQCMVEKLLPRLYEGLDAGKDEKALNLARAFHAKNRTGAVM
FT                   GATMAEMIEKYQFAAFPAGGMTEAPFDFLADFIRSFSGIAKDIRRYPEKVLKACDAVLP
FT                   HMQKLAVVPSSSRYSRTFIPLHMAPFMRPKDFDQFWWPTFKKLMDYIAEKNVGVKAFVE
FT                   HDWGDKIDHLGELGNRVEFQFEYGDPQKIKQTLGNKHIISGLYPITLLQTGTEKECTDK
FT                   AKALLDVLALDGGYIFNTDKTIYSLEGKIADNLKAVIETVKTYGRY"
FT                   /protein_id="YP_003958277.1"
FT   gene            281528..281674
FT                   /db_xref="GeneID:9882197"
FT                   /locus_tag="ELI_0296"
FT   CDS_pept        281528..281674
FT                   /locus_tag="ELI_0296"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825921"
FT                   /db_xref="GeneID:9882197"
FT                   /translation="MQPAYYHNYEEECKRRSSQLNSDDEFDASQYVQPYEEDLYRFIFS
FT                   LFL"
FT                   /protein_id="YP_003958278.1"
FT   gene            281699..283111
FT                   /db_xref="GeneID:9882198"
FT                   /locus_tag="ELI_0297"
FT   CDS_pept        281699..283111
FT                   /locus_tag="ELI_0297"
FT                   /gene_family="HOG000086794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium/sulphate symporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825922"
FT                   /db_xref="GeneID:9882198"
FT                   /translation="MQQDNKIKKQQIIGMLVSIAIVIIMYFMPAPADLGVAGWRTISIL
FT                   LVFLILLVTEAFPAGVICIITLILMPVLGAVPSIGDGFTGFANPVTFFILASFGISAAI
FT                   AKMPIAHRILLVIIRLLKGSTRGIIFGIMVCTALFSSMVSNIPTTAIFMGIALGFLDIF
FT                   EDEDEKKRTGKALMIAIPVSAMVGGVMTPAGSSLNLLVIGMLEQMTGITVSFVQWMVFG
FT                   IPLAIVILPAAWLIITKVYHPADMDPDRLKAYVNTLNTHDKMDIKEKFVILVTLIMLVC
FT                   WIASSWFPVFNVTMVALCGLFCLFLPKIGALTWDEFVKSVSWQVFFLVGTVLTLGTAIS
FT                   ANGIGNWLVASFMPEQMSITGPILIAICGFIGFAMLIVVPVAPAFIAVLAPAMISVAAN
FT                   CGYSPAILMIILGICAGNAYLLPLDTVPMITYSKGFYKMSEMPKSTALIQVILVVLMAV
FT                   WFPLAGSIVGFI"
FT                   /protein_id="YP_003958279.1"
FT   gene            283134..284306
FT                   /db_xref="GeneID:9882199"
FT                   /locus_tag="ELI_0298"
FT   CDS_pept        283134..284306
FT                   /locus_tag="ELI_0298"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825923"
FT                   /db_xref="GeneID:9882199"
FT                   /translation="MENKNSGYQKRLERCEKAIQRKVPDRVPVVANIYAWAENYYGYSV
FT                   KEVYDTKPELTYDVHSRLAKEFDFDAFFTMGNNVPIPATNALGGGHYIVTEKGLQVSNL
FT                   SCNVMNEDEYPLLAKDPAAYFRDYLLPRKYPVLNETGEKAYEALCEAFDKFGWYMKKTI
FT                   EANMRIEADGYPVLSNGAINHPLDSIMDFCRDFSGVMTDIRRHPDELKHAMESFNDFLI
FT                   HNSCDGYRKREDSAHFLFCATHIAPFLKPKDFEEFYFPYFRAQLDYAMNTCGYTVGVFM
FT                   EGNWEPYYELLQELPDNDGKLVCLQENGDCKKFKEKLGNKLCVCGGVPISLLAFGSEEE
FT                   VKDCVKRMIDDCAADGGFMISTDKGILTLGDAKPENIKAMIEAVKMYGTY"
FT                   /protein_id="YP_003958280.1"
FT   gene            284330..284467
FT                   /db_xref="GeneID:9882200"
FT                   /locus_tag="ELI_0299"
FT   CDS_pept        284330..284467
FT                   /locus_tag="ELI_0299"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825924"
FT                   /db_xref="GeneID:9882200"
FT                   /translation="MESTQKNNTVKELFERLKQEKTDSEMQEIERDKIMDKLIFILTKN
FT                   "
FT                   /protein_id="YP_003958281.1"
FT   gene            284515..284856
FT                   /db_xref="GeneID:9882201"
FT                   /locus_tag="ELI_0300"
FT   CDS_pept        284515..284856
FT                   /locus_tag="ELI_0300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825925"
FT                   /db_xref="GeneID:9882201"
FT                   /translation="MYTIFILFYLRRIKTFCISHKTCYNMKYTSRERNFKFGDKLKNRI
FT                   KELRKEKGLTQLQLADAVGVSTRTIISLEKGQYNPSIMLAYKIARLFGTTIEALYCLEE
FT                   NLKNEMENL"
FT                   /protein_id="YP_003958282.1"
FT   gene            284837..285262
FT                   /db_xref="GeneID:9882202"
FT                   /locus_tag="ELI_0301"
FT   CDS_pept        284837..285262
FT                   /locus_tag="ELI_0301"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825926"
FT                   /db_xref="GeneID:9882202"
FT                   /translation="MKWKIYSWMPWIRLVVLIICIGFSFFLVLSDLIENRAPQNQLWIL
FT                   CIIIPAGLEQVSRIMDARAGIVIYKDEREQYLKLEAGALAFRYAKIACVILLCLTAALN
FT                   YFTPSLLFIGIVLGLTIFLIVMYGMELIVYFYYEKIK"
FT                   /protein_id="YP_003958283.1"
FT   gene            285512..285793
FT                   /db_xref="GeneID:9882203"
FT                   /locus_tag="ELI_0302"
FT   CDS_pept        285512..285793
FT                   /locus_tag="ELI_0302"
FT                   /gene_family="HOG000087839" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825927"
FT                   /db_xref="GeneID:9882203"
FT                   /translation="MSYKKATHILPRELLEKVQEYIDGEFIYIPRISDNKKVWGASTST
FT                   RQELKDRNTNIYADYLAGASMEVLAEKYFLSLKSIQRIVGQLKKENNG"
FT                   /protein_id="YP_003958284.1"
FT   gene            285997..286548
FT                   /db_xref="GeneID:9882204"
FT                   /locus_tag="ELI_0303"
FT   CDS_pept        285997..286548
FT                   /locus_tag="ELI_0303"
FT                   /gene_family="HOG000294511" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825928"
FT                   /db_xref="GeneID:9882204"
FT                   /translation="MKKIIWKIEPLGLPLVLRHCKKCGKTSEFSCSGQFRVNAQRKYLD
FT                   IWLIYKCAKCDTTWNAAVYSRVSPQALNANLLEGFYSNEEGLARQYAMDFQFLKGNGAD
FT                   VLRPSCSVLGDIPASGEVSEVEIQSEYPFPVKVSTLVRDKLCLSQKDYLERVTEGKIRS
FT                   SAGQDLRKCRLKNGMVLIFQ"
FT                   /protein_id="YP_003958285.1"
FT   gene            complement(286684..287187)
FT                   /db_xref="GeneID:9882205"
FT                   /locus_tag="ELI_0304"
FT   CDS_pept        complement(286684..287187)
FT                   /locus_tag="ELI_0304"
FT                   /gene_family="HOG000136449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825929"
FT                   /db_xref="GeneID:9882205"
FT                   /translation="MLNQSQLILEMSDYLANDPRRIHHFLKVLGFAQVISSCEQLDPCT
FT                   ATILETAAIVHDIGSKISEAKYGQSNGKLQEQEGPAEARKVLESLDFPSNIIDRVCYLV
FT                   AHHHTYNTIAGLDYQVLIEADFLVNAYDHSLSPESIQSFGSRYFKTQTGKYLLERLYLK
FT                   DHRT"
FT                   /protein_id="YP_003958286.1"
FT   gene            287326..287445
FT                   /db_xref="GeneID:9882206"
FT                   /locus_tag="ELI_0305"
FT   CDS_pept        287326..287445
FT                   /locus_tag="ELI_0305"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825930"
FT                   /db_xref="GeneID:9882206"
FT                   /translation="MQKGFKEICWVEFSNYFIIKVMEINFYDLKNNFTKIKKS"
FT                   /protein_id="YP_003958287.1"
FT   gene            287622..288827
FT                   /db_xref="GeneID:9882207"
FT                   /locus_tag="ELI_0306"
FT   CDS_pept        287622..288827
FT                   /locus_tag="ELI_0306"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative ammonium transporter family"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825931"
FT                   /db_xref="GeneID:9882207"
FT                   /translation="MINFADTGFILVCAAMVCLMTPALAVFYAGLLRKGNIVDIMFQCF
FT                   IAMGIVTVLWFMGGFSLIFGDDVSGIIGNLEFAFLQNVSLAPSALWAPTIPFIAFFVFQ
FT                   LMFALVTPALICGAVAERMTLKSYMVFLTLWSLLVYIPVAHWVWGGGFLSQMGLADFAG
FT                   GTVVHMSAGFSALAAVLVIGGRKKRDYTPHNMVYVAIGAGLLWFGWFAFNGGSALAANE
FT                   IAAMTITNSQISAGFGLMTWIIASWIQEKHPSVLSAMMGALAGLVCITPGSGFVEPWAA
FT                   AIIGVAGTLCCYGMIQLRIKKNLDDTLDVFGLHGVGGTVGIIMTGIFASPAINAVTGAV
FT                   YGNPGQMLTQLAGAVIVMLYSFVLTIVMLKIISCFTPLRISEQLESVGIDEAYYQEKGM
FT                   VE"
FT                   /protein_id="YP_003958288.1"
FT   gene            complement(288893..290041)
FT                   /db_xref="GeneID:9882208"
FT                   /locus_tag="ELI_0307"
FT   CDS_pept        complement(288893..290041)
FT                   /locus_tag="ELI_0307"
FT                   /gene_family="HOG000243774" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative succinyl-diaminopimelate desuccinylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825932"
FT                   /db_xref="GeneID:9882208"
FT                   /translation="MHIINAQTLTQELVRIDSSDPGAYEGAISLKIVELLESAGVPVVK
FT                   EEVLPGRFNVMGKIKGEIDDPALIYICHMDTVTLGEGWSIPPLSAKIKDGRLYGRGACD
FT                   MKSGLACALSAFLKAAVSGKQPRHSFVFIGTIDEEYYMRGVEAAIASGWVTEKSWVLDT
FT                   EPTNGQIQVAHKGRTWFELTADGVTAHASTPWKGADAISAMAEMIVAVRKGIEATAPHH
FT                   DLGRSTVTFGQINGGYRPYVVPDHCTVTIDMRLVPPITTAAAESIVKSAICRAEKQIPG
FT                   VHGHYKITGDRPFVEKDGHSYLLKMLRESCAAVTGSPAQVSFFPGYTDTAVIAGKLNNH
FT                   NCLSYGPGDLELAHKPDEYVPLADIARCENVLTDLADRMLFV"
FT                   /protein_id="YP_003958289.1"
FT   gene            complement(290218..290877)
FT                   /db_xref="GeneID:9882209"
FT                   /locus_tag="ELI_0308"
FT   CDS_pept        complement(290218..290877)
FT                   /locus_tag="ELI_0308"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825933"
FT                   /db_xref="GeneID:9882209"
FT                   /translation="MAEKTEIRELLLEKAKISFYEKGYQKTSFEYLANECGVTKPTISY
FT                   YFKNKVNLANEVYSRYISTIRKLISERIMITYGTQDFLTVSAVQIRMLLEMYHQDKNAY
FT                   RFYHELINCGFTSFSVEPSLNYNRLIHQQYHLDIDENIDEVQLLTYAIRGAATSLVVAF
FT                   FDGNLNCTYEQFMKYRLTIVFKIMNLPETKIEQILEDADKIIQDLNFKIKPYFQIV"
FT                   /protein_id="YP_003958290.1"
FT   gene            291083..292477
FT                   /db_xref="GeneID:9882210"
FT                   /locus_tag="ELI_0309"
FT   CDS_pept        291083..292477
FT                   /locus_tag="ELI_0309"
FT                   /gene_family="HOG000166282" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Na+/melibiose symporter-like transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825934"
FT                   /db_xref="GeneID:9882210"
FT                   /translation="MKKPLSKTLKRFYGVGDFGFCMMTAAELSLFMLFLTDVAKFPLGI
FT                   VAAITTITGAVDAIISLFSGAIVNMVKPMKWGKIRSWLLICPPIVLMTFIFQFSKIGSD
FT                   ITAAVIVCLGFIISHAAWNLATVANVSLVPMLSSNEDDKIILTSRRGMFNNLAKVFFSY
FT                   IGPPLAIYLGFALHNEVTGYTILAGLCALLFCIGYFAHFKMTEGYEPTQEEIRKESNGE
FT                   KVKAKDLIRNFLTNYPLMVIILADTGRTLVNMLMSALAGYYYKYIAEDMGLFPLHLFIT
FT                   ACAAVLGAYFAKFIGKKLQAKMSCVILFAGITVFLVLGRVFYQNVPVFMFCLSMVQFCV
FT                   GGLQALTVVLYSDTIVYGEWKTGKNTASFIMGMIVVPSKISQILKGLIIASALAAAGFV
FT                   AGAAPTPELQVGIANAYIIFPATGALIASLLILFGFRLNSKKVAEMQQEIDERKCTSAV
FT                   KTEQIK"
FT                   /protein_id="YP_003958291.1"
FT   gene            292535..293680
FT                   /db_xref="GeneID:9882211"
FT                   /locus_tag="ELI_0310"
FT   CDS_pept        292535..293680
FT                   /locus_tag="ELI_0310"
FT                   /gene_family="HOG000294981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825935"
FT                   /db_xref="GeneID:9882211"
FT                   /translation="MIQQKINERQQLFNDVIDNKIPERVPVMGNIMYEAAIEYAGFDLK
FT                   QGQWDSEIAYKVFKKINEDFQTDAPCTSPTMRNPLFYQILGAKSYVMSETGVMQHPEIT
FT                   AMEPDEYDDFIKDPFKFMCDILLPRLYTELDTSPMQAAMVLAKAFKAKTDEDNIARKAS
FT                   REAAEPYEYAVIGGAGFGEAPFDFLSDLLRSFTGISKDIRRYPDKVKQACDAAVPLIEK
FT                   TLIPPKPMKYRYASVPLHMAPYLGDKSVNEFFWPSFEKLISRCVSAGQTLHLFMEQDWM
FT                   RFLDKLNELPGRMYMRFEYGDPQLTKKKINKHIITGFYPTVLLQTETKQKCIDKAKELL
FT                   DILAPDGGYIFNVDKNIMSLKGSVAENYRAVLEYVSLHGNY"
FT                   /protein_id="YP_003958292.1"
FT   gene            293690..293830
FT                   /db_xref="GeneID:9882212"
FT                   /locus_tag="ELI_0311"
FT   CDS_pept        293690..293830
FT                   /locus_tag="ELI_0311"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825936"
FT                   /db_xref="GeneID:9882212"
FT                   /translation="MFESEYYTTWEKYQEEHLNISDNACKTEKIQNYEEEMFKFIMMLF
FT                   L"
FT                   /protein_id="YP_003958293.1"
FT   gene            293842..295008
FT                   /db_xref="GeneID:9882213"
FT                   /locus_tag="ELI_0312"
FT   CDS_pept        293842..295008
FT                   /locus_tag="ELI_0312"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825937"
FT                   /db_xref="GeneID:9882213"
FT                   /translation="MLTKLQEYENRKADLIATTGHQEPQYVPVMLDVISWPIAYQKKKT
FT                   ADLIKDADLMVRTFTKTLREIYCDCITSAGIPYPLVALNILGGKGYFISEDEVTIQHTQ
FT                   NCTMEAEEYGELIRDTENFILNILPKRKFSNLNGSDNENYAVLKNAIMAFSKHMEAAGK
FT                   LSAALQNELGVVAVCGGRTKAACDTMFDRIRGFRETIFDMKRKPDELLTALEHVFEVYG
FT                   NPGLEKLRENGSTVPFPFTACHAVPFIRKSDFEKFWWPTYKKVVDPIIAEGGRIFMKSE
FT                   GRCGHILDVLKDCPKSSFILQLDMEDDPYKVYEKIGDHATIACGITTNQLKCLSKQECL
FT                   DIAKKAIDTFAPGGGFIFTTDKPLISENDVNPENLFAVYQFAHEYGKY"
FT                   /protein_id="YP_003958294.1"
FT   gene            295019..295141
FT                   /db_xref="GeneID:9882214"
FT                   /locus_tag="ELI_0313"
FT   CDS_pept        295019..295141
FT                   /locus_tag="ELI_0313"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825938"
FT                   /db_xref="GeneID:9882214"
FT                   /translation="MKEKTLDELLKELAEDASWECDPQKREKIVSAFRMILIEM"
FT                   /protein_id="YP_003958295.1"
FT   gene            295240..296514
FT                   /db_xref="GeneID:9882215"
FT                   /locus_tag="ELI_0314"
FT   CDS_pept        295240..296514
FT                   /locus_tag="ELI_0314"
FT                   /gene_family="HOG000281279" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825939"
FT                   /db_xref="GeneID:9882215"
FT                   /translation="MNPMYISLLILLAAVILYVCGKFSYLAISMSIPILLYLTGVLEIN
FT                   EIFVAFTNESVILAGCMFVISGSILSTGVAEDIGNYIIKYIKSEKSAVVIIMLATILMS
FT                   SFLSNIGTAMIMLPITLGVCRSAKYSPSRLLMPMAFACSLGGMNTTIGAPHNLLANSIL
FT                   EINEMQSLGFFELSKMGILFSIAGVLYFYFWGYKMLPVNGTIKETVTSNEKKSISPKTK
FT                   YRNKIFATVIFVFCILGFIFENRIKMPVHITAFIGMLLLLFFRVINEKEMVNMVDWSGL
FT                   SILAGMFPLVLALNKTGGVKLIADNLIKLGGETASPVIFTALIFIAAAGITQIMSNTAS
FT                   AALLYPIAIAVACGLNCNPKVIVIAVTVAASCAFITPIGTGSNTIVMASGGYQFKDYMK
FT                   IGLPLLLICFLVYIFFAPLIWPIYF"
FT                   /protein_id="YP_003958296.1"
FT   gene            296689..298041
FT                   /db_xref="GeneID:9882216"
FT                   /locus_tag="ELI_0315"
FT   CDS_pept        296689..298041
FT                   /locus_tag="ELI_0315"
FT                   /gene_family="HOG000277392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825940"
FT                   /db_xref="GeneID:9882216"
FT                   /translation="MEKQNDFTKGSISGNIMRLAFPMMAAQLINVLYSVVDRVYIGHLP
FT                   DASTLALTGLGLTFPIIMIITAFANLFGMGGAPLCSIARGKGDDRRAERIMGNSFAMLL
FT                   ISGVLLMIVCLIFKRPILYAFGASDQTFPYADDYVEIYLCGSLFVMIGLGMNSFINSQG
FT                   FAKTGMMTVALGALVNILLDPVFIFIFGLGVRGAALATVLSQLLSALWVLRFLTGKKAI
FT                   YRLSLKSMRLDFSLIGEISGLGLSGFIMSVTNSAVQIVCNASLQFYGGDIYVGVMTVLN
FT                   SIREVLTMPVQGITNGAQPVLGFNYGAGAYGRVRKGIQFTAIIGVAYTFIAWLILMLTP
FT                   QAFIHIFNSEPELIRLGVPALYIYFFGFFMMVLQFSGQTVFIALGKSKQAIFFSLLRKA
FT                   IIVIPLTMFLPTVFGLGVNGIFLAEPISNFIGGAACFITMMVTVWSKMKEE"
FT                   /protein_id="YP_003958297.1"
FT   gene            298225..299010
FT                   /db_xref="GeneID:9882217"
FT                   /locus_tag="ELI_0316"
FT   CDS_pept        298225..299010
FT                   /locus_tag="ELI_0316"
FT                   /gene_family="HOG000247878" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825941"
FT                   /db_xref="GeneID:9882217"
FT                   /translation="MNVAVCIKQVPAVSEIKLEKGTNRMLREDVPAVVNLCDKNALEEA
FT                   LRLREKHGGRVTVLTMGPPQAEEALRECVGMGADEAVLLCDDALQGSDTLATSRVLAAA
FT                   VEKLGGYDLVLCGKQASDGDTGQVGPGIAERLDWAQVTYVNRLKVEDYVLTAERENRDG
FT                   VEILQTALPTVCTITEKAHAPRHPSIKGKMKSKSVEIRTLSAEDIGLTPDDVGFKGSAT
FT                   QVAGTFSPAVLDTGVRIDAKDGQKGAKVLFETLESLGVW"
FT                   /protein_id="YP_003958298.1"
FT   gene            299023..301362
FT                   /db_xref="GeneID:9882218"
FT                   /locus_tag="ELI_0317"
FT   CDS_pept        299023..301362
FT                   /locus_tag="ELI_0317"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-coa dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825942"
FT                   /db_xref="GeneID:9882218"
FT                   /translation="MKENAIWIFIEKEEEQIRRVSLELLSKGKKLKHEDGELVAVVFGY
FT                   LSCDMTTELSGYGADIILNVPGDGYEIYSTDTYTDAMEALIRRYTPNLLLVGATHNGRD
FT                   LCGRLATRLELGLAADCTEIELEENNAATFIRPAYDGKEFAKITMATRPQIGSVHSGIF
FT                   AKGLPVEGLKAEVIEEDIPIKESALRVKLLEYVEAVSKVADDLEEADIVVAGGRGLGGP
FT                   EGFDVIRELADALGAAVGASKPTVEDGWIDIEHQVGVTGKRIHPKLYIACGISGAVQHT
FT                   MGMKDSDIIVAINNDPEAPIFKIAHYCVVGDLFEVVPALAGMIREKRQLRSPAERSQNP
FT                   TDTQAAYFEEKASKDQEHQTPEIEKKEETAAVPLERGPKREIKKINTVDKTHTDEEEET
FT                   MNFELSKEHQELREMFREFAQMEVKPIAKDLDEKERFPEETIPKLAEAGMLGIPFPEEY
FT                   GGAGMDNLAYAMCVEEISKVCGSTGVIISAHTSLCAWPIFAFGTEEQKRKYLVPLAKGE
FT                   HLGAFGLTEPGAGTDAAGQKTTAVLEGDHYVLNGSKIFITNGGKADTYVIFAMTDITKG
FT                   NHGITAFIVEKDFPGFSIGKKLDKMGIRGSSTTELIFKDCIVPKENLLGEVGKGFKIAM
FT                   KTLDGGRIGIASQALGLAQGAIDETIPYVKGREQFGQPLSAFQNTQFQLANMIARAEGA
FT                   RLLVYQAACAKDAGKPYNHLAALAKLVASEVARDVTCEAVQLFGGYGFTRDYPVERMMR
FT                   DAKITEIYEGTSEVQRMVISSWAGVK"
FT                   /protein_id="YP_003958299.1"
FT   gene            complement(301450..302391)
FT                   /db_xref="GeneID:9882219"
FT                   /locus_tag="ELI_0318"
FT   CDS_pept        complement(301450..302391)
FT                   /locus_tag="ELI_0318"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825943"
FT                   /db_xref="GeneID:9882219"
FT                   /translation="MVIRRYNRIQNLNEEGISMFGECHAHMIMDGVCFREAAAKHRNGP
FT                   DEALIRQVLSAYQKRNVLFIRDGGDNLGVSRLAADLAQEYGIDYRTPVFAIHHRGYYGG
FT                   IVGFAYDSLKEYARLVQKARSYRCDFIKIMTAGIMDFDHAGRLSCPGLPGQEVAEMVRI
FT                   AHSEGYSVMTHVNGADHIKVALEAGVDSIEHGNFMDAECLSLLKETGAVWCPTIAITGN
FT                   IIGSGRYNDTVLTSIHERQLANIQRAFDLGAAVALGSDAGAFRVTHPRGVFDEYGYFRQ
FT                   AVPDQAFLDARLAEAEATVRERFKAGGIIMEN"
FT                   /protein_id="YP_003958300.1"
FT   gene            302466..303104
FT                   /db_xref="GeneID:9882220"
FT                   /locus_tag="ELI_0319"
FT   CDS_pept        302466..303104
FT                   /locus_tag="ELI_0319"
FT                   /gene_family="HOG000248344" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HPr(Ser) phosphatase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825944"
FT                   /db_xref="GeneID:9882220"
FT                   /translation="MDYKAYLFDFDYTLANSEKGIVMCFQHVFERNGFKGIEEDAIKKT
FT                   IGLTLEEAFMLLTGIKDRETVAGYRKQYVEKSDEVMVANTKLFPEALPMLRKLKKQGVK
FT                   TGIISTKYRYRIESTIRLYGMDELIDLVIGGEDVETAKPSPEGVWKALDRLKCGREETL
FT                   YIGDSLVDARTAQNAGVHFAAVTTGTTTAADFETVPHVSVMENLSELVK"
FT                   /protein_id="YP_003958301.1"
FT   gene            complement(303136..304431)
FT                   /db_xref="GeneID:9882221"
FT                   /locus_tag="ELI_0320"
FT   CDS_pept        complement(303136..304431)
FT                   /locus_tag="ELI_0320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825945"
FT                   /db_xref="GeneID:9882221"
FT                   /translation="MMSGTFCQSFLRASLSLLCTIGLIFVMTEFRYSRRKCFLIIFFFF
FT                   VAAMTINGIILYAAGLDVLFRYFLFTTTLPCVILLAVLAKDDIFKAQFNFWTQINLFFA
FT                   IVILSYYGTQALGGGFYTELLLRLLLYGGVFLLYTRYLRKPFRLFAKSLETGWILISFV
FT                   PALFCTVIISLVLFPTIFYERPQVLPTLGLVYLTMFGVYAVIFITFQRSYELTSARREA
FT                   EFLGLQINLQKRQFDTQQQKMEVIRMYRHDMRHHIGIIIAFLQDGHPEKAEAYSRQIQS
FT                   MIDETSYYQFCENYLVNTLVSLYTDLAMTKGITICSDLSIPRELFVEDTDLCVIFSNAL
FT                   ENALNACSKLPASDERSIDLICRKYPDKLVIEISNSFNGQAEFNEEGLPVSHDEHHGIG
FT                   TQSIAFIVKKYSGILHYKTENRLFTLQILLNH"
FT                   /protein_id="YP_003958302.1"
FT   gene            complement(304428..305174)
FT                   /db_xref="GeneID:9882222"
FT                   /locus_tag="ELI_0321"
FT   CDS_pept        complement(304428..305174)
FT                   /locus_tag="ELI_0321"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825946"
FT                   /db_xref="GeneID:9882222"
FT                   /translation="MIKIAICDDQPDELAELAAIIKNYCKSRQKTISLDCFQSSHALLD
FT                   TVEGQNHFDILILDIILPEMDGIALAKALRTIDDESTIIFLTTSPDYALKSYEVNAFQY
FT                   LLKPLDRQKFYDILDKLLDRLTLTQTQRLVITTPQGIQSLKAYDITYVEHISHVLYIHK
FT                   KDGAAIATANSTITLTELENHLNDPGCFLRPHRAFIVNLHAISTLNSDSFILEDGTIIP
FT                   IAGRRYTAVKEQYLNFLLHNKGGLLL"
FT                   /protein_id="YP_003958303.1"
FT   gene            complement(305257..306855)
FT                   /db_xref="GeneID:9882223"
FT                   /locus_tag="ELI_0322"
FT   CDS_pept        complement(305257..306855)
FT                   /locus_tag="ELI_0322"
FT                   /gene_family="HOG000036732" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="L-serine dehydratase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825947"
FT                   /db_xref="GeneID:9882223"
FT                   /translation="MTNYKTSIFNDVLGPVMTGPSSSHTAGPGRIGYFTGSLMPDFKSV
FT                   QLIFPKSSSYATTYKGQKSDIAFAAGLLGLPLNHPDFKNSLRRLKEKSIGFDICLTDTA
FT                   CEHPNTCDLVLGGPSGRLCVTSLSIGGGMFCITALNGAPVDFKGDCPVLAGFYTTETQG
FT                   ALRTFLETLPPAIADTKSLICGTGFYALPLKASTSPDEIKRLIKTAPETLRYIPAILPV
FT                   PTPAQAALPFSTSGALTAFLDKNPMPLWQAAVEYEAARSGWAAEKVLSYSKMLVKTMHQ
FT                   SISFGLLDASNGESLTNRSARSMAAAASAGRLLSASPYQNGAVYSTAVMEASNAMGVVV
FT                   AGPTAGSCGVLPGVLFALLQETGIPPSFPPVLPEKALEQAAKALLCAGIIGVFIAEQAT
FT                   FAAELCGCQAENGAASAMAAAMAVSLVNEDPILSLRAASTALQNVLGLICDPVACRVEI
FT                   PCISRNAMSVSNALTSAEMTLGGYDSQIPLDQTIETMYRVGRQLPSELRCTGNGGLCLT
FT                   PAALAMAKNAGQPHE"
FT                   /protein_id="YP_003958304.1"
FT   gene            307007..308164
FT                   /db_xref="GeneID:9882224"
FT                   /locus_tag="ELI_0323"
FT   CDS_pept        307007..308164
FT                   /locus_tag="ELI_0323"
FT                   /gene_family="HOG000296240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825948"
FT                   /db_xref="GeneID:9882224"
FT                   /translation="MEYRRIKGIETPVSVIGFGGVYLEGMPGEKIIEMIHHAMDLGVNL
FT                   LDLYMPQPEIRDAIGEAIRTHPGKMMIQGHLCTVCGGDGQYIRSRNLEEVKRSFEDMLD
FT                   RLKQDHVDFGIIHFLDSEKDCEAVEKSGILEYALDLKSHGVIRKLGFSSHNAVTAMKQV
FT                   ETGLYEMLMFSLNPAYDLDHGQREVEDIMEFRGVSVDERALGIAPARIALYQLCEALGI
FT                   GITVMKALAAGRLLSAESSPFGKAMTPAQCYHYALDRPGVVSVLPGLSTLHEIDEAAAY
FT                   CQSTEAERDYSAIAEAPSFQMQGQCMYCNHCQPCPMGIDVAAVTKYLDVAREHGGRLPG
FT                   ATAEHYKALAVHASDCIECGSCLKRCPFGVDVVVNMQEARRIFGL"
FT                   /protein_id="YP_003958305.1"
FT   gene            complement(308235..309002)
FT                   /db_xref="GeneID:9882225"
FT                   /locus_tag="ELI_0324"
FT   CDS_pept        complement(308235..309002)
FT                   /locus_tag="ELI_0324"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825949"
FT                   /db_xref="GeneID:9882225"
FT                   /translation="MFDLTDKVAVVTGASSGLGADSARAYAQNGANVVLLARRKEKLEQ
FT                   VAAEISGMGRKVLVISCDVTDEECVKKAVEEIIEKFGRIDILLNNAGVAVRGGVDTLTV
FT                   EDWDHAMDVNVKGMFIMSKYVVPHMKEQNYGKIVNISSVNALIGDKADMFIRHSYNASK
FT                   SAVLGLTIGMAASYGQFNITVNAVCPGLFESEMTKDTLFKSEAFLQGYSAQCPMSRPGK
FT                   RGEVSGPVLFFSSDASSYVTGQHIVVDGGTSIV"
FT                   /protein_id="YP_003958306.1"
FT   gene            complement(309089..310924)
FT                   /db_xref="GeneID:9882226"
FT                   /locus_tag="ELI_0325"
FT   CDS_pept        complement(309089..310924)
FT                   /locus_tag="ELI_0325"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycerophosphodiester phosphodiesterase
FT                   (glycerophosphoryl diester phosphodiesterase)"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825950"
FT                   /db_xref="GeneID:9882226"
FT                   /translation="MKSKNIQNTLIAFIQTFPALLAFEVVYKILCSVLLKPLLSFIMQI
FT                   FLNLSGYSLAFNERILNFFTNIPGVITLIIMLALGALMVYYEFSVIILMLYHRLHKNPI
FT                   RLGTAMKMALTTYKSLENFGSVGFTAYALGLLPLIHIGLRPSLLPQTRIPNFITGELSK
FT                   TLLGNIGVYLFYVVIFVLFVILLFVLPAMVLDRVSFMKASRRSFSILKKGRLPDALALG
FT                   IYLILWIVLFNFPGFVPTYFPGISGNGPFTVFLSLFSGNMFAPLMGFLLAGLLRITLIL
FT                   LLLTILTAGYSRLDGRVNIDGEALPFIDERLGHTKEKAMSFFHISRHTAKSAWTHIKAH
FT                   PFFIKHQKPIALGVVILAAVGMFSLFYNPPALHSPIVIGHRGSSEGVENTLGSIQGGID
FT                   QGADYAEIDILLSKDNVPMVIHDSNLQRLSGENVNVYDLTAKELGELTLFQNDAKGKIS
FT                   TLEEVIKATKGQIKLLIELKTHGHETADVAAETAKVVEAQNDEKNCMFMSLDYSLVEQL
FT                   KTLHPEYTVGYCVYGNLGKADTRRLVNMDIDFLTVEENMVTKSLISKARKAWLPVYVWT
FT                   VDESKAMRQYLDLGVLGLITDKPAAGREVIDQQNP"
FT                   /protein_id="YP_003958307.1"
FT   gene            311014..311187
FT                   /db_xref="GeneID:9882227"
FT                   /locus_tag="ELI_0326"
FT   CDS_pept        311014..311187
FT                   /locus_tag="ELI_0326"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825951"
FT                   /db_xref="GeneID:9882227"
FT                   /translation="MEDVREVYYHLEGIAENLGIPADNAVLRELYFKDVKLSAFPFNGK
FT                   SLQQFSRDSTAY"
FT                   /protein_id="YP_003958308.1"
FT   gene            complement(311138..311467)
FT                   /db_xref="GeneID:9882228"
FT                   /locus_tag="ELI_0327"
FT   CDS_pept        complement(311138..311467)
FT                   /locus_tag="ELI_0327"
FT                   /gene_family="HOG000244138" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylated-DNA/protein-
FT                   cysteinemethyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825952"
FT                   /db_xref="GeneID:9882228"
FT                   /translation="MSVSLNEKFYRVIANIPEGRVATYGQVALLAGRPRAARAVGAALR
FT                   HVPAHLELPCHRVVFSDGSLCKGLIFGGPGIQEQLLKKEGVAFLPNGKVNMRCCLWKIA
FT                   EDFSH"
FT                   /protein_id="YP_003958309.1"
FT   gene            complement(311566..312501)
FT                   /db_xref="GeneID:9882229"
FT                   /locus_tag="ELI_0328"
FT   CDS_pept        complement(311566..312501)
FT                   /locus_tag="ELI_0328"
FT                   /gene_family="HOG000226771" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative nitrite and sulfite reductase subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825953"
FT                   /db_xref="GeneID:9882229"
FT                   /translation="MNIAPEEIKRVKGQGFLFNNDHEHFAARVITEDGVLNAAQFACLS
FT                   EAAEKFGNGNIAFTTRLTVEVQGLTWDDIVPFQEFIAKEGMVTGGTGPKVRPVVACKGT
FT                   VCTYGLIDTQGLAREIHERFYEGYRDVTLPHKFKIAVGGCPNNCVKPDLNDLGIVGQKI
FT                   PNYNDALCKGCSKCSVEDRCPMDAATVTDGKLVIDEEKCNNCGLCVDNCRFDAIPDGEV
FT                   RYKVYVGGRWGKSIRRGTELKTLFTRGEIMDVVEKAILLYKKEGQNSERFGSTVERLGA
FT                   EAVERALTTNDLLDEKDNILGIATVSGATC"
FT                   /protein_id="YP_003958310.1"
FT   gene            312648..313526
FT                   /db_xref="GeneID:9882230"
FT                   /locus_tag="ELI_0329"
FT   CDS_pept        312648..313526
FT                   /locus_tag="ELI_0329"
FT                   /gene_family="HOG000233518" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR substrate binding domain family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825954"
FT                   /db_xref="GeneID:9882230"
FT                   /translation="MTIRHLKVFLAVAETGKMSAAADQLFIAQPSVSQAIADIEKYYNV
FT                   RLFERLSRKLYITPAGERLLDYARHIVALFDEMELEMKYSTEHTTLKIGGTVTVGTTIL
FT                   SELVSRFEAENPPVTLTVLVDNTPVIESMILKSDLDLGLVEGEVSSEDLIQIPAVEDEM
FT                   VLICGTGHPFAGRKTISLDELQGQYFVIREKGSRARSFFEKILDRESVEIVEKWTCTNT
FT                   EAIKNAVMDGQGLAVLSKRLVERDFEQGRLCILSIQGIRLLRSFTLIYHKNKFLSPPLK
FT                   AFVQACEEYKD"
FT                   /protein_id="YP_003958311.1"
FT   gene            313780..314469
FT                   /db_xref="GeneID:9882231"
FT                   /locus_tag="ELI_0330"
FT   CDS_pept        313780..314469
FT                   /locus_tag="ELI_0330"
FT                   /gene_family="HOG000289069" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="microcompartments protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825955"
FT                   /db_xref="GeneID:9882231"
FT                   /translation="MIINNTEILKKGVQKMTGDLLKAHVLSSKLMTDIEDIMIEEFGLP
FT                   EGHIDIGLFTTDNEDIGYVAADEATKKANVQVCYAKSTYGGLGCAYGGEMIGIISGPSI
FT                   SDVESGLRTITHFTEHNACLFSAREDDGVQFYAQVISKIGTYLAEVCDLPVGSSVAYLV
FT                   GPPLESMMGVDEALTAADVEVVKFFGPPTVSNRGGAIVTGTQSACKTACMAFAKMVMDC
FT                   VEEPVDY"
FT                   /protein_id="YP_003958312.1"
FT   gene            314811..315230
FT                   /db_xref="GeneID:9882232"
FT                   /locus_tag="ELI_0331"
FT   CDS_pept        314811..315230
FT                   /locus_tag="ELI_0331"
FT                   /gene_family="HOG000095927" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825956"
FT                   /db_xref="GeneID:9882232"
FT                   /translation="MAYTITEKCIGCTICARNCPVMAITGEKKKQHVVNDKRCIDCGVC
FT                   GRSCPQAAILDNRGEITNKEPKDQWKKPMIEPAVCSACSMCVDGCRFGCLAISMPAFKG
FT                   DIRVYADLVKPKACVGCGLCESLCPLSAIRMEVIQ"
FT                   /protein_id="YP_003958313.1"
FT   gene            315227..317119
FT                   /db_xref="GeneID:9882233"
FT                   /locus_tag="ELI_0332"
FT   CDS_pept        315227..317119
FT                   /locus_tag="ELI_0332"
FT                   /gene_family="HOG000014651" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825957"
FT                   /db_xref="GeneID:9882233"
FT                   /translation="MKPLNYLHINLSTGKIRPLPIKEGVVRAYLGGKTLAAKLLYDLLP
FT                   KGVDPLSKENILIINTGIMTDTGAPSSSRFNMTFKNVMTGGIASSNCGGSFGMMMRRAG
FT                   VDGLILVGGAEKPVYLEILDGEVTIRDAENLWGLDAEAVQERFPKIYGKVVIGPAGENR
FT                   VRYACAVSGERVAGRCGCGAVMGVKNLKGIVAYGTKRPELYNKPAFDAYVKKWVKFIQN
FT                   HPMTGDSLPHYGTAGLVNNANASHALPTHNFKRGQFEAAEEICGETLADKYLTRNSGCV
FT                   SCPIRCERRVMVDGREVKGPEFETVGLFGSNIENSNLELINEINYKADILGLDTISLAG
FT                   TLAFAMELQEREMADFGLRFGETGNLLEIIEKIAYRQDIGDELAEGSARLAQKYGGADF
FT                   AINAKGMELASYEPRRSVGMGLGYATSNRGGCHLNGGYLALMESVGVMSVGAQGTKGKP
FT                   ELTAFMQNGMEAGSAAGFCLFTMQTMIPSILYHMGPVSPVTHTAGKAMIMARGVLGNMW
FT                   PLMPGLLPVKTMYLMPHCKAIELATGMRMTTGEFLQVGERGFTIERLFNLREGLTAEND
FT                   SLPGRLTDELQEPTDPSTRVDLETMLPVYYKVRGWDERGVPTWPTLKRLGLGSL"
FT                   /protein_id="YP_003958314.1"
FT   gene            317116..317364
FT                   /db_xref="GeneID:9882234"
FT                   /locus_tag="ELI_0333"
FT   CDS_pept        317116..317364
FT                   /locus_tag="ELI_0333"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825958"
FT                   /db_xref="GeneID:9882234"
FT                   /translation="MITVKYFGALRALTGTAQESLEAANIKEVLAKIKAAHGKEAAAKA
FT                   KRCLILLNSDNVNLHNGMRTGLKPSDVVTFVPVCAGG"
FT                   /protein_id="YP_003958315.1"
FT   gene            complement(317382..317576)
FT                   /db_xref="GeneID:9882235"
FT                   /locus_tag="ELI_0334"
FT   CDS_pept        complement(317382..317576)
FT                   /locus_tag="ELI_0334"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825959"
FT                   /db_xref="GeneID:9882235"
FT                   /translation="MEPIYPTDIYEYLPHSNCKRCGEDNCMAFADKLSKNEANLSSCAP
FT                   LRLPEQERNRKAVEKLLNG"
FT                   /protein_id="YP_003958316.1"
FT   gene            317678..318349
FT                   /db_xref="GeneID:9882236"
FT                   /locus_tag="ELI_0335"
FT   CDS_pept        317678..318349
FT                   /locus_tag="ELI_0335"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825960"
FT                   /db_xref="GeneID:9882236"
FT                   /translation="MKRWTTSGGITIERLNTLRCNCYVIQCAGAVYLVDTSVVMERQSI
FT                   ERQLKKLGISGLDGIILTHVHTDHVGNAACFQKKFNCLVYVHAHERTALRDGCCPLPQG
FT                   TLPFTKKVVSVAGALGLWTCFEPCRNVMAVENGQYIGPGLRVLHTPGHTKGSMSLILNE
FT                   DIALVGDAIIHRNKQVYPPFANDERQVKNSLQKLLETNCQQFLPGHGAVAGRENILSAL
FT                   L"
FT                   /protein_id="YP_003958317.1"
FT   gene            318484..318846
FT                   /db_xref="GeneID:9882237"
FT                   /locus_tag="ELI_0336"
FT   CDS_pept        318484..318846
FT                   /locus_tag="ELI_0336"
FT                   /gene_family="HOG000276043" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenical resistance operon trans-acting
FT                   repressor ArsD"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825961"
FT                   /db_xref="GeneID:9882237"
FT                   /translation="MKVLELFEPAAIDVSDEDARMDAVIQALVNAGETVKRYDIIGMKK
FT                   DFAENEMVENLLDAEGPEVLPITLIDGVLVKQGGYPSNTEIANWFGITEDTIAACCRAS
FT                   GKGCGSCGGCGGKHES"
FT                   /protein_id="YP_003958318.1"
FT   gene            318836..319321
FT                   /db_xref="GeneID:9882238"
FT                   /locus_tag="ELI_0337"
FT   CDS_pept        318836..319321
FT                   /locus_tag="ELI_0337"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825962"
FT                   /db_xref="GeneID:9882238"
FT                   /translation="MKVKKKLFMSTVAVLVTSLVLAGCGSKDGPAGKAEYLGFLGSQFT
FT                   SMTTTVQNIQDKLSGFTEDSLSDSAWVSDMDKQLDQVDKACDAIIGYDKVPQNYVDLHS
FT                   KLTDVANQLKPAVAKYKTGIENKDYDALSSANEQVKTAAASLESYIPELKNLLGSQN"
FT                   /protein_id="YP_003958319.1"
FT   gene            319447..319875
FT                   /db_xref="GeneID:9882239"
FT                   /locus_tag="ELI_0338"
FT   CDS_pept        319447..319875
FT                   /locus_tag="ELI_0338"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825963"
FT                   /db_xref="GeneID:9882239"
FT                   /translation="MFFKNISIIYRHSEILFQKRLGGMQLNNTEQSILLYLKHNDGVNQ
FT                   HAIARFFQFNKTTVAKTLSALEDMGLIKRETNCESKREKRVYLTEAGNKAVVLIKESRR
FT                   QLEEEVMAEFTEEEKALFDELSERIAVKVWKLNQESDG"
FT                   /protein_id="YP_003958320.1"
FT   gene            319922..321280
FT                   /db_xref="GeneID:9882240"
FT                   /locus_tag="ELI_0339"
FT   CDS_pept        319922..321280
FT                   /locus_tag="ELI_0339"
FT                   /gene_family="HOG000072914" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825964"
FT                   /db_xref="GeneID:9882240"
FT                   /translation="MVNDMTRGKPAKILMVFMLPMLLGNIFQQLYNIVDTVIVGNYVGA
FT                   DALAAVGSTAAMVFLLVAVAMGLSMGCSVLISQYFGAGDKKNMRRAVFTSMVFILAVGA
FT                   LVCVLGLAISDWLLHLIQTPANIFEGASTYINIYYMGCIFLFTYNGLAAICRAVGDSKT
FT                   PLYFLIVAALLNIVLDLVFVIYFNMGVAGVAWATLIAQGVSAVTCLIYVYFKVPVLKLH
FT                   REDCVFDFKMLKDLLAYAIPSTVQQCIVSFSMMAIQGLVNSFGSVFIAGYTAATKIDSI
FT                   AIQPLLSVTMSLSTFTAQNIGAGRTERVYEGFKVTILIVVIMCLAISGLIFLFGDVFIG
FT                   AFVDSVADAGVIQVGVEYIRIVSVFYVVMGLMFSAGSVLRGAGDATAFMMGSLSNFVVR
FT                   IAAAYILAGMIGSSAIWWSIPMGWGVGLLVNYIRYRSKKWENKAIISKKQVEA"
FT                   /protein_id="YP_003958321.1"
FT   gene            321397..321849
FT                   /db_xref="GeneID:9882241"
FT                   /locus_tag="ELI_0340"
FT   CDS_pept        321397..321849
FT                   /locus_tag="ELI_0340"
FT                   /gene_family="HOG000010070" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825965"
FT                   /db_xref="GeneID:9882241"
FT                   /translation="MKNHLSMNLTALRKMNQYTQEEVASRIGVSRQAVAKWENGESAPD
FT                   VINCNALAEMYNVSLDDLVNYNEKEKDGLAIPPKDKHMFGCVSVGERGQIVIPKKAREI
FT                   FDIKPGDRLMVLGDEDPERAGIAIVKEDVFMELAAQIMDAVKRGEE"
FT                   /protein_id="YP_003958322.1"
FT   gene            321850..322608
FT                   /db_xref="GeneID:9882242"
FT                   /locus_tag="ELI_0341"
FT   CDS_pept        321850..322608
FT                   /locus_tag="ELI_0341"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825966"
FT                   /db_xref="GeneID:9882242"
FT                   /translation="MNLLSVKNLSKKYPAFELKEVSFNVKQGSIMGFIGKNGAGKSTTL
FT                   KAMLNMVHPDSGTIEMLGKDFNQNEAWCKQNIGVVLGGIDYYPKKKLKTITKVTSRFYE
FT                   KWDDEKYQQALKLFELDERKTVDQLSAGMRVKYLIALALSHHARLLIFDEPTSGLDPVS
FT                   REDLLMLFEKLVQSGDRSILFSTHITSDLEKCADTITYIKDGTILASEDREAFVRHFQY
FT                   LKDNESDPELSLEDIMVHMERKKYDESIAL"
FT                   /protein_id="YP_003958323.1"
FT   gene            322586..323230
FT                   /db_xref="GeneID:9882243"
FT                   /locus_tag="ELI_0342"
FT   CDS_pept        322586..323230
FT                   /locus_tag="ELI_0342"
FT                   /gene_family="HOG000148046" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825967"
FT                   /db_xref="GeneID:9882243"
FT                   /translation="MMRALLYKELLLTSLPPMFIFMFFGAMLMIPGYPYYVPFFFGCLG
FT                   LFFTFQNGRENKDTFYTAALPISKGDVVRARCLLVVLVELGEVLISVPFAVLRAYVLPP
FT                   NPVGIEPNPAFYGFVLIMFTIFNVIFLTQFYKTAYNVGKAFIIAQIPLWLYIIVMEALV
FT                   HFPASGTYLDTTNPSMMLRQLPVLAAGIVIYILGMFVACRVSIRRFEKVDL"
FT                   /protein_id="YP_003958324.1"
FT   gene            323255..323431
FT                   /db_xref="GeneID:9882244"
FT                   /locus_tag="ELI_0343"
FT   CDS_pept        323255..323431
FT                   /locus_tag="ELI_0343"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825968"
FT                   /db_xref="GeneID:9882244"
FT                   /translation="MSPSFQTVKSAAAGDCAFYPDKKKSSGALNNGQKSCKIIRPAGHW
FT                   RDEVSTLVKQISV"
FT                   /protein_id="YP_003958325.1"
FT   gene            323589..323882
FT                   /db_xref="GeneID:9882245"
FT                   /locus_tag="ELI_0344"
FT   CDS_pept        323589..323882
FT                   /locus_tag="ELI_0344"
FT                   /gene_family="HOG000077974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825969"
FT                   /db_xref="GeneID:9882245"
FT                   /translation="MKEIISCCGVVCTSCEYYPETCAGCPAIEGKAFWLEYTGGDVCGI
FT                   YECCILERKQSHCGKCRELPCRRYFDTPDPTKTPEENKADFRRQMEQLKRME"
FT                   /protein_id="YP_003958326.1"
FT   gene            323885..324085
FT                   /db_xref="GeneID:9882246"
FT                   /locus_tag="ELI_0345"
FT   CDS_pept        323885..324085
FT                   /locus_tag="ELI_0345"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825970"
FT                   /db_xref="GeneID:9882246"
FT                   /translation="MKIRKMQFFDMQSDIGKALLGALEKQAKERRCTQIILVTEENRKD
FT                   ACRFYEANGYQEDNAGYKKKL"
FT                   /protein_id="YP_003958327.1"
FT   gene            complement(324095..325504)
FT                   /db_xref="GeneID:9882247"
FT                   /locus_tag="ELI_0346"
FT   CDS_pept        complement(324095..325504)
FT                   /locus_tag="ELI_0346"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825971"
FT                   /db_xref="GeneID:9882247"
FT                   /translation="MKKSDHDPEYSAYLNSLPREMLLSILENCYNEIFVNDRDGRIVYV
FT                   NPACIRHYGLKPEDLVHAKNADVFQGNWTPMALDYAIDEKRIIFAKQRFIPAGEELVTI
FT                   LTPVLDEAGNIELIIGNVQENEITHWDVSYKDDDLKTSRRHKSSHFNSNETPIISRSFN
FT                   YWKIITELKQVSDSTIPVLLLGESGTGKTYVAEYIHENSGRDGLFITLNCTAIPESLLE
FT                   SELFGYAPGAFTGASSKGKIGLIEMASNGTLFLDEIGDLPLYLQAKLLDVLENQRYIPV
FT                   GGTKMEYVNIRIITATNKDIDTLVKEGKFREDLYWRISTFNTILPPLRKRRDDILPLSN
FT                   FFLKLFNEKYEKNKTFSQEVLSAFMRYSWPGNVRQLKNMIERLVVVTMGNIIDLQKLPE
FT                   TMLRENHNTPDNSALTLDERVEALKKDIVRDAYRKNQTVRRAAAALGITASKAQRLIKE
FT                   YCGDLQKENEG"
FT                   /protein_id="YP_003958328.1"
FT   gene            325790..327250
FT                   /db_xref="GeneID:9882248"
FT                   /locus_tag="ELI_0347"
FT   CDS_pept        325790..327250
FT                   /locus_tag="ELI_0347"
FT                   /gene_family="HOG000250777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trimethylamine methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825972"
FT                   /db_xref="GeneID:9882248"
FT                   /translation="MIRNSLTDVFFTKDDVENLHEGVLRVLSEVGVKIENDEALEIFKQ
FT                   HGARVEDGTVYIGEALLNKALETVPANFELQGFDRTVQVGLDHDPVVIPTNGTPLVLNF
FT                   DGSYSDTNTDDLVNFYKLIDTSDVMQVTSEIAVDVPGLDKTKDSLLAQTALLMKYSHKP
FT                   IYNILGATIHNYKKGSVAQGVRENIQFAKKYYGYDDKYVIYSGTCVISPLGVGWEAMDH
FT                   FMGFIKENQPISITACSMTNLTAPGSLYGSVVEDAAAILSIVVLSQLMNPGLPVLYTSL
FT                   SSMSDMRYVQLCMGAPEFALITLGHIALANFYKIPVRVGGALGDAFKTDYQAGVESFVG
FT                   LMAPMLSQAAMIPHGCGTMGSFNLTSYEKFIMDEETIRYLMRLRRGFEVSDKRKEKALK
FT                   DITKVGPRGNFLGGRTPKEYREDNYLASEVFNRKGCKENTREEQGDIRDRAKKVYDARM
FT                   EAYELPDTTLEQKKLLNTELPEQYKFDL"
FT                   /protein_id="YP_003958329.1"
FT   gene            327301..328611
FT                   /db_xref="GeneID:9882249"
FT                   /locus_tag="ELI_0348"
FT   CDS_pept        327301..328611
FT                   /locus_tag="ELI_0348"
FT                   /gene_family="HOG000103580" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825973"
FT                   /db_xref="GeneID:9882249"
FT                   /translation="MNFLKGEKKLSDLSRFHKMFLIVLISMGSSIIYMPVYLKNVFYEP
FT                   LMVGLGVSNEQLGALVGMYGIMATILYIPSGIVADKVRVRTLAWVGFAATALAVFWYAA
FT                   MPSYGVLLFIFGLMAVTTILIWWGTRFKLVRLVSSEEEYPKNIGFSYGLYGVAGLIFNM
FT                   IALGVFGMIADQTRGVTTVLIIMGAIILLFGILSFFFIPKFEGEIKTDGKSFNLSEFAE
FT                   ALKHPGVWLASISMFFICFVYQGMNYTTPFLTNVFGASLGLVSVVGMIRTYGITLISSP
FT                   ILGKVAEKINSPAKVIMVISAVAALCYGSFLILPKTAAMAIVVAVIMVVLGFVGNGAFG
FT                   IASSQLTETKVPIHVFGAATGMVSVIGFLPESFMHQWFGGMIDRQGNAAFTTIFGILIV
FT                   CAVLSIGASLLVRRYAKKHTGTGEDKKIVKEVDTAVE"
FT                   /protein_id="YP_003958330.1"
FT   gene            328704..329291
FT                   /db_xref="GeneID:9882250"
FT                   /locus_tag="ELI_0349"
FT   CDS_pept        328704..329291
FT                   /locus_tag="ELI_0349"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphopantethiene-protein transferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825974"
FT                   /db_xref="GeneID:9882250"
FT                   /translation="MIDVYTLDTHFFSVTGKTVHVEVLLNKIFEKKGLPVPVKVEKNRY
FT                   GKPFLKEYPSLHFNGSHSGDYLVCAMSQNPVGVDVQRIDRTKRMMSLAKRFMSPGEVRG
FT                   LEALDDEKRTQAFYRLWAQKESYMKYRGLGFALPLSAFEIQQKGEEYQILDEGCQTGGV
FT                   SLRRLELASDYELWVCGEEDEVRKIEFGVYEE"
FT                   /protein_id="YP_003958331.1"
FT   gene            329294..330025
FT                   /db_xref="GeneID:9882251"
FT                   /locus_tag="ELI_0350"
FT   CDS_pept        329294..330025
FT                   /locus_tag="ELI_0350"
FT                   /gene_family="HOG000013807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="branched-chain amino acid transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825975"
FT                   /db_xref="GeneID:9882251"
FT                   /translation="METTEEKIIINNSFAKGLQDGIPIGLGYLSVAFTFGMMAVTQGLP
FT                   AWSAVLISMTNLTSAGQFAGLDLIVLGAPFVEMALTQLIINLRYALMSLSLSQKLEDSV
FT                   TTLERCLIAFGNTDEIFAVSSGQPGKLGKWYMFGLMVMPYIGWSGGTLIGAAASTILPE
FT                   FIRSALGIAIYGMFIAIIIPPARKKKSVRAVLIFAVALSCIFTFAPILSQVSTGFTIII
FT                   CTIAASAFGAWFFPISEEEEI"
FT                   /protein_id="YP_003958332.1"
FT   gene            330022..330336
FT                   /db_xref="GeneID:9882252"
FT                   /locus_tag="ELI_0351"
FT   CDS_pept        330022..330336
FT                   /locus_tag="ELI_0351"
FT                   /gene_family="HOG000013920" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825976"
FT                   /db_xref="GeneID:9882252"
FT                   /translation="MTTTLLIYILVMAGVTYLIRVLPLALFKKKIESKFVKSFLYYVPY
FT                   AVLGTMTFPAIFYSTGSLYSATAGLIVAILLAMKEKGLVTVAVFACAAVLLVETVLGYL
FT                   "
FT                   /protein_id="YP_003958333.1"
FT   gene            330394..331191
FT                   /db_xref="GeneID:9882253"
FT                   /locus_tag="ELI_0352"
FT   CDS_pept        330394..331191
FT                   /locus_tag="ELI_0352"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825977"
FT                   /db_xref="GeneID:9882253"
FT                   /translation="MYRISEFSKITNLTVKALRYYDEQGILVPSHRDSQNGYRYYSEED
FT                   FKRAQLVALLRSFEFSISELRDVMENFDEDTDLAYFLEEKKAMIEHKIEKEKKLLKKIS
FT                   LYIEPTGQEESPMQYKIEVKRLEPVIVASIRYQGLYSEVGKYIARIYKAVKGNAGGIPF
FT                   NLYYNEAYQEKADIEICVPVKRYIEAAGIECRTLPAVERAVSTIHQGSYSQFNHAYKAL
FT                   LDYSRAQDLKLLIPSREKYIKGPGAIFRGNENKYMTEIVIPFE"
FT                   /protein_id="YP_003958334.1"
FT   gene            331356..332577
FT                   /note="multi antimicrobial extrusion protein MatE;
FT                   frameshift"
FT                   /db_xref="GeneID:9882254"
FT                   /locus_tag="ELI_0353"
FT                   /pseudo
FT   gene            complement(332642..333265)
FT                   /db_xref="GeneID:9882255"
FT                   /locus_tag="ELI_0355"
FT   CDS_pept        complement(332642..333265)
FT                   /locus_tag="ELI_0355"
FT                   /gene_family="HOG000277503" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosyl-AMP
FT                   cyclohydrolase/phosphoribosyl-ATP diphosphatase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825978"
FT                   /db_xref="GeneID:9882255"
FT                   /translation="MNNDIELKFNHHGLIPAVLQDYYTRQVLMVAYMNREALDKTLETG
FT                   KATFWSRSRKELWTKGETSGNYQEVVAIDYDCDADTLLVQVLPKGPACHTGETSCFYRN
FT                   LYTNEEKATGNMDIIHKLADQVQDRRENPVEGSYTNYLFREGVDKICKKIGEESAETII
FT                   AAKNDSKEELTYEASDLLYHLTVLLNNQGVTFDDLFVELTKRHK"
FT                   /protein_id="YP_003958335.1"
FT   gene            complement(333283..334038)
FT                   /db_xref="GeneID:9882256"
FT                   /locus_tag="ELI_0356"
FT   CDS_pept        complement(333283..334038)
FT                   /locus_tag="ELI_0356"
FT                   /gene_family="HOG000224612" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825979"
FT                   /db_xref="GeneID:9882256"
FT                   /translation="MLTKRIIPCLDVDHGRVVKGKKFKDIQDVADPVELGRYYSEQGAD
FT                   ELVFYDITASYEERDIFINIVEKVAEAIRIPFTIGGGISRVEDFRKVLMAGADKVSVNS
FT                   SAVKNPQLIRDAALKFGNQCVVLSIDAKRNDSGSWDVYVKGGRENTGIDAIEWAKRGQE
FT                   LGAGEICINSIDTDGVKRGYDLELNRKLSEILTIPVIASGGAGEKAHFSEVLKAGADAA
FT                   LAASVFHYKEIPIPELKAYLDSEGIAVRK"
FT                   /protein_id="YP_003958336.1"
FT   gene            complement(334040..334753)
FT                   /db_xref="GeneID:9882257"
FT                   /locus_tag="ELI_0357"
FT   CDS_pept        complement(334040..334753)
FT                   /locus_tag="ELI_0357"
FT                   /gene_family="HOG000224614" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosyl formimino-5-aminoimidazole
FT                   isomerase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825980"
FT                   /db_xref="GeneID:9882257"
FT                   /translation="MIIFPAIDIKNGKCVRLKQGVKDDETIYFDNPVEVAKRWESEGAE
FT                   YLHLVDLDGAFDGKPQNLEVVKDIVKALDIPVELGGGIRDEEIAKMYVDIGVSRIIIGT
FT                   QAVKDLGFIERLLALYDEKVCVSIDAKDGIVCTEGWVESSNIEALELAAKLERLGLSTL
FT                   VYTDISKDGMMSGPNFDMLNVLNLHLNMDIIASGGIASADHLKKLEEMNLYGAITGKAL
FT                   YEGTLDLAAYLKGEC"
FT                   /protein_id="YP_003958337.1"
FT   gene            complement(334750..335358)
FT                   /db_xref="GeneID:9882258"
FT                   /locus_tag="ELI_0358"
FT   CDS_pept        complement(334750..335358)
FT                   /locus_tag="ELI_0358"
FT                   /gene_family="HOG000025030" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825981"
FT                   /db_xref="GeneID:9882258"
FT                   /translation="MIAIIDYDVGNLKNVYTALKDVDLEGVITRDPKVVDNAEAIILPG
FT                   VGAFSDAMEHLRQFDLVNCLDKNVQSGKTLMGICLGMQVLFDKSTEDGEWTGLGYIPGE
FT                   IVKFDAPGLKIPHMGWNNLIINRDDSLVKGIGSEDYVYFVHSYYAQPKSFDDVVAYADY
FT                   SVKVPGIVRKENVIGMQFHPEKSSRVGTQLLMNFKENLK"
FT                   /protein_id="YP_003958338.1"
FT   gene            complement(335355..335942)
FT                   /db_xref="GeneID:9882259"
FT                   /locus_tag="ELI_0359"
FT   CDS_pept        complement(335355..335942)
FT                   /locus_tag="ELI_0359"
FT                   /gene_family="HOG000228064" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825982"
FT                   /db_xref="GeneID:9882259"
FT                   /translation="MERKITLTRKTFETDIELSLNLDGTGQCDVSTGVGFFDHMMTLFT
FT                   KHGRFDLTLKATGDAADNHHVLEDIGILLGKAFAEALGDKAGITRYAFQFTPMDEALCR
FT                   ICIDISGRSYLVYDVPLTREYIGEFETEMLEEFFIAFTNNSKMTIHVASLYGRNNHHIV
FT                   EGIFKCFGRTLKQAVTIDPNVKGVPSTKGVLE"
FT                   /protein_id="YP_003958339.1"
FT   gene            complement(335944..336996)
FT                   /db_xref="GeneID:9882260"
FT                   /locus_tag="ELI_0360"
FT   CDS_pept        complement(335944..336996)
FT                   /locus_tag="ELI_0360"
FT                   /gene_family="HOG000288510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825983"
FT                   /db_xref="GeneID:9882260"
FT                   /translation="MKNFARKCVKDLEAYKVEAPQYDIILNANENPWDFPEALKKELCD
FT                   EIMKAPLNRYPEACFPELLAELSDYTGVPEDQIICGSGSDELIAMINQSFMNPGDTAVT
FT                   HTPSFAMYQIWTAIADGQFVGVPDKNGHIPDVEGIISAAKVNDAKLIYLCNPNNPTGYL
FT                   FPRYDIVQILEETNALVILDEAYMEFKGSTHVDLIENYPNLLVLRTLSKAFGMAGIRCG
FT                   YCLGNKALIDVMYKVKSPYNLNVLTQKAAVIALKNREKLLDRLKTLNAERHKMYKALRD
FT                   MPLDSLYPTASNFIYFETGKGEAIYEAMKENGILIKFFKGNETMPASIRLSIGTPEENR
FT                   KVLEILKKVL"
FT                   /protein_id="YP_003958340.1"
FT   gene            complement(337008..338294)
FT                   /db_xref="GeneID:9882261"
FT                   /locus_tag="ELI_0361"
FT   CDS_pept        complement(337008..338294)
FT                   /locus_tag="ELI_0361"
FT                   /gene_family="HOG000243914" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825984"
FT                   /db_xref="GeneID:9882261"
FT                   /translation="MKTYTYKESINKLDTLLKRDEGENQEIRRRVLEIIDTVKSQGDAA
FT                   LINYTEKFDGCRLDTLRVTDAEIQEAFDLVGREMAAVIEEAAGNIRAFHEKQKEETWMY
FT                   NPGPGITLGQHITPLERVGLYVPGGKAAYPSTVLMDSIPALVAGVDSLVMVTPPGKDGK
FT                   INPNILAAAKIAGVHEIYKAGGAQAVAALAYGTESIAPVNKIVGPGNIYVATAKKEVFG
FT                   KVAIDMIAGPSEVLILADGTANPVYAAADLLSQAEHDEMAMPILVTTDADFGEKVITEV
FT                   YRQIEADLGRKEIARKSVDNYGFVFVAENLEQAFELSNAIAPEHMEILLPEPMQYLERV
FT                   RNAGAIFLGSYTPEPLGDYFAGPNHTLPTSGTAKFSSPLGVYDFMKKSSILSYSEDALE
FT                   KVYTKIAAFARSEGLDAHAKSVERRYENK"
FT                   /protein_id="YP_003958341.1"
FT   gene            complement(338305..338934)
FT                   /db_xref="GeneID:9882262"
FT                   /locus_tag="ELI_0362"
FT   CDS_pept        complement(338305..338934)
FT                   /locus_tag="ELI_0362"
FT                   /gene_family="HOG000223248" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825985"
FT                   /db_xref="GeneID:9882262"
FT                   /translation="MQIRLALAKGRVARKAIELLQKIGYIFEDYDEKSRKLIFQDTTGA
FT                   IEFFLVKSPDVPTYVEKGAADIGIVGRDVLMEHPANVYELLNLDIGQCKMCVAGFKDSK
FT                   PQFGKKLVVGTKYPAIAKDYFNSKDEPVDLIKINGSVELAPLLGLSDCIVDIVESGSTL
FT                   RENGLVVLEEICDISSRLIVNKVSLKTKGAMIDPIIERFEANLSIN"
FT                   /protein_id="YP_003958342.1"
FT   gene            complement(338936..340189)
FT                   /db_xref="GeneID:9882263"
FT                   /locus_tag="ELI_0363"
FT   CDS_pept        complement(338936..340189)
FT                   /locus_tag="ELI_0363"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histidine-tRNA ligase (histidyl-tRNA synthetase)"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825986"
FT                   /db_xref="GeneID:9882263"
FT                   /translation="MLENYTIDGFENIQYQGYPALQKIENNLGQLFELYGYHPISTPTF
FT                   EAYDLYAAEDSIASDDLFKLVNHQGKVLALKPDATLAVTRMAAINHHDPDEIIKFSYLT
FT                   NIYRSFASPESVKKEMTQMGVEYFGNNSPECDGEIIALAIESLLSNRIEDVHIDLGHVG
FT                   FINHLMDELAFSVKEKTQLFKYIENKNIGDIGEFLNRKNLNAKVAAIILKLPKLYGEPQ
FT                   QVFKKMEALCINDAMRRVVDKLKAIYHHLEVTGYAKYISFDLGFTNQMNYYSDLIFKGY
FT                   INNWGEPVINGGRYNHLSEKFGISRPACGFGIDLLKMMEYMEQYHLLPQSEKRKTIILY
FT                   APEDKCEGYKTAGILRQKGQPTELFVLKTTPEECAAALAQNALYQNAHYYLIRDQKNYH
FT                   FTKKGFQAIDSIVEAEVN"
FT                   /protein_id="YP_003958343.1"
FT   gene            340443..342248
FT                   /db_xref="GeneID:9882264"
FT                   /locus_tag="ELI_0364"
FT   CDS_pept        340443..342248
FT                   /locus_tag="ELI_0364"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825987"
FT                   /db_xref="GeneID:9882264"
FT                   /translation="MDTFLIFNLIGNISLWLLIIALIVTAFFYYNYRLKKENLEQKEQY
FT                   RLDVDLIRTMLNMVSDCVILLDESGKILRVNKKLEEYYGRSADKIVGKNYQRFHTDFDY
FT                   EEHKSNMRLNFDLGSTYTLPVKYYMPDRSVIPFSVEIHRFVFSEKVYYGIVARDEKNLQ
FT                   EREAYIEEQASKLVEIEHIARMGYWELNHQSKEIVWSRELYHILGYEINTVKPNLDILF
FT                   KMVHPADQERVTKAFLDAFQNQETVDIHHRIITTKNEVVDVLIRIRHTFSSKNEHLSTI
FT                   GIVQNITEEKELRDNLDFQSQFSKAVVDNSDMLVLTTDENNNILEVNPFIEELTGQSRE
FT                   VLIGQPAEAIFGRVAQRRTNKDRNYRKPLALRDKEGRIRWIYWNTRELPYFDNRRVCVS
FT                   VGLDVSEGVEYRNKFEYLAYHEPITGLASRLKLRQVLSRYFAKNAGKPGKHMALLNISL
FT                   TNYHEINDLYGYEVGDQVVKQVCEQLSDRVGHYGLLARHSDDLVVLFLPNRNAREKIEP
FT                   ICIEIIECLNEPCVVEGMTFTIGGQIGIAKYPENAQNKEDLQRFADAAMNCARLDTSID
FT                   YYFFDDKLRRKMVDDKMMYRKNYKK"
FT                   /protein_id="YP_003958344.1"
FT   gene            342284..342922
FT                   /db_xref="GeneID:9882265"
FT                   /locus_tag="ELI_0365"
FT   CDS_pept        342284..342922
FT                   /locus_tag="ELI_0365"
FT                   /gene_family="HOG000248343" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825988"
FT                   /db_xref="GeneID:9882265"
FT                   /translation="MAYKCVVFDFDGTLADTEEKTFNIYNDMAEKYKYRKITKEELQHI
FT                   KNLHIKEIMEIVDIPFYKLPRVLSEGQKRMRATMEDIRAFYPEIKTFMDDLTQITEYRG
FT                   ILTSNIEKTVQSFLRHYRLEDDIDFIMCSALLSKEKKIKKVLKKYDLKKEELLYVGDET
FT                   RDIESCLRAGVDVVAVKWGYNTPKALERCNPTYMVDHTTDILTIVKNKM"
FT                   /protein_id="YP_003958345.1"
FT   gene            342922..344169
FT                   /db_xref="GeneID:9882266"
FT                   /locus_tag="ELI_0366"
FT   CDS_pept        342922..344169
FT                   /locus_tag="ELI_0366"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="poly(A) polymerase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825989"
FT                   /db_xref="GeneID:9882266"
FT                   /translation="MEKAIETLFQVFRKHHKQLFIVGGAVRDMLLGKAPSDYDFTTDAL
FT                   PDEVESWFEHTITVGKHFGTIGVIMDKKVYEITTFRKEASYADGRHPDEVLFTDDVRED
FT                   VSRRDFTINGLLMDERGCVFDYVGGLEDIRNGMVRCIGDPKKRFEEDRLRKWRCIRLAA
FT                   EKRMELDERTRSAIRDNPDTAGVSIERIRGELTRIMLCEKVAWGGYLLIKTELLGDLLN
FT                   RMVPEYWKRCEDYLIDGFEIMGYLPKKLPLRLAAFLLNMFPEERRVFLREMRYSNKEKQ
FT                   LAYGFCHHVVADSQDSVAFKEALADIGMENAEDFLAFQDGLAYWDGDPSIKRAAEQNQR
FT                   VYRRIAANREPMTLRELAVNGKDLTDRGYQGEAIKESLTRLLKRVYEYPEENKKDRLLA
FT                   WLERETHGETDLPEGN"
FT                   /protein_id="YP_003958346.1"
FT   gene            344138..344995
FT                   /db_xref="GeneID:9882267"
FT                   /locus_tag="ELI_0367"
FT   CDS_pept        344138..344995
FT                   /locus_tag="ELI_0367"
FT                   /gene_family="HOG000227962" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825990"
FT                   /db_xref="GeneID:9882267"
FT                   /translation="MEKLTSPKVIEGILNKYDLHFNKRYGQNFLIDENIVRKIVEAGNV
FT                   HKNDTVLEIGPGIGTMTQVLAEAAGKVYSVEIDKKLIPVLAKTLEDCNNVEIIQGDILK
FT                   TDIPGLLRTNLQKNPLKIVANLPYYVTTPIIMGFLESELPIEQMTFMIQKEVGERLCAE
FT                   PGTKAYGSLTIAAQFYAETEISFYVPAAVFMPRPKVDSIVVTLKKRAEPAIRVSDKKLF
FT                   FQIVKASFLNRRKTLINGLQMNTDYSKERLLNALEKCGIAPGVRGETLTGEDFARLANT
FT                   LSGE"
FT                   /protein_id="YP_003958347.1"
FT   gene            345067..345348
FT                   /db_xref="GeneID:9882268"
FT                   /locus_tag="ELI_0368"
FT   CDS_pept        345067..345348
FT                   /locus_tag="ELI_0368"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825991"
FT                   /db_xref="GeneID:9882268"
FT                   /translation="METKPARKTRPFYVTLALVAIIMFSLFGFLFFREMGRLSSLTGVS
FT                   MLPEQKLTISKIDKQELREKQLENQYTQTLVITTDAVASYIMDNKAID"
FT                   /protein_id="YP_003958348.1"
FT   gene            345469..345855
FT                   /db_xref="GeneID:9882269"
FT                   /locus_tag="ELI_0369"
FT   CDS_pept        345469..345855
FT                   /locus_tag="ELI_0369"
FT                   /gene_family="HOG000158443" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825992"
FT                   /db_xref="GeneID:9882269"
FT                   /translation="MKSIKRVCACKGGTLTRFIQPVILTILSEQDDHGYSILSKLAGTY
FT                   LWKDKKPDASGLYRTLKNMEQQGLIVSHIDIADNENMGKRVFSITPAGLECMMHWKETL
FT                   EDYQKGIDEIIEGIAEAAGKRKLD"
FT                   /protein_id="YP_003958349.1"
FT   gene            complement(345903..347684)
FT                   /db_xref="GeneID:9882270"
FT                   /locus_tag="ELI_0370"
FT   CDS_pept        complement(345903..347684)
FT                   /locus_tag="ELI_0370"
FT                   /gene_family="HOG000011738" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="activating enzyme"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825993"
FT                   /db_xref="GeneID:9882270"
FT                   /translation="MRVLFPLLEEEIEVSQDSLISDVCASIGLPLNLVCGGKGRCKKCL
FT                   VNIKENGEMKEVLACQYSVSDGMEIYASREQAASQILETSSNSDLPFDPIVKCYSLNYT
FT                   DLVTPMCTYDLDVLRKLIPQTLDTPDYSVLKHFSEVYFLEGYEKLHVIVSGNRIIDFIP
FT                   SNETEKPIYGIAFDIGTTSVVGYLYDITSGCLLNQHSMLNKQIAFGGDVISRIDYAGES
FT                   PESLHKIYEAIMETLTEIITQVCKKASVDTNDIYQTVYCGNSTMAHLFLELNPKHLGLA
FT                   PFLGFCKDAISLKGMDTPLPINPKGTVTFMPLLGGFVGADTTAVLLGLPRDKKMRLMID
FT                   LGTNGEIAVGNCDKFYVASTACGPALEGAGLTMGMRGTTGAIEKVGCENGKITYSVIGK
FT                   TAPQGFCGSGIVDAIAMLFREGLIAKRGNFIKGDALDAHPMKNRFGVDENNQRYFKIVT
FT                   ASEHPEGKDIIITQKDVRAVQLAKAAIYTGCCLLSENYGIKGSDLEEIVIAGAFGNYID
FT                   VHNAQFIGLLPKIEGVPVRSIGNGAGTGAQLYLLSKKEADICNAIPTITTHIELATDPK
FT                   FVETYMMNTMFGDNVMI"
FT                   /protein_id="YP_003958350.1"
FT   gene            347983..348798
FT                   /db_xref="GeneID:9882271"
FT                   /locus_tag="ELI_0371"
FT   CDS_pept        347983..348798
FT                   /locus_tag="ELI_0371"
FT                   /gene_family="HOG000015344" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydropteroate synthase DHPS"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825994"
FT                   /db_xref="GeneID:9882271"
FT                   /translation="MIIIGEKLNGAIPVVKKAIEEKDEAFIRDRAIAQAEAGATYIDVC
FT                   AGTAPEIELESLKWMMDIVQEAVETPLCIDSPDPEILKAVFPLCKKPGLVNSVSGEGNK
FT                   MDVLLPLFDDADPAWELVAMTCDNAGIPNTVEKKVELTKMMVEEAKKHNLTPNRIHIDP
FT                   CVMALSTENHSFLNFKAEIEGIREIYPDIHITSGLSNISFGLPARKLMNQNFMTLSMFV
FT                   GMDSAVMDPTSRDMMGAIFATDALLGNDRLCRKYSKAFRQGKIGPVQAK"
FT                   /protein_id="YP_003958351.1"
FT   gene            349501..351180
FT                   /db_xref="GeneID:9882272"
FT                   /locus_tag="ELI_0372"
FT   CDS_pept        349501..351180
FT                   /locus_tag="ELI_0372"
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825995"
FT                   /db_xref="GeneID:9882272"
FT                   /translation="MGFKSDIEIAQEAKPQDIREIAAKLGLTEDDLELYGKYKAKVDYN
FT                   LLKRETGKKARLILTTAINPTPAGEGKTTTTIGVADALSKLGKNTLVALREPSLGPVFG
FT                   VKGGAAGGGYAQVVPMEDINLHFTGDFHAIGAANNLLAAMLDNHIHQGNELNIDPKRIT
FT                   WRRCVDMNDRQLRNIVDGLGKKGDGAVRQDGFDITVASEIMAAFCLASDIVDLKNRMGR
FT                   IIVGYTYDDEPVTAGQLKANGAMAALLKDALKPNLVQTLEGTPSFVHGGPFANIAHGCN
FT                   SVIATKMAMHFASDYVVTEAGFGADLGAEKFLDIKCRMAGLKPDAVIIVATVRALKYNG
FT                   GVPKDELNNENLEALEAGLPNLLKHVENITQVYKLPAVVAINRFPLDTKAELKLVEDKC
FT                   RELGVNVALSEVWAKGGEGGIAVANEVIRLCEEGENSFQFSYEDDMSIKDKINAIATKI
FT                   YGADGVDYTPEADAEIAKLTKLGFDKVPVCMAKTQYSLTDDQTKLGRPTGFRITVRQAS
FT                   ISAGAGFIVCLTGEIMKMPGLPKEPAAERIDVDENGVISGLF"
FT                   /protein_id="YP_003958352.1"
FT   gene            351342..351971
FT                   /db_xref="GeneID:9882273"
FT                   /locus_tag="ELI_0373"
FT   CDS_pept        351342..351971
FT                   /locus_tag="ELI_0373"
FT                   /gene_family="HOG000057022" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methenyltetrahydrofolate cyclohydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825996"
FT                   /db_xref="GeneID:9882273"
FT                   /translation="MGIADKKCTEFVEVLYSKSAVPGGGGAAALVGAIGTALAGMVGNL
FT                   TTGKKKYAEYEEDIQRILGEAQALQDQLMAMIDQDAENFAPLAKAYSLPTETEEQKAHK
FT                   AEVMEECTKVACGVPIEIVRVCYKSIKLHEELVHKGSALAISDVGVGVQCLRAAMISGW
FT                   LNVLINIKTMKDRDYVASVENELKPMLEDGIAICDTVYAEVEKQLS"
FT                   /protein_id="YP_003958353.1"
FT   gene            352007..352909
FT                   /db_xref="GeneID:9882274"
FT                   /locus_tag="ELI_0374"
FT   CDS_pept        352007..352909
FT                   /locus_tag="ELI_0374"
FT                   /gene_family="HOG000218242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825997"
FT                   /db_xref="GeneID:9882274"
FT                   /translation="MAAKLLSGKEVSESMLAKVLEDAKSLIAGGVQPKLAIMRVGADPG
FT                   SISYEKSIITRMGKSSIEVESVEFPEDVTQADFVAKLKTLNDDKNIHAVLIFKPLPEQL
FT                   DEEEIKYILSPEKDPDALNPTNLGKLMIADERGFFPCTAEGVMELLKHYEIDVKGKDVV
FT                   IINNSNVLGKPLAIMLTNEFATVTMCHVFTKDTPSYTKKADIVVTAAGIYGLVKPDMLS
FT                   EDCILVDVAMSQMKDENGEFVLNEEGKKIRTGDAHVDCLDKVAMITSATPGCGGGTGPI
FT                   TTALLAQHVIKACKQQNNL"
FT                   /protein_id="YP_003958354.1"
FT   gene            352975..353640
FT                   /db_xref="GeneID:9882275"
FT                   /locus_tag="ELI_0375"
FT   CDS_pept        352975..353640
FT                   /locus_tag="ELI_0375"
FT                   /gene_family="HOG000016468" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825998"
FT                   /db_xref="GeneID:9882275"
FT                   /translation="MIISQKKSFEDVLEYLKDAKKVVITGCSECATVCKTGGEEEVEAM
FT                   KAALEAEGKEVLATKVLTTSCNVLLNKKELKEIKGELGDADAVLCMACGDGVQTVAKGV
FT                   KKETYPANDTMFVGETVRNGIFEEMCKTCGDCVLGRTAAICPITRCGKSLLNGACGGSR
FT                   DGKCEVIPENDCAWIEIYKKLKEQGKEELLEEIQPLRGYKKVAYPRTINLRDQEKDGE"
FT                   /protein_id="YP_003958355.1"
FT   gene            353630..354520
FT                   /db_xref="GeneID:9882276"
FT                   /locus_tag="ELI_0376"
FT   CDS_pept        353630..354520
FT                   /locus_tag="ELI_0376"
FT                   /gene_family="HOG000016467" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative methylenetetrahydrofolate reductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310825999"
FT                   /db_xref="GeneID:9882276"
FT                   /translation="MVNKMSSLLQQTLEAGKFAITAEMAPPKGTDFSHILEIADLLKGR
FT                   VQGVNVTDYQSAAVKASSLAMCVELEKKGLESILQMTGRDRNRIAIQGEMLSAGHFGVK
FT                   NMLALTGDHTTTGDNPEAKPVFEMDSVSILQTAEVLMSGQDLAGNELKGAPDFYLGACV
FT                   TPVFDPIEVQLIKMRNKIKAGAKFFQTQGVFDIEVMREFKELTKDMDCYVLAGIIPLKS
FT                   AGMAKFMNRSVPGISVPDALIERLTEAEDKAAEGIRIAGEFVAQLKEEGVCDGAHIMAI
FT                   GAEENVPKILDVAGL"
FT                   /protein_id="YP_003958356.1"
FT   gene            354534..355907
FT                   /db_xref="GeneID:9882277"
FT                   /locus_tag="ELI_0377"
FT   CDS_pept        354534..355907
FT                   /locus_tag="ELI_0377"
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826000"
FT                   /db_xref="GeneID:9882277"
FT                   /translation="MRITVIGAGPGGYEAAIMAAKLGAEVTCIEKDEVGGTCLNRGCIP
FT                   TKAFLAASDVLETVESAKDFGINIDGTVSVDYKAVVDRKNKVKDGLIKGIHFLFEENKV
FT                   NLIKGTGKIVDKNTVEVTKEDGSTETIETDKIILATGSVPVSPGMFKYDGKKVITSDEV
FT                   LDLEKAPESIIIVGGGVIGCEIGQFLSRMGTKVTIVEALEQILPNEDKDVSKQLLRQFK
FT                   KDKIKVHTGVGVAEVEVSDDGVKASLANGKSVEAEMMLVAIGRRSFVDNLGAQDAGVEV
FT                   DERGRIIVNDKMETSVPGVYAIGDIVATAQLAHVASKEGIVAVENAMGADKHVTYAAVP
FT                   RCVYTEPEVAGVGLTEKDCEKKGVEYKLGTFDFRALGKAQAIGKIQGFVKVIVDNNDVI
FT                   VGASIVGPHATDLLAELSLAVHLGLTAEQVGDVIHPHPSLSEALMEALHDVHGKSVHK"
FT                   /protein_id="YP_003958357.1"
FT   gene            356029..356409
FT                   /db_xref="GeneID:9882278"
FT                   /locus_tag="ELI_0378"
FT   CDS_pept        356029..356409
FT                   /locus_tag="ELI_0378"
FT                   /gene_family="HOG000239392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative glycine cleavage system H protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826001"
FT                   /db_xref="GeneID:9882278"
FT                   /translation="MNVPQELKYDKEQHLWIAVDDNVATIGITDFAQDKMGDILFVELA
FT                   DEDDEFERGDEFSVVESGKKASPLEAPFAFKVLESNQDLDDEPEAINEDAYANWIVKVQ
FT                   ITDDEGIEDLVDAAEYEAAIAE"
FT                   /protein_id="YP_003958358.1"
FT   gene            356423..357307
FT                   /db_xref="GeneID:9882279"
FT                   /locus_tag="ELI_0379"
FT   CDS_pept        356423..357307
FT                   /locus_tag="ELI_0379"
FT                   /gene_family="HOG000295169" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="amidohydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826002"
FT                   /db_xref="GeneID:9882279"
FT                   /translation="MVIDCHIHCALSGFGKLKKGLMSEDTPEREGWFLSLAARYRKHNV
FT                   KALRDGGDAYGAGTAFKPIAEDAGIIFRTPLVALYKTGHYGDFLGEAITDFESCRKKMD
FT                   QLLKRKPDFIKIIQSGIMSFDHFGEAGSLEFTDEELRYLIDRAHDAGLRTMVHVNTPKG
FT                   IMMAIEAGADSIEHGYCIDADCIAAMKEKDIVWVPTLAPFANIAGCDKSHPLSRYREVS
FT                   QRYFTGHKLQVKKAHEAGVTIALGSDAGASLVIHGLASREELSYLTDCGLTKAEVFTNG
FT                   CRVLELDEAQFKK"
FT                   /protein_id="YP_003958359.1"
FT   gene            357484..358113
FT                   /db_xref="GeneID:9882280"
FT                   /locus_tag="ELI_0380"
FT   CDS_pept        357484..358113
FT                   /locus_tag="ELI_0380"
FT                   /gene_family="HOG000200848" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="D-Ala-D-Ala dipeptidase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826003"
FT                   /db_xref="GeneID:9882280"
FT                   /translation="MHELVTVRPDNFVDVADYIPTIETDVKYYSGDNFVGERIEGYNAP
FT                   IILVTRETADALKAAQSKLMTKGYCLRVYDGYRPQRAVEHFLRWKDRPETGETKARHYP
FT                   DFTRAEVFDEGFIAARSTHTRGSTVDLTVVDMRNGQELDMGGFFDYFEESSYSNYTDLT
FT                   AIQSRNRMMLKYLMLSCGFEPFFQEWWHFTLGNEPYPNTYFDFEIQ"
FT                   /protein_id="YP_003958360.1"
FT   gene            358135..359505
FT                   /db_xref="GeneID:9882281"
FT                   /locus_tag="ELI_0381"
FT   CDS_pept        358135..359505
FT                   /locus_tag="ELI_0381"
FT                   /gene_family="HOG000277392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826004"
FT                   /db_xref="GeneID:9882281"
FT                   /translation="MDNEKNTELGTMPVGRLMFKLALPAIVAQVINALYNIVDRMYIGH
FT                   IEGVGPMALTGVGITFPIIMLITAFAAMIGMGGAPLAAIHLGEKNRDSAEGILGNAATL
FT                   LLILSVVLTAFFLIFQRPLLMAFGASENTIEHALQYMTIYLCGTIFVMATLGLNSFINT
FT                   QGFAKTGMLTVLIGAVLNIILDPVFIFVFGMGVRGAALATILSQAVSAIWVCRFLMGKK
FT                   TTIKIKPSRMRLKKEYVVGIISLGISPFIMQSTESLLNITLNASLQFYGGDLAVGAMTI
FT                   IGSISQLGLMPLMGLTQGGQPIISYNYGARNYDRVRKAYHLMIAASFTLSMVIWAIVEF
FT                   FPEVVIAIFTTDPQLSSLTVWAIRIFMMCLGIMGLQTGCQQTFLSLGQAKVSVFLAMLR
FT                   KLILLIPLILIIPRVTGLGMTGVFLAQPIADFIAVVSTVAVFAVKIRKIIPRPAKTA"
FT                   /protein_id="YP_003958361.1"
FT   gene            359606..362380
FT                   /db_xref="GeneID:9882282"
FT                   /locus_tag="ELI_0382"
FT   CDS_pept        359606..362380
FT                   /locus_tag="ELI_0382"
FT                   /gene_family="HOG000220999" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826005"
FT                   /db_xref="GeneID:9882282"
FT                   /translation="MKKGKKAFWTVVVAVVVVLAILLSLNHFYVDYLWFSEMGYLNVFF
FT                   KELVTKVQIGTPVFVVLLVLLFFYLKFLKKISERYLGITQAVRTKREKTIGAVLSVVAA
FT                   AVITGFIANSLWSEILQFTNATDFGTTDPLFGKDLSFYFFTLPLLKGAYGVVMTCFFGM
FT                   VILTLLYTVFVMYREKDFRIQTAQSMDDFKSGAKDIFTTFLTLASKQIGVFLGIFFLLL
FT                   AFSSFIGRYEMLYGGTGMVYGAGASDITIGMKVLYVKIALCLVLAVTSVLAGFRKNYKM
FT                   MAAGPVLLIAVALLGGVGQAAYEYLSVVPNQYTKEAPYIEKNIASTQKAYGLDKVTIKD
FT                   FSPTQDITARDIQENEATISNIPINDQKPTKDMYNSLQGIRNYYKFYDVDVDRYFVDGK
FT                   YTQVFLGTREMENSALPDDAKTWVNQHLKYTHGFGVAMSPVNKTNSVGQPELIVKDIPP
FT                   VTDTQSLEIEQPRVYFGEGDYKYVVTNAANPEFDYPEGDNNKENYYEGTGGIKLSLLNR
FT                   ISFALYYGSPEMLLTSEITSDSKILINRNVMDRVSKLAPFLEYDNKPYMALADGKQYWI
FT                   VDGFTTSSKYPYAQPYDKTTGKNYIKNPVKVVVDAYNGDVTFYKVDDEPVLETYSKIFP
FT                   GLVKDISEMPKGLKEHIRYSKTLFDIQSDIYKTYHMSNPQVFYNREDQWETANQFFGAS
FT                   KEEVPIDSSYTIMKLPDRQTEFMLTTTFTPRNKDNMIAWLAGVSDGDDYGQLLLYQFPK
FT                   QQLVYGPMQIEQRIDQNTTISPQLTLLSQQGSTVLRGNLMTIPIEDAIIYVEPIYIQAS
FT                   AGENNLPEVKKVIVSYQNEIVMADSLNQALGQIFNYDAGEAPAGANTAVSTATPNSSSA
FT                   TSAADLSIRANQLFQEAQNAQKSGDWAGYGSKLNELQDVLNQLQQATGASQPQ"
FT                   /protein_id="YP_003958362.1"
FT   gene            362528..362893
FT                   /db_xref="GeneID:9882283"
FT                   /locus_tag="ELI_0383"
FT   CDS_pept        362528..362893
FT                   /locus_tag="ELI_0383"
FT                   /gene_family="HOG000226057" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826006"
FT                   /db_xref="GeneID:9882283"
FT                   /translation="MPSFGDPFAANVERKMTKKELAQAIRLDLAGELEAIYLYDAHAQA
FT                   TDDPVAKKVLEDIRDEEKAHMGELTTLLRYLDPVEAELFEEGAGEVHEMLEELGIESGS
FT                   SEAQTAEGPTVGSLIED"
FT                   /protein_id="YP_003958363.1"
FT   gene            362904..363713
FT                   /db_xref="GeneID:9882284"
FT                   /locus_tag="ELI_0384"
FT   CDS_pept        362904..363713
FT                   /locus_tag="ELI_0384"
FT                   /gene_family="HOG000245523" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826007"
FT                   /db_xref="GeneID:9882284"
FT                   /translation="MDYLSREAAPFGDALWEQIDTTIVETLKKYLVGRRFLPLYGPLGP
FT                   GAQSVAVDSSDKDESFKDGVVQTTGRKFVELVQLYEDFPLFWRDLEASERTGVPVDLSA
FT                   AARAAQASAKAEDQLIFFGNKALGVDGLLTVPGSNTIKMDDWAEGQNAFANIAAGASML
FT                   VEKDMLGRLALIMGPDLYFKLQRIQPGTGVMEIDRIKSLLDGRVYRSNALAGKAVLVCA
FT                   EAQYMDLAIGQDLAAAYLELVNLNHYFRILETAALRVKNSEAIVVFE"
FT                   /protein_id="YP_003958364.1"
FT   gene            363840..365084
FT                   /db_xref="GeneID:9882285"
FT                   /locus_tag="ELI_0385"
FT   CDS_pept        363840..365084
FT                   /locus_tag="ELI_0385"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826008"
FT                   /db_xref="GeneID:9882285"
FT                   /translation="MIRFELSKKASDKIRKTAAHILEVQEERCPVVKTQMKLAMSDPQF
FT                   AGLVARCRDTQCAFAERDAAWEELMELLPSKRLDFDSMRQDALSYYGDDSDEVEHGMVF
FT                   EVVRETYDLMTRCLYDGVDFDTESYNITDIGPLGRCLSDGFHHFYCNVVFGEIEAGLSW
FT                   GRMLDEPLSLDKINYVYLYDQFERFEFGWWQIYGDKKKLYFDIYNEGTRNSKQKMRKCA
FT                   VEQKMPKKPQPFYGEYVRRCAELMLENPSLKQKAFKEMAVAQDAFKTGDESLNGEIAVT
FT                   LYKRLNTLHEPILAMIPELNATDTILINTVARMRADYLFYLLMHLVYLKSAGMSLLDEA
FT                   SQLMIEQNSQEPVPPTAFETLAVGYLSGAQGEMPEQNARALDEMMDFIEEAGLLSMNKY
FT                   GQLQPTPMEMTPRLL"
FT                   /protein_id="YP_003958365.1"
FT   gene            365118..365225
FT                   /db_xref="GeneID:9882286"
FT                   /locus_tag="ELI_0386"
FT   CDS_pept        365118..365225
FT                   /locus_tag="ELI_0386"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826009"
FT                   /db_xref="GeneID:9882286"
FT                   /translation="MALMGRYKYEIMYGTMDLMETLNAFFAELDGPMLY"
FT                   /protein_id="YP_003958366.1"
FT   gene            365391..365582
FT                   /db_xref="GeneID:9882287"
FT                   /locus_tag="ELI_0387"
FT   CDS_pept        365391..365582
FT                   /locus_tag="ELI_0387"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826010"
FT                   /db_xref="GeneID:9882287"
FT                   /translation="MMIEKEVKQCQCKEPSGVHPETDQLGFWMACNDCGGKIDATYEYF
FT                   EGFGEMKQRRDAYSLEHE"
FT                   /protein_id="YP_003958367.1"
FT   gene            complement(365715..366581)
FT                   /db_xref="GeneID:9882288"
FT                   /locus_tag="ELI_0388"
FT   CDS_pept        complement(365715..366581)
FT                   /locus_tag="ELI_0388"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CAAX amino protease family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826011"
FT                   /db_xref="GeneID:9882288"
FT                   /translation="MKQKKHRFLKHPILAAFLLPVIGLLGGGIIGQIVVLSLNGFDTKA
FT                   AQNTLLSNDLPEIFLALLVILIMKHSYDNQFKFGFWKKNLKPSMVFASWGFLVLLLNII
FT                   PNLFLGTPLESSYGLLLAVTGGIAPGLYEEVTCRGVVLSNMMYQWRNAKNPIMMSLLAS
FT                   SIAFGLIHLVNLFSTVGPTLIQVGYATGLGIFFGAVYLRTRNLWGPVVVHALIDISAKI
FT                   FVTEDPVAGIASLAVPPEQMLVGIAVFIVFTSIGLYLVRPAKHEEIKALWREDSWHHEV
FT                   APETEAL"
FT                   /protein_id="YP_003958368.1"
FT   gene            complement(366593..369988)
FT                   /db_xref="GeneID:9882289"
FT                   /locus_tag="ELI_0389"
FT   CDS_pept        complement(366593..369988)
FT                   /locus_tag="ELI_0389"
FT                   /gene_family="HOG000166274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826012"
FT                   /db_xref="GeneID:9882289"
FT                   /translation="MKKRILCILLSLLMVLSLVPAGVLAQEEETPVSYEDCAAGEAIVC
FT                   MEKASPLTRSAVPGLLAGAEVLMDLSNFPAARARSTSADTSGQVLALVRDESRSTEELI
FT                   AELNTYPQVAFAEPNYAISSMTDESGAAETVAPEPSAVETDKTVVPEAAANGETRAAAD
FT                   EPTAKGLQAAPAAKAPGAVNTADSMTDYQWAYDNTGDYFSSLPGFDMHYDGWNQDSGAA
FT                   GSDDVVVAVLDTGVDHDNPDLKNKMWRRGTLNLPGGEHGISYASADPADTSDPDGHGTH
FT                   CAGIIGAEWRNGGVSGTSQNAKIMALRYGSFISTVLACYDYMASAIDLGVNLKAVNCSF
FT                   TSSGSPKSLDLAVEKLGKMGMLSVYGSANSATDNDRTGILSSTFINNPYAVVVDAANAY
FT                   GLMAAYSCYGERTTDIVAPGSRILSTWLTDKALYYPEFSDNNLFYEGFEGSDSLKFYTS
FT                   ADPSKGELCGEISGKKVYNGKNSLKLQGTAEGNAVYSEPVDLTQASGFDSSEAYRFSLN
FT                   VAGEGGHSCGQAEVMVRLTDGSFALLGDGTSLARGRDGGFNSFNTGAAQILPKNTDYAN
FT                   FQLCLTLKGLDMVFPNGHGEYVYEDGPVYIDNLGIGSTTLPYNYSDGTSMATPMITGAV
FT                   AVLAGRYPDDSAAMRTARTIGSVTKYDEFKDKCVSDGFINLDQSVTDNPYPVVNAANIA
FT                   EDTVTIDGYFFGKNPTVTIDGKAAGIQSSEAFEDGGQRLVVSRPADVSGMARVSVTSSE
FT                   KGEGHQSYDFGKVKNVDYFENTLPLPEDPAFYDIDAYQMVGYGDYLYCIPHYYTFPELV
FT                   EKLWRFNVNTKAWDQVTLPENTVMFNATAVVWQDKLLIYSYNTGVEDPAAAKPVSIGMI
FT                   LTYDGSTWTQTPGWNDKTFPNSAALVNNDGQLLAVSGIFNNTFNNTVYSVSLENHTLTP
FT                   MGNTLRAVSGPLVSAGHGQLIVTGGLESGNQNGTLPGVERLTLDNGVYVPSELDMTGIK
FT                   TGNLSGFASAAVKDGFMLVGPETTDASTDTYTLGTSGGLTPYKKRVDNAALANPSAAAY
FT                   KGQFYVLARTYTSDSNFIFKSTAVQTEEPVNPDNPVNPDNNNSQAANVGTGITDTLPLA
FT                   GAAVLLLLCAAGIMVWARKKRKLD"
FT                   /protein_id="YP_003958369.1"
FT   gene            complement(370030..373092)
FT                   /db_xref="GeneID:9882290"
FT                   /locus_tag="ELI_0390"
FT   CDS_pept        complement(370030..373092)
FT                   /locus_tag="ELI_0390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="M6 family metalloprotease domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826013"
FT                   /db_xref="GeneID:9882290"
FT                   /translation="MKTYAKHVGLAALLLFALLLFFMPGAQAQEPAGTACAPDAETLEA
FT                   YRADGTLAERQAYYESLSLNQTDPGLIAQAQAQESGSASLRAVPSGWKTGMATTGDANI
FT                   LLIRVDFPDYRFSGNDTEDALRQIAFGPAGGGQPGYPYESLSAYYERSSYGQLHISGQA
FT                   ASYTAANNRDTYSRNMAGLFKEAMTALDAQGMDFSQFDGNGDGLMDGVYIHFAGPDTGW
FT                   GSPWWSQKAHYEGAPFVLDGVALSDYVTLHDNSANGARTLIHETGHMLGLADYYSYTAQ
FT                   TYENGIRTFDMMCDNTGDHNGFSKWLLGWINPEDITRVSAADGSAALTLSAISGNDGSK
FT                   IAVVSPTDSGMFSEYFLIQYDVPGLNNEGIYYPDVPDSGFRVFHINAALNADGSNFMYM
FT                   NKTPAEPKLIEAVGPEGQTAPYMPLFYTKGMRLAPDTTPDSSFFGGQYQAYTGVVLENL
FT                   DTQNASLSVRFENTPPVVPTLTLTPDSALDNQTNLPTFTFTANIPVRDHTGDGARTPIT
FT                   LEGPDGTSYPMHCAIDGTSLALGLADSSNIANLKANTAYTLVFPEKYFDLGQGIYSEAL
FT                   RFSVKTGDIPAVQSSGVLEQPSSFGGKETELAALSDGRIFRFMGRYKPSGETYFSYFDQ
FT                   VQLLLAGTDLQTSLLNVEGIPDIESYSDIHGLALSDDTLALALYNKTNDTTSLFSVDLE
FT                   GRVLAGPYTLSGSPKLFSGGSSVKAWRSFYGNGEELPGIQLETIDFKNPVATSFIYGEG
FT                   LNSDLKLFPVDTASYAVQERISTSLWEYKNYLSLYSMDSDTPKWRTECTTSNAIIGVAA
FT                   QNGGIARIETDYGMMDAHAASFSSQYKNVLVTAFDANGRLTEKSKVVGRIRSAVNETQN
FT                   VLSVKGGASGIAVESTFLAPALPFIENNNDTECRDYLFIGSDGQTKALSGQNASPGLWT
FT                   GDRYLITGRDLDTGKCLYYQTDTVFADTPDVPVTPDTPGGSADAPADSAGTSGNLSTGI
FT                   LGTQASLYMCLALLGAALCGLAVYRKNSGQK"
FT                   /protein_id="YP_003958370.1"
FT   gene            complement(373180..373383)
FT                   /db_xref="GeneID:9882291"
FT                   /locus_tag="ELI_0391"
FT   CDS_pept        complement(373180..373383)
FT                   /locus_tag="ELI_0391"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826014"
FT                   /db_xref="GeneID:9882291"
FT                   /translation="MVTCALFRILILILSSFPKQLFCYLESGTTAACFYYLFFIVFLED
FT                   YMRNKLTGSYFSIFKRIFFNKI"
FT                   /protein_id="YP_003958371.1"
FT   gene            373346..374089
FT                   /db_xref="GeneID:9882292"
FT                   /locus_tag="ELI_0392"
FT   CDS_pept        373346..374089
FT                   /locus_tag="ELI_0392"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826015"
FT                   /db_xref="GeneID:9882292"
FT                   /translation="MRIKIRKRAQVTIPGEIMQALLLKEGDELELTIKNRVICLALVRE
FT                   AETKPHQKISVPGRESRVKSSMTPVPLVFLCFGGFSIYYHGVTMGVASKKAKEMLALLL
FT                   LQNGKPLSKRVIAELLWPNKMPQKSMACFYKANQYLKNIPGFNELSPLVNSGGALSLDM
FT                   SRIYSDINEFSQLLRQAPTIENRRRMLLLYQGRLFQNETFEWLSSQEAYFDMEYLEAAE
FT                   WLIREYKSHNRIQEAQKYISLILEE"
FT                   /protein_id="YP_003958372.1"
FT   gene            374178..374684
FT                   /db_xref="GeneID:9882293"
FT                   /locus_tag="ELI_0393"
FT   CDS_pept        374178..374684
FT                   /locus_tag="ELI_0393"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826016"
FT                   /db_xref="GeneID:9882293"
FT                   /translation="MMKKQENFNDLIASIQEAFIQANKIAETQHLDMLSHYFDQDKKPI
FT                   CFQMAYPEYDENGKVVYRTLSVPKLCVVPLSSLKLKEISVDFKVKLYGKIALKKSEPQQ
FT                   QTNALKGATSGQRPPQETGYLGYIPGLGRRDSSDNYAQISLKFESEDPPEGLMRISDQL
FT                   TKVTL"
FT                   /protein_id="YP_003958373.1"
FT   gene            374703..375374
FT                   /db_xref="GeneID:9882294"
FT                   /locus_tag="ELI_0394"
FT   CDS_pept        374703..375374
FT                   /locus_tag="ELI_0394"
FT                   /gene_family="HOG000010501" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826017"
FT                   /db_xref="GeneID:9882294"
FT                   /translation="MPEGLVSMQDQFSGLDMAALVGGPLKAACDAQMMLANSTARFIED
FT                   VGLEPPAADGSRKVRTTSFSFTRAATAPDGASIGSEEVMMNVPFLSIIKIPSLMVNAVD
FT                   ITFDMEVKSSTSSESTSDKKGELEANAGLKIGPFHMDVKIKGSIACHESNTRSSDNSAK
FT                   YHVEVHARDSAMPEGLARMLDILATASAPVAIEQKKPEGPQNPEIPSPPKPKKPEQPIE
FT                   S"
FT                   /protein_id="YP_003958374.1"
FT   gene            375381..375608
FT                   /db_xref="GeneID:9882295"
FT                   /locus_tag="ELI_0395"
FT   CDS_pept        375381..375608
FT                   /locus_tag="ELI_0395"
FT                   /gene_family="HOG000010502" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826018"
FT                   /db_xref="GeneID:9882295"
FT                   /translation="MNDQFSLSDVGYVYRVIVGNDIPEQQPDEAKVQKQLALLNRCLTE
FT                   VPRGRIIGQEKNFYLLNIGEHQVVMQYIVY"
FT                   /protein_id="YP_003958375.1"
FT   gene            375733..375984
FT                   /db_xref="GeneID:9882296"
FT                   /locus_tag="ELI_0396"
FT   CDS_pept        375733..375984
FT                   /locus_tag="ELI_0396"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826019"
FT                   /db_xref="GeneID:9882296"
FT                   /translation="MEFEVTFTVDDEINPNEVTGTMSKDTITTGCPYTTVAYTYKNAGL
FT                   GQFEFKDAVKKDFTEKYGPKYTMQNTFFKWESKSRKTE"
FT                   /protein_id="YP_003958376.1"
FT   gene            376854..377933
FT                   /db_xref="GeneID:9882297"
FT                   /locus_tag="ELI_0397"
FT   CDS_pept        376854..377933
FT                   /locus_tag="ELI_0397"
FT                   /gene_family="HOG000166283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826020"
FT                   /db_xref="GeneID:9882297"
FT                   /translation="MKKMIDRLIGIVRNAVFGQKILMRDLLENWLKEKEKEGKVKIKTL
FT                   ENYRRQVRVHLIPMLGEYEVQDITTEVLQDFVFYLEEENGLNPTTVKNIFGRIATVLKK
FT                   AHEDGIIFENPCNSVVLPKANARTGKALNRLEQDKLEKVLSNDEGSKTLSVYIALHSGL
FT                   RISEVTALKWKDIDMENEFIYVRHSFQRISQQMTDGTHKSSLLLGKPKSLKSVRSIPMN
FT                   DLLAMKIKEYYKGLEKWQRKGEMFVISKGNGSFYDVRTIQRYFNDVCKVACIDHHHFHD
FT                   LRHTFATNAKACGIDIQLISEMLGHAQIKTTMDIYVHPSDTDKQNAIQLMNRLNKDRCP
FT                   HRLRKQIENMLEEIYPKVV"
FT                   /protein_id="YP_003958377.1"
FT   gene            378026..378655
FT                   /db_xref="GeneID:9882298"
FT                   /locus_tag="ELI_0398"
FT   CDS_pept        378026..378655
FT                   /locus_tag="ELI_0398"
FT                   /gene_family="HOG000266481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826021"
FT                   /db_xref="GeneID:9882298"
FT                   /translation="MLEAVNEYLRNCPGEVQRHCQRTGVLMDEILKQLNQGSEMSAVWL
FT                   AGHRPYYYHDLGKCIVPGGVLKKKQDLSPGEWKIMKRHTRFGSILFDQLRELAENSEEK
FT                   DFCRIGAIVCRDHHERWDGGGYPSGLKGAAIPFLARVCAVADSWDAMVNNRCYRRRLSA
FT                   DDALSEIEKGIGTQFDPEIAAAFLRMKKCAIRRESIKQRSVEYIVR"
FT                   /protein_id="YP_003958378.1"
FT   gene            complement(378891..379022)
FT                   /db_xref="GeneID:9882299"
FT                   /locus_tag="ELI_0399"
FT   CDS_pept        complement(378891..379022)
FT                   /locus_tag="ELI_0399"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826022"
FT                   /db_xref="GeneID:9882299"
FT                   /translation="MLKTNTNKGLKSVPPLIKSFLFIVMSFRYFNLFVIHDNLSSIA"
FT                   /protein_id="YP_003958379.1"
FT   gene            378955..384273
FT                   /db_xref="GeneID:9882300"
FT                   /locus_tag="ELI_0400"
FT   CDS_pept        378955..384273
FT                   /locus_tag="ELI_0400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826023"
FT                   /db_xref="GeneID:9882300"
FT                   /translation="MNKNDLIRGGTLFKPLLVLVLSIVLLLSGAVLPAREAKAAPVTPT
FT                   REVDLATGSVTVKDKEVVRIYQNSGTTTGNVISVPNNINATVILENLNWQGGGVFVSVN
FT                   QGANVTFLLKGENTAKSTGSEDRTVLGLWDKANVTIADYDDGGVLDLSQIGNAAYSYPV
FT                   IGTCWGGSASLTVNSGMVKATSKYGAPAVGADTYNSILNLTINDPAVVEAHSFGVGAAI
FT                   GTGRTVDGNSAEVNITINGGTVRADNPSLVEENGNRRSGAVIGTGHIEKGTQNVTLNIP
FT                   KTSTAKIYLTSYYGGAAIGGAGNARVTAYGMLNSSTKQSVTSNINGGMIDIVVRGQAPG
FT                   IGTGASVSYRQNIEANIGGGNITIHNDLDTSDTKAGDATGPAIGVGLLAQNQTVTCNVT
FT                   GGKLQMLSQDKGDKLATSPAVGVGAMNKNNPTTSKWTQSKGNTVNFNVKGGTVSAETRS
FT                   SDKTIMDVGAIENNTFNVKVDSGSFNVVNGRMNVTAQNSATNNVYPATISLGNMSGDNT
FT                   VVENATIDGKSYGRNLKTQSGKLYLWTTPGTNKKINASVAGDSRVYANPGANLAYGSGF
FT                   TFTDPNVSLKKTVVPADLGRFSIKSVGEDNVTVQVSSVVSGVPVAIQAFDHATGQSVGN
FT                   PQNVTSGKTDYTFTGLSKNKTYDIKTFVSDQDNYWEAESAAFMVKPFAYAPELADAQLR
FT                   GPYEGSVAVGNGDYTYALVPGAALPEGLKLTSDGRITGTPTATGRTTFNVIATATDEGI
FT                   AKGNSRTATVTLNVVPITSEATLVDELGQPLEGCSCKIETKTVNDEIGVGDVVAYTVTP
FT                   CPQHTFVKFNLNGEDISAGVKVVDGIAKYSYTVKPGDTKLNMKAFMDERRITGLEKVGE
FT                   APDLDLFANDEKNSSADQLQSHIDNSVMLKATYNDGTTKNGKASELGLSWATNDAYSLK
FT                   GNTYHYVVRGGDASAEQVLTVNSVNAELDPLSDIMRTVSAEGYPTIEALGLPQTADCQY
FT                   PDGVTVSEADRHPAIQWTTKVPADFGKTATEAPVVFEGTAAVPEWATIASNAVSVNVSI
FT                   SDVKITGLEKVGEAPDLDLFANDEKNASADQLQSYIDNSIILKATYNDGTTKNGKASEL
FT                   GLSWATNDAYSLKGNTYHYVVRGGDAMVEQVLTVNSVNAELDPLSDVVRTARTEGYPTI
FT                   EALGLPETADCQYPDGVTVSEADRHPAIHWTTEVPQDFGKTATEAPVVFEGTAAVPEWA
FT                   TIASNAVSVNVSISDSALKITGLEKVGEAPDLDLFANDEKNASADQLQSHIDNNIILKA
FT                   TYNNGTTKNGKASDLGLSWATNDVYSLKGNTYHYVVRGGDAMVEQVLTVNSVNAELDPL
FT                   NDIMRTVSAEGYPTIEALGLPETVGCKYPAGVPVSEADRNPAIQWITEVPADFGKTATE
FT                   APVVFEGTAAVPEWATITSDAVSVNVSISDKVILIPEIKIADKVYDGTKDAVVAETPTL
FT                   DPASLTAGTDVQLEGTAVAEFNAADVGNNISVKVTGLTLTGADADKYSLDLNRVTGKII
FT                   PATITLSDISMEDKTVTEDGNPQTIEIKGTLPEGVSVSYTYEREGSGEAVNLPPSVPGT
FT                   YTVTATFKTDANHVVEPETMSAKLVIKEKTAGVVVEEITTGLTEEQAAGMNATILKNGE
FT                   AVQVGDTVMAGDKLTYQFAPAAVREAYVPYGFTMNGETVVLTKLAEGKGYSAEYTIKEG
FT                   DTALKADAKCVLLGNFSGDEVIDIIDAQKIALALASGENIEDMQKAAGDVNFDGIVDII
FT                   DAQKIAQYAADTSIVF"
FT                   /protein_id="YP_003958380.1"
FT   gene            384381..385838
FT                   /db_xref="GeneID:9882301"
FT                   /locus_tag="ELI_0401"
FT   CDS_pept        384381..385838
FT                   /locus_tag="ELI_0401"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ig domain protein group 2 domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826024"
FT                   /db_xref="GeneID:9882301"
FT                   /translation="MKAKTLSSRLIAGFLGLSLLATAAIPGMMPRAKAAGDSAVFSAVA
FT                   DKTEVHPGDTFTVAVSATPEPTVGSYEVALQYDVTKLEVAGTTDSSYAPIVEPGGGGFT
FT                   GVYASWFDMTGKKPMTEATDLFTVTFKVKDGATGDAGLEMYLKTVANAAADRITANCSG
FT                   TASSVNITEAPPAPVPVTGVSVSLDASELFPGQSAQATAVVEPAGADNPNVAWTSSDDA
FT                   VATVDADGKVTAVAPGTASITATTEDGGFTASADVTVKADIVKALAVAAAPTKVDYLQG
FT                   DAIDLTGGKLTVTYEQAGDVEMDMAQATAIVDMNQVGEAVPVAIEFGGQKLENAFTINI
FT                   KAATVTALELIQAPTGKTTVGDAMPNLEGGMMKATINDGEAVRELPLSDAEITGYDKTK
FT                   AGEQTLTATYGGKSIEFKITVSEASAGGGGTIDGNTDGKTPSNVKNPVTGLNFSQDAVN
FT                   GFGFLTTGLAILVVSGIKVFRMRRKMQ"
FT                   /protein_id="YP_003958381.1"
FT   gene            386086..392964
FT                   /db_xref="GeneID:9882302"
FT                   /locus_tag="ELI_0402"
FT   CDS_pept        386086..392964
FT                   /locus_tag="ELI_0402"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endo-1-4-beta-xylanase precursor"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826025"
FT                   /db_xref="GeneID:9882302"
FT                   /translation="MKKKMRTKEIPQKVAAGVMSGVMLLSSTGATALAQEIQGTELFKG
FT                   DDAKQTAKGIVKTAAQSAPTLASRTDTTVTLNSEAELYYAYTEANKAPSEYTWTKASGD
FT                   TVTISGLTAGTSYDFVCAADNQGTGMSPASTIYTLQAAPADPENCAVVTYPEETITINA
FT                   GYEMNTQKDFNGDQVANGASISAFIGKNLYVRAAKNGEIPAGVAAAYAIDARPENTTSV
FT                   PADQITRSTTGFHFTPNPQGVYQYTGGGQTTPKTIVGGKVTGLQPGTVYSLIDYTAATV
FT                   NAFKSGTNTQEIRTKSVVAPATKDGPGQSDLANTVKADKTEADLGETITYTVTYGEGYT
FT                   PSMTIGGDERAFDTAAVDPETKTAVFQYTVKEGDTTVNAVAHFNERAVKGVDAQAPKTL
FT                   YANDPSNQSAQALAESLPKKVGVTYDNQTKGEEDASWQLKKESAWNIKGGDYTYEAQVG
FT                   EARAAQDVKVLPVVAAFEPIGDIKLPVKTGGYTAKELGLISSIEVTYTSTGFETQTDKA
FT                   VPVVWSPAVPSGFGANQTDRATFTGTVSVPEWATIPDPTLSREVTFGIPVTVSGLVFYD
FT                   KPYDGTDTASWNVNDIDKMSLKVNGTTLQGYALKKDGSATIHLDSPNVGKRTIAGVSDL
FT                   SITGPEADQYVLDFSGMTATITKQTNVTAPDAVTVASDSVTDTSAAVSVTNPAEGYLLE
FT                   YASAEAGQQPTIWQTSGTFTGLKPGTAYDFYARYAETSNNAASEATKTATSTKTNAQVA
FT                   APTKAGAGKKDPACTITADVKHAAKGETVTYTVKPSENFSVDENTSLKINGQAVQMTAS
FT                   GQPDEKGLSTYTAQYTVTENDTVIQAEATFNKRAVKTVTAPDAITTTANDPINASQQAL
FT                   EQSLPQTLEVTYDNGVTGQELVQWAKKSGSPDWDAKGKSYTYTGTLFSDKSKTAEITVT
FT                   IKAVTATIPPIPEKTIAIREKAYTMEELGLGSTFEVSFDNSVAPMDCPVSWDPNTPGDF
FT                   GTTGSKETSKTFAGTVTLPAWATAPSAGTTVDATVKTATQLTVTGITVTPKAYDGTTEA
FT                   TLVLDGAQLAGTIAPGDTVEFNTNANLTAEFDNANVGTDKKVTVTGDALTGANAANYII
FT                   DWSACDIKGKITKATGITAPAAPEVDAEKTTSTSVTLKEVDITDPTAVAAGARVQYSKD
FT                   QVNWQQSPVFTGLEPGTAYAFYARVGATGNTEASASSAASPTITTKVAVVAPVLSVDGD
FT                   CTAGQACKVELYDAENKKINDLLEADAGTKVTYKITYCDSHTMHFTFKGNELALSTTTD
FT                   GMRKAADEKRTWYYDYTIHPGDTTVTASAEAVPKTVENFAAAPITMAANDARNQSPEEL
FT                   LKSLPKTIQFQYDNETEGTDRVENWKLKSGAWALKGADLTYEGTLKNHPKTKVTQSVTV
FT                   KPVNATVETTVGKITLKERPQGYTLADLEGEGLPMTASIGYDSYVDPADKTTAITWQLP
FT                   EDFGKTSGAVDITGSVQLPQWATAATSEVLSAHFDITARPQVKLEIQADDVTKTYDGSA
FT                   VLENVPVKLDPASLDAAHKDVALSAETATIRFQTPNVGTGLTYTVEGLTLTGADADWYA
FT                   LGATYKNGVIVKAAVAAPAAPEADSISLNSIALKPVVLEGAAKAAGAKVVYQISKDNGT
FT                   TYTDNPADKYSPVFKNLESGKAYSFKASVEATANTEASEASAGLTIRTKFNPVAPIIAK
FT                   TSPCEGGECKVEMTDAQGAPMTVKSEVGTGDVIHYTITSCDNHTPGKLLINSKTEVPLS
FT                   GTGKVRTGFYTVTAQDSQLVSQVTFNDRQAVRVESPEPIEMYANDDRNQSAESLANSLS
FT                   KEVAVVYDNGTRGTETIRKWNPSGTAWNPRGGSYTYVAAVGGDGQFFTLQNVTVKPVSA
FT                   VYEPFADTTLTVREEPYAKEELGLSDTLAVTYTSEDGVVKETRDEPLVWTPEVPGDFGT
FT                   TETTQTFTARLALPAYAGGDKALSKTIRVSEKSPLVIKGVKAEDKVYDGTTDAALDFSQ
FT                   ATFTGDPGFGSYTVDWEQATGTFEDASAGDHKKVTVEGIVLSGKDADHYILSVEQVSAN
FT                   IQKAEIKGVVFESARFPEDGKPHSLEAVYPEGCGITGVSYTYEKDGVKTTEAPKEAGVY
FT                   KVTATFTVDDNHLAPAPMTATMTIGEAGGTVEEAVVEGLPEGVTGCTVTADKDHVTEAG
FT                   ETVTYTLTRNRERKSYVPAVMTVNGQALPLTYDQESGQFKAAYVAEDPTISIAAAVQYV
FT                   LLGSFTGDDTIDIIDAQKIALFLTAGETPSERQKAAGDVNFDGKVDIIDAQQIALYLAD
FT                   PEKQF"
FT                   /protein_id="YP_003958382.1"
FT   gene            393058..393342
FT                   /db_xref="GeneID:9882303"
FT                   /locus_tag="ELI_0403"
FT   CDS_pept        393058..393342
FT                   /locus_tag="ELI_0403"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826026"
FT                   /db_xref="GeneID:9882303"
FT                   /translation="MLNGLLGMLASGFAGAGLAIHQNLKRKGENRRYRLVTGQFTLLAG
FT                   AFGVYVSLEGIGAFLLSLVSFVTALAIMCCMCAAGNAAENERLKENQED"
FT                   /protein_id="YP_003958383.1"
FT   gene            393346..397074
FT                   /db_xref="GeneID:9882304"
FT                   /locus_tag="ELI_0404"
FT   CDS_pept        393346..397074
FT                   /locus_tag="ELI_0404"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826027"
FT                   /db_xref="GeneID:9882304"
FT                   /translation="MLKKICSVLVTASLVLSQTAAFAQTQNTAETPGSVTVKENGPKEE
FT                   KRYVSYGGHLWEVVEQVDGRLLLCTDPAIDKKLEMDQALIEKDAEAQYQFLNQDFLESF
FT                   NAVEKAHLDKVTLQKKTTEDAQKARGAKAVKVFLPNDDTVEILDADVQKALEKFKAGQK
FT                   TEAPEAAPVPSVAIPEALEEAPAPSVATPEALEEAPAPSVATPEAPEPAPVPSVAIPEA
FT                   PEPAPAPSVATPEAPEPAPAPSVAIPEAPEPAPAPGVEPPKVNQPEETEEAILGDVNAD
FT                   MKVDILDAQLIALSCAAGGEMEASRKARGDVNGDAQVNIIDAQQIAQNAVEPLDEGMGT
FT                   KKMVSARAASVMKSSALESQHFAAPDTRPEGLAFGILVNPEGLEQSGAGTKEDPYTFSE
FT                   KKAAPTPAVPNKVPEQPEVSEAPETTLPFTPFSKEELENPRLNNVEQAFDQLSTAGYKT
FT                   REPSAAGFPSDLITTTKNHIQGLGYYGDYTIINVNGDGSPGKIFIYDQGGMVQTLVPPQ
FT                   TKSFHTSGMQVVGDMLIMMNGLHGDPDSYILMVDLRPLKEGQEAVMLPRETGPSMTGAC
FT                   VGATNYTAADGTERLILIGVRNQCFESVIPEDGVSFNWVERQYDGPNLKENQNIALVTD
FT                   VNNQVYLVAFASEASQQGSITDLIDTNGFDGLNFDDRLELYKVDVHSNPNGIKVEFLKR
FT                   KDVQAYDDDMLVFGSHFRYGATLTVDSPEGFSVHTTRRAPGNAHFNILGSLGSDVISAL
FT                   FGGNTLPITTYTAGQSYFLENKSGTVSKMDVTYVTKEGEQKTQTTNNVALGENQDIRIP
FT                   IDAKDIRLDFYVSTGSSWKPVKTLEYKEANGNARRYKITGTVFNPTLHEGVVLGEGIQY
FT                   QIKVKTGTAFGAGTDSDVYIRLVGDQGTTDEVLLNYGMTNQFNTRGNPFETKGYDVGVF
FT                   NFNQDVGKIKRIEVRTDRSGAGADWLLDAIEVVPMYNTTETQTKKFDIHQWIVNDTWTS
FT                   FSNTAEDSSQYRLKINTGNVKGAGTDSDIYVKLTGTKGETNEVEVSGLYNGNAFEKGTS
FT                   HSVVASFDQNVGEIQKITVRSDMSGVGADWFLDSVQVVPVWNNQTQDGEKTFDCKEWIV
FT                   NKNPHTYSLDQNAITRYRMTVKTGKLSWWPKGEGTDADIYVRLIGDKGQTNEVEITSLI
FT                   PGNALERGDTDTFTVNFENAIGNVKKIQVRSDMSGVGPDWYLERIDVQPLFGNKDVGKN
FT                   VRFAFNQWIDIKKVYEK"
FT                   /protein_id="YP_003958384.1"
FT   gene            397107..397832
FT                   /db_xref="GeneID:9882305"
FT                   /locus_tag="ELI_0405"
FT   CDS_pept        397107..397832
FT                   /locus_tag="ELI_0405"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826028"
FT                   /db_xref="GeneID:9882305"
FT                   /translation="MRRRYVSKQEHPDMEKILKTLKEEKGYTFNIEQNVAINYGLCVGA
FT                   DVLGTANPAYSGAQLSEIFRVQSEGLDDTLLRNPALGGARAKELRLGLEAGLDMKPLAD
FT                   VGMPLTNVQWLRRAMAKGIDIRLYPEFQDGITKIIKKYNELCGGEKPKGSKQCTLRVVR
FT                   IKEEVNEMVVQYDDLEKLEDAIGRINAAHFDKVQRLKEKLYESDVHTLGKRVLEPVEQQ
FT                   TYFEIVKEGNPTENRNDSY"
FT                   /protein_id="YP_003958385.1"
FT   gene            397849..398307
FT                   /db_xref="GeneID:9882306"
FT                   /locus_tag="ELI_0406"
FT   CDS_pept        397849..398307
FT                   /locus_tag="ELI_0406"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826029"
FT                   /db_xref="GeneID:9882306"
FT                   /translation="MFQLEDILENAQKLERHGDYKKARHLYKRLLKKAPDSEIARISEE
FT                   RLVRINAQQKTAEKKGPSLEWTAFYILVFSFCGAFFITYPLSFVIESSSAVLNLYLGLV
FT                   CAAELVSAGLLMVHKLYCKRAFKKFSMLTFLLDVLLILLGVGVMIAGA"
FT                   /protein_id="YP_003958386.1"
FT   gene            398438..398986
FT                   /db_xref="GeneID:9882307"
FT                   /locus_tag="ELI_0407"
FT   CDS_pept        398438..398986
FT                   /locus_tag="ELI_0407"
FT                   /gene_family="HOG000166284" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826030"
FT                   /db_xref="GeneID:9882307"
FT                   /translation="MALAKRLKELLEALEMDLETYLKKHYELFEAVDTGYVAKDGRTHF
FT                   TELIYHGHSRHVCRYCQRALKKKTLRLVKRNGRNHVVNGLSKEVEDADGNLYVLWVCSC
FT                   ECRHCARRQRVLPVFAGRWLRHTLFTVAHTLLHVFENDELDEKPLKPRRGRPVLTMPFY
FT                   GEVSTVYRWRQRIKIIFDL"
FT                   /protein_id="YP_003958387.1"
FT   gene            399110..399640
FT                   /db_xref="GeneID:9882308"
FT                   /locus_tag="ELI_0408"
FT   CDS_pept        399110..399640
FT                   /locus_tag="ELI_0408"
FT                   /gene_family="HOG000166285" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="toxin-antitoxin system"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826031"
FT                   /db_xref="GeneID:9882308"
FT                   /translation="MNCKQTTPSTGTDKKAFKPWCGSCALKQEDRILGSFETLPAIDKR
FT                   IELCFLEKQLDALQQVYEEKARIYLRETEPTPPSENRLMEEELECSVEHLVKKLQAQGL
FT                   DIGLHAFYAWLRKKGYIRYQKNRKLTQVPTQKALDEIIMLDEDRIRITLFGQLLFAKML
FT                   FEEHGMDPKAVRL"
FT                   /protein_id="YP_003958388.1"
FT   gene            399717..400343
FT                   /db_xref="GeneID:9882309"
FT                   /locus_tag="ELI_0409"
FT   CDS_pept        399717..400343
FT                   /locus_tag="ELI_0409"
FT                   /gene_family="HOG000166286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826032"
FT                   /db_xref="GeneID:9882309"
FT                   /translation="MNYLTEILAFYKWLETHPMSPLLQAYWHLLMYYNNKAAVRAEDGS
FT                   WHWPVDFKVPNTVLMPLLGVKDRRVLLRQRGYLIDHKRVTYQKDKGQRAGTYRLVPFDR
FT                   GLGMAALRAETGDSVTQIWTQAVPPPVTGVSPFININHKQASLLYSNQEDAPFIPRFNL
FT                   LPQITEEEKAAIRAQYPGDEVAAFNAIWAAREEKQKEALKLEVTT"
FT                   /protein_id="YP_003958389.1"
FT   gene            400340..400540
FT                   /db_xref="GeneID:9882310"
FT                   /locus_tag="ELI_0410"
FT   CDS_pept        400340..400540
FT                   /locus_tag="ELI_0410"
FT                   /gene_family="HOG000166287" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826033"
FT                   /db_xref="GeneID:9882310"
FT                   /translation="MNRYGKDPAIIRCRRAYMVEAECRMQAGFYARSAEEAEDDFNELS
FT                   AAVEDQFPGLVLEITDVYEDA"
FT                   /protein_id="YP_003958390.1"
FT   gene            400550..401185
FT                   /db_xref="GeneID:9882311"
FT                   /locus_tag="ELI_0411"
FT   CDS_pept        400550..401185
FT                   /locus_tag="ELI_0411"
FT                   /gene_family="HOG000166288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ECF subfamily RNA polymerase sigma-24 factor"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826034"
FT                   /db_xref="GeneID:9882311"
FT                   /translation="MSNYKAIDDLVATYKHGQESPDNSPERESSRVAGQRLVITFKPLI
FT                   LSTMQCMTGIGPADYEDAYQDGVVAFMEGMKKYDETKGGRFNAFIKTHLQLYYRKWQSG
FT                   QFNHSVTAEKLLSAPAGSSDGLTLEEVIADEAIDLEGCYIEREDQQRLWQSVHALSARQ
FT                   GKVLYQSFHESKSLVQICKEMGVTHKAVRKLRDKGLKNLKKSLKGVPF"
FT                   /protein_id="YP_003958391.1"
FT   gene            401258..401482
FT                   /db_xref="GeneID:9882312"
FT                   /locus_tag="ELI_0412"
FT   CDS_pept        401258..401482
FT                   /locus_tag="ELI_0412"
FT                   /gene_family="HOG000166275" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826035"
FT                   /db_xref="GeneID:9882312"
FT                   /translation="MAVEETKKDTKLKVTVNHGEKLGKIERSSKSYGDVDHEATKEQMR
FT                   SAYKHITGMQEPIGEGCERVTTSDITEIV"
FT                   /protein_id="YP_003958392.1"
FT   gene            401515..401745
FT                   /db_xref="GeneID:9882313"
FT                   /locus_tag="ELI_0413"
FT   CDS_pept        401515..401745
FT                   /locus_tag="ELI_0413"
FT                   /gene_family="HOG000060671" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826036"
FT                   /db_xref="GeneID:9882313"
FT                   /translation="MAVEQKKELVMYFERTDGKEFRMTIPHYKEGLTDEEVKTGADGIV
FT                   TDNIFKPEGFPLAKLSGAKRVDTTTTDVAVE"
FT                   /protein_id="YP_003958393.1"
FT   gene            401796..402356
FT                   /db_xref="GeneID:9882314"
FT                   /locus_tag="ELI_0414"
FT   CDS_pept        401796..402356
FT                   /locus_tag="ELI_0414"
FT                   /gene_family="HOG000253777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase M15A"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826037"
FT                   /db_xref="GeneID:9882314"
FT                   /translation="MKNFYKTISRRLILSILILISCVFLTGLSIAPEEVPVPQAEPSVS
FT                   APSPPPETPQDGAVIDHPLPEDPILTKGPWASEHFLMSEYACDCAGYCDGWPAEMDPEL
FT                   LGKVEELRCVFDQPIIITSGVRCERRNAEVGGIENSWHLSGHAADLYCPGVPCDEVAAA
FT                   ARALGLGVIEYPDRQFDHVEIWR"
FT                   /protein_id="YP_003958394.1"
FT   gene            complement(402697..402816)
FT                   /db_xref="GeneID:9882315"
FT                   /locus_tag="ELI_0415"
FT   CDS_pept        complement(402697..402816)
FT                   /locus_tag="ELI_0415"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826038"
FT                   /db_xref="GeneID:9882315"
FT                   /translation="MCIFLQSSFFIPNFGPTCPFCFLGSFLDFGYLSRFHLFL"
FT                   /protein_id="YP_003958395.1"
FT   gene            402815..403618
FT                   /db_xref="GeneID:9882316"
FT                   /locus_tag="ELI_0416"
FT   CDS_pept        402815..403618
FT                   /locus_tag="ELI_0416"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Site-specific recombinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826039"
FT                   /db_xref="GeneID:9882316"
FT                   /translation="MKEYGYIRVSTKEQNEARQFEAMKRAGIKTKQLLMDKQSGADFER
FT                   PQYQKLLKKLHRGDSLFVKSIDRIGRNYTEIKEQWRMLTQEMGVDIIVLDMPLLDTRKH
FT                   KDLTGTLIADIVLQLLSYVAEVERNNIKERQAEGIAVAKKQGKHLGRKPLTIPEGFEPV
FT                   CQRWLKGEISQNKAAALLGVSGGTFKRWVTQSGQYPIPLRMRNGRKLKSEHFAAVYEKW
FT                   KRKEIKTKDAAKVLRVSPPTFLKWAHEEDAKEIESNKKECKKNSL"
FT                   /protein_id="YP_003958396.1"
FT   gene            403681..403791
FT                   /db_xref="GeneID:9882317"
FT                   /locus_tag="ELI_0417"
FT   CDS_pept        403681..403791
FT                   /locus_tag="ELI_0417"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826040"
FT                   /db_xref="GeneID:9882317"
FT                   /translation="MVKFFLIKFPYIYVYKEVKHLNMRQIAKIFYKYIFC"
FT                   /protein_id="YP_003958397.1"
FT   gene            403928..405517
FT                   /db_xref="GeneID:9882318"
FT                   /locus_tag="ELI_0418"
FT   CDS_pept        403928..405517
FT                   /locus_tag="ELI_0418"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826041"
FT                   /db_xref="GeneID:9882318"
FT                   /translation="MKKTTIKRMLCVLLALCMLLPITSEFTNTVLAEKALDQSGGGSSS
FT                   YSNNSAGPQKPENTESQRQSPEKDAMESPAPSAAPENKTDSLPPLENKKLPKEKEANLL
FT                   QSGTENAYINLTPGNGETTYMAPDAGVISVNYRPTGDEAGKYIDILGFTPSGLEITALP
FT                   VADGDIVASAGYLEKSGDKGMRVYIADTVTTADDVAFQFSMKVSDEKQFMDTLRIDPAD
FT                   SWITGLEATEKLGSETAVGIKAKSDFKVTAKNMESTIYTRQNTITDTSFPRSPDNLFGN
FT                   SGMVLAVKAEGITDLNTGAWKTQETEYTVKRANATTRTDGGMDPNYKEEITDRYMKGVE
FT                   LKIPLPNGVKVTGLPAEQTSGVKVSYDSTANYLTLTCDTLDGTGGNEVPAELKFRMTLD
FT                   FTGVGANSQQLSIGKWHNFYDNNVDPSLTNRNETGRPWHIKGVIYGQHIDQSFYDRSAL
FT                   VPDSIPCTPIIGKDKARPFSFKPNEYKTYTELTGSNMALEPIRSYQSAIPYERNGPTNP
FT                   GLADTHGLYNRT"
FT                   /protein_id="YP_003958398.1"
FT   gene            405495..409100
FT                   /db_xref="GeneID:9882319"
FT                   /locus_tag="ELI_0419"
FT   CDS_pept        405495..409100
FT                   /locus_tag="ELI_0419"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826042"
FT                   /db_xref="GeneID:9882319"
FT                   /translation="MVYTIEPDDAAARVIGVKGEFPQDIAVTFTWSDNTSETKGVSDMV
FT                   DQVIKPKPYTDNTYITKVELYSPSAAGFQHNLLVDLQTKHLDGTPLTDGEKFNIGFDHD
FT                   FGGYGKTSWYGEMPSTKNFMYQVLQPGRPLSSLVYSGGDYVSYYPPETPNTMISGVGFM
FT                   PETVFENVGFMKVTNTQKNPGPGQTFQDLKDVSYSAKTTSDGNWFYKLINKSTFTITLS
FT                   GGDYLTAPPTVTVLCVKQNNDVVTKTVAPGQFKVANGKATAQVDFGLGDNEYALSYEMS
FT                   LSSMPKMAVAELSIDELSTQNRVLPDGTEFQDIDTGTENQYARVTFSTLLRFSSLGGKP
FT                   KNQYSTGNTFLYPKVGLMFDTIGLPEYDSKGKITVAPPELDASGQSLLQGATQTLRLSL
FT                   ADLAYDPTYAIEINKNFNYVPGSYKNVQTGGRNYKVIEEWLPNYEKFKGTEKEGNGLLR
FT                   LRFVGTGSTGYNINPVTRGSFSPKAPIETWEFKVQAKMTAEIGRTEVVPAIYRSDKWAE
FT                   KNLVGKKLDVKDWEGIINEKGYLQLSKTKGMTPVELLPKYANAASRFQDSYDIDGDGDT
FT                   VSLVYQSAAPANGTLEITKASKTRVDGYLVDPISGLESRDAKLYPHQTAGFVQILEILD
FT                   QNPIGGTDFIGYYHIPKKNHHIEYVDENGNRQEFVSQFDTSLGDFITATSDGNPISESQ
FT                   MQIAYYLSANPEDVDGDDHNKMSLLEDGGVETPQEKANYKTKEEIEALVTDGTYPTLED
FT                   ALSHVTMVKIQAPQVESKKTILTSTRLKIGHRPPDQNNVNNLVDYFSGIYRYTDSSGTR
FT                   GQKLYTPLMTFNMLPYTVAGSIWNDKKADSVKDPFEPGIAGIEVELWDDGVDPHGEKPP
FT                   AAPKCVASATTGADGSYSMLVGYHGNYKLKFKIPSGQKLTLAGKGDLPYESSVFKENGA
FT                   GDAETDYFLLDDRSLQDENGGLIDERSLEAPTDFYLSVNSTLDIPYQITPDYLMSEENF
FT                   RIKPTITSEDGGTHFTLNPENGTLTGVAEGDGTVTLTIPDPPNPGQVLTKTVQVHVQPA
FT                   SVANVSVPTNVEIFAVQGKTNEIIAPDLTISNYNPFAVDAYIEKMDTTNTGTTKRLNLV
FT                   RQNAAGSYGANEISLTVKASQRAGNAFKGMAETDIASIDGSKLVYLGKMDSAIAPENQN
FT                   WGQFTFGGAYNANILQTDIQENRFAMHFRFVEAKP"
FT                   /protein_id="YP_003958399.1"
FT   gene            409097..409588
FT                   /db_xref="GeneID:9882320"
FT                   /locus_tag="ELI_0420"
FT   CDS_pept        409097..409588
FT                   /locus_tag="ELI_0420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826043"
FT                   /db_xref="GeneID:9882320"
FT                   /translation="MNIKKTKRRAVGGVLLLVVAAVLLLWSPLHKIFDLDPRVGKVPTA
FT                   DLEQLKKQVQQNADASQFTVRINSWIVLETPESEAELYLRNPQENKFDTRMLLVSDKTG
FT                   RLLYTSEDLKPGEGVDKAVLTGPLEAGVQACTARFYILKDSKVVSTLEYPVTLEVKPGQ
FT                   "
FT                   /protein_id="YP_003958400.1"
FT   gene            409680..410213
FT                   /db_xref="GeneID:9882321"
FT                   /locus_tag="ELI_0421"
FT   CDS_pept        409680..410213
FT                   /locus_tag="ELI_0421"
FT                   /gene_family="HOG000166289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826044"
FT                   /db_xref="GeneID:9882321"
FT                   /translation="MDEEREKAAKVKKRKRSVLIAILVFAALCVAGGLIWWLNRPPDDY
FT                   LFDKQARDGLIDAHTKEDVQKILDTVVSKGMFNASINPNPVFSDGNAEGDLWIENIQAN
FT                   HYYTTVTIIRNDNGETIFSSKGIKPNQNIEKAKLDKALPKGEYPCTAVFRITDPETMKE
FT                   IGLVNIQLTITVQN"
FT                   /protein_id="YP_003958401.1"
FT   gene            410254..410889
FT                   /db_xref="GeneID:9882322"
FT                   /locus_tag="ELI_0422"
FT   CDS_pept        410254..410889
FT                   /locus_tag="ELI_0422"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826045"
FT                   /db_xref="GeneID:9882322"
FT                   /translation="MIKKKLAAVVLTAGLLMGCGGSAFAANDNPAGGNSDVYVGVTQTA
FT                   PENLSVTVPTSLAIAVVSDGSSSLTTLLGDYMVDAAGTVTHSGDAVTQPNAQRVTFQNT
FT                   GDKAAQITSAKVVNLARSGWTIKDDVTTATGDAKTMSLTLNNVKAGTIGPDQNSTISFS
FT                   GGFDVPANSIAHMSAAVKAGGGPSDYTSVEQSARSFVIEWNIQKKSQA"
FT                   /protein_id="YP_003958402.1"
FT   gene            410936..411478
FT                   /db_xref="GeneID:9882323"
FT                   /locus_tag="ELI_0423"
FT   CDS_pept        410936..411478
FT                   /locus_tag="ELI_0423"
FT                   /gene_family="HOG000166289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826046"
FT                   /db_xref="GeneID:9882323"
FT                   /translation="MKEQNAINGKAQTKSKKRRRIILFFMLLLLLAAGIILWWTVFRTP
FT                   HEIYKDRNAEIGILPGMTEDQIQDRLNATVAEGMMNVSMNPNPVFENGSAQGDLRIENI
FT                   EKNHYSYTVTITKDDNGEEIYQSGLLEPGYYINEAKLSKNLSAGEYPATARFLAYQNPD
FT                   EAPIGAAVVKINITVKN"
FT                   /protein_id="YP_003958403.1"
FT   gene            411488..411988
FT                   /db_xref="GeneID:9882324"
FT                   /locus_tag="ELI_0424"
FT   CDS_pept        411488..411988
FT                   /locus_tag="ELI_0424"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826047"
FT                   /db_xref="GeneID:9882324"
FT                   /translation="MKKIKRTLFIMTILCFFPMVVSAAQGSTDVYIDIASIPGQSMHFL
FT                   VVEETGEPVCGATIDVWANSVLGYQLLGVTQSDGRYETKFPAGHTYAYRVHKTGYETVE
FT                   QSLVTPKDEEKVVLRKKSSNGGGTQSADKNVYTGILTSHADIILLLGIFLLLCFIMLFR
FT                   KKE"
FT                   /protein_id="YP_003958404.1"
FT   gene            412191..412475
FT                   /db_xref="GeneID:9882325"
FT                   /locus_tag="ELI_0425"
FT   CDS_pept        412191..412475
FT                   /locus_tag="ELI_0425"
FT                   /gene_family="HOG000166290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826048"
FT                   /db_xref="GeneID:9882325"
FT                   /translation="MFVLKAGDQKLYFTQVIWEATSPDYFALTQGTLNGIVILKFLKDK
FT                   VHCEKPLLFSALEKGIYDKRCTIVKRVSYYEEFQNYLKKCVGSAQEELK"
FT                   /protein_id="YP_003958405.1"
FT   gene            complement(412612..413088)
FT                   /db_xref="GeneID:9882326"
FT                   /locus_tag="ELI_0426"
FT   CDS_pept        complement(412612..413088)
FT                   /locus_tag="ELI_0426"
FT                   /gene_family="HOG000057960" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826049"
FT                   /db_xref="GeneID:9882326"
FT                   /translation="MSKVFVAYFSASGVTKTVAEKLAQEIKADLFEIQPETPYTSADLN
FT                   WQNAKSRSSVEMNDRSSRPAIRSRVADMGAYDVVFVGFPVWWYREPSIIDTFMEDYDFS
FT                   GKTVVPFATSGGSPIGSSGKNLEALAPGAKVESGKRFAANTPGSELAAWAAQWL"
FT                   /protein_id="YP_003958406.1"
FT   gene            complement(413257..415128)
FT                   /db_xref="GeneID:9882327"
FT                   /locus_tag="ELI_0427"
FT   CDS_pept        complement(413257..415128)
FT                   /locus_tag="ELI_0427"
FT                   /gene_family="HOG000252814" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PTS system protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826050"
FT                   /db_xref="GeneID:9882327"
FT                   /translation="MKEKVQVFGRFLSSMVMPNIGAFIAWGLIAALFIKTGWLPNEQLA
FT                   QLVDPMSQYLLPLLIAYTGGKLTGGSRGGVMAAIATMGVVVATDVPMFLGAMIMGPFAG
FT                   WVIKKFDALVEGHIKAGFEMLINNFSVGILGGILAILSYYVFAPAMLAATGAMAAGVQF
FT                   FVNHSILPLASLFIEPAKVLFLNNAINHGILTPLGLQQVQEAGKSIFFLMESNPGPGLG
FT                   ILLAYCLAGKGSARDTAPGAIIIHFFGGIHEIYFPYVLMNPVLLLAVMGGGAAGVFTFN
FT                   LLGAGLVGPASPGSILAIMAMVPKSGGYLGVLAGVAVAAVVSFAIALPLLKIFGKDENL
FT                   EDAIAKKDAMKAAAKGETAPVLSPDTDVSAIRHIVFACDAGMGSSAMGATVLSKKLNAA
FT                   GRDDICVEHASVSDIPSHAQIVVTHQDLRERAAHSAPQAELVLITNFMNAPEYDVLAAR
FT                   LSQIDTPADREAASICPETKAAHNASEILPLNSIQTGCAPDDKEAVIRRAGQMLVDSGC
FT                   VDADYIPAMIKREESFATHIGNGIAIPHGVEEAKAKIKRTGLSVQLFPDGTPWGDVTVK
FT                   VVIGIAGAGDDHLDILANIATKLAAPEAVDALMDKTPEALQIFFTQA"
FT                   /protein_id="YP_003958407.1"
FT   gene            complement(415203..416474)
FT                   /db_xref="GeneID:9882328"
FT                   /locus_tag="ELI_0428"
FT   CDS_pept        complement(415203..416474)
FT                   /locus_tag="ELI_0428"
FT                   /gene_family="HOG000124436" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826051"
FT                   /db_xref="GeneID:9882328"
FT                   /translation="MKAKAVRLYGKDDLRLEEFELPEIREDEILVKVMSDSICMSTYKL
FT                   VDQGKAHKRCPQNVDTNPVIIGHEFAGVIVEVGEKWKDQFKPGQKFAQQPALNYKGRLD
FT                   SPGYSYEWCGGATTYCIMPHEVMELGCLMPYEGKSFYKASLGEPMSCIIGGYHSNYHTN
FT                   KRDHSHAMGTKAGGNILIMGGCGPMGLGAVEYGLNFENKPKRIVVTDIDDARIERARTV
FT                   ISPESAAQKGIELVYVNTTALEDAYDGLMTISEGHGYDDVFVYAPIRQVAELGDQLLAF
FT                   DGCMNFFAGPTNKDFMADINLYNVHYTSSHIMGTTGGDNNDLIEANALAARGVIDPSVM
FT                   VTHIGGIDSIAEATLGLPKIPGGKKLTYTQFNMPLTAIEDFAKLGETDPLFKKLADCCD
FT                   AHNGLWNDDAEAILFRHFGICAEA"
FT                   /protein_id="YP_003958408.1"
FT   gene            416662..417429
FT                   /db_xref="GeneID:9882329"
FT                   /locus_tag="ELI_0429"
FT   CDS_pept        416662..417429
FT                   /locus_tag="ELI_0429"
FT                   /gene_family="HOG000224683" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DeoR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826052"
FT                   /db_xref="GeneID:9882329"
FT                   /translation="MSKSLTADRRNRIAQILMKEGSIKVGNLSERFGVSTETIRKDIIY
FT                   LEEEGIATKSHGGAIAKSDFVERPLNVKESEHADAKAAIATAAIRLIQPGAAVILDTGS
FT                   TTGAIARQLLLKEGLTIFTNSVTIAAMLAESDNAVYLFGGLVRSSSKAAVGDWATGALA
FT                   AVHADIAFLGSDGFKGLAGPSTLSYEEAEFKKKVIAASTATYTVCDSSKCQSAGLFAYA
FT                   GWKDVTGLIIDQNIQESAAEDISRETKLILAKN"
FT                   /protein_id="YP_003958409.1"
FT   gene            417495..417857
FT                   /db_xref="GeneID:9882330"
FT                   /locus_tag="ELI_0430"
FT   CDS_pept        417495..417857
FT                   /locus_tag="ELI_0430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826053"
FT                   /db_xref="GeneID:9882330"
FT                   /translation="MNHKIIYFEGEGFTSLADFKKACILDIDRVPTIIAYDKGQRLELR
FT                   NIRSVATEELKDFGTLLKITADHQTVYAAAVIVSFKGGLAVAHNVKTANLKVQLEKLAG
FT                   LDDSVERYGYYEVRKK"
FT                   /protein_id="YP_003958410.1"
FT   gene            417838..417954
FT                   /db_xref="GeneID:9882331"
FT                   /locus_tag="ELI_0431"
FT   CDS_pept        417838..417954
FT                   /locus_tag="ELI_0431"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826054"
FT                   /db_xref="GeneID:9882331"
FT                   /translation="MRSGRSRISLKKAKKATILRHVQDGGFVFSVNFYCSFQ"
FT                   /protein_id="YP_003958411.1"
FT   gene            complement(417936..419447)
FT                   /db_xref="GeneID:9882332"
FT                   /locus_tag="ELI_0432"
FT   CDS_pept        complement(417936..419447)
FT                   /locus_tag="ELI_0432"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826055"
FT                   /db_xref="GeneID:9882332"
FT                   /translation="MESYLIGIDGGSTSIKTVLFDQRGKEIASASNPTMRLESHTPGFE
FT                   TFDVDRLWASTSASIKSMLAKAAVDPSRIAGIGMCSFGNGLIILDRDGKSIAPGVFSQD
FT                   YRANTIVEGYKREGSFDRINDIIKGTLYAGEPGPILRWFKDQKPEVYEKIGGILLFKDY
FT                   LMYRLTGVFATDANIFGGSAMLDLTTTDYSTELLNLYGIPEIEPFLPELATESSQIVGR
FT                   VTKRAADETGLKPGTPVVAGMMDVLACLVGAGATADGIVTAVAGTWCINETHSTRIIPG
FT                   ASANMPYLTKGEYLNCAFTGASGSNYEWFCKAMGGEAKYIAEKQGGSYYEVLNELIASV
FT                   PIETSKVMYLPFVAQPSVHPNAKAEFFNIDQNTTYAELAYALAEGVAFMHRYHIRFLRD
FT                   SGCKADVVRLTGGIAKSQVWARIFADIIELPIETVDCNEVGALGCAITAGVGTGLYKSY
FT                   EEAFEQAVKINPPVTSHSENFELYEKRYQNWSRLIEIMNIYWNEQ"
FT                   /protein_id="YP_003958412.1"
FT   gene            complement(419486..420376)
FT                   /db_xref="GeneID:9882333"
FT                   /locus_tag="ELI_0433"
FT   CDS_pept        complement(419486..420376)
FT                   /locus_tag="ELI_0433"
FT                   /gene_family="HOG000227793" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fructose-1-6-bisphosphate aldolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826056"
FT                   /db_xref="GeneID:9882333"
FT                   /translation="MALVTLSKILKPARDNHYCVAAFDTSNNDMTLAILETAEALRSPV
FT                   ILMALCVDIEGDKMEYWLDGARKMASRASVPVCLHLDHATDTAFIKKAVDSGFTSVMYD
FT                   GSVLPFAENVKNTKKVTEYAHAHGVSVEAELGHVGDGIVGRSETDVKKNRDGAYDNPDD
FT                   SLTNPDEMSAFIEETSVDALAVAVGTAHGVYVHEPRLHFDRLAQLNKLSSVPLVMHGGS
FT                   GTPDEQVREAVRLGICKLNVFSEIIDAYYREMKKQLNEMENMAIWPSTANLRPLNALKE
FT                   AVSKKIMLLGSDNRA"
FT                   /protein_id="YP_003958413.1"
FT   gene            complement(420418..421458)
FT                   /db_xref="GeneID:9882334"
FT                   /locus_tag="ELI_0434"
FT   CDS_pept        complement(420418..421458)
FT                   /locus_tag="ELI_0434"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826057"
FT                   /db_xref="GeneID:9882334"
FT                   /translation="MKIAGIGDVWISGEDIKRGFAAFAERGETIETVEWQCGSYDALQA
FT                   INLAVETGGSEAYEPPEAIKRAVEDADIIITQFCTVTRDMIDRCPHLKAIGVLRGGYDN
FT                   VNVAYATQKGIAVYNTPGRNANSVADYTVGLMIAECRNIAKAHMNLKLGNWVRDYTNKE
FT                   TMPDLSGKTAGIVGFGAIGKKVAQRLKGFEMELLVYDPYFKPTAETKGIELVSLETLLQ
FT                   RSDFVTLHCRLTQETERLFDAHMLSLMKPTAYFINTSRSGLVDEKALWQALKDHKIMGA
FT                   ALDVYDREPPGKDYPLVTLDNVTLSPHMAGGSRDAFTQSPGMLAREMLSFPKDKTSRFL
FT                   VNPDVL"
FT                   /protein_id="YP_003958414.1"
FT   gene            complement(421614..422564)
FT                   /db_xref="GeneID:9882335"
FT                   /locus_tag="ELI_0435"
FT   CDS_pept        complement(421614..422564)
FT                   /locus_tag="ELI_0435"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826058"
FT                   /db_xref="GeneID:9882335"
FT                   /translation="MNDTEYLQKLVQVARLYYEENMTQQAISKKLGTTRQSISKMLSEA
FT                   RERSIVEIKINDVETNLSKAAQMIKEIFPIQNVTIVPGHFNDDALARKMLAQRAALYFD
FT                   DLCREGLHKIGISWGRSVYSFVEQCSESSLLQRADIFPLVGASSQAAAYFMINEMVRML
FT                   SEKTGGTAHFINLPLGPLSPEDYELFTRTQAYAEILDQWQEIDLAVIGIGAIGNLKHRS
FT                   YYPGESELLAEDCANIIGDICTHYFDLQGRITETIGAASMIRIPFENLAKVKRVLALVN
FT                   GNEKIDAVTGALKLGIVTDIIIDEALAEGIIARLS"
FT                   /protein_id="YP_003958415.1"
FT   gene            422724..423509
FT                   /db_xref="GeneID:9882336"
FT                   /locus_tag="ELI_0436"
FT   CDS_pept        422724..423509
FT                   /locus_tag="ELI_0436"
FT                   /gene_family="HOG000184780" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HAD family phosphatase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826059"
FT                   /db_xref="GeneID:9882336"
FT                   /translation="MKETIRVAFFDIDGTLASHKVESSNFLDRVPASARRALCALRENG
FT                   IQPVIVTGREPSVIRQFVADLEMDTYIAANGLSLTHGGVEVWRQLLAPEVVAALLCELR
FT                   EVRDVAVVLESTAGNVLCWNESPYTVDFDVSIEGALERACEYGVYQLAIIGDGLKGRVR
FT                   TAQEGLKARVVAPLVLDILPEAVSKASAIERMLGLLGFDRSQAIAFGDEENDLEMFGAV
FT                   DYTVAMGNAIEALKQTATYVTDSVDEDGIYNACCHFGLI"
FT                   /protein_id="YP_003958416.1"
FT   gene            423684..423833
FT                   /db_xref="GeneID:9882337"
FT                   /locus_tag="ELI_0437"
FT   CDS_pept        423684..423833
FT                   /locus_tag="ELI_0437"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826060"
FT                   /db_xref="GeneID:9882337"
FT                   /translation="MWAEDWGNRLPAIKQRSTVSVYEKNHPKKVKKLYQDIFLMASYLI
FT                   ELIL"
FT                   /protein_id="YP_003958417.1"
FT   gene            424150..424269
FT                   /db_xref="GeneID:9882338"
FT                   /locus_tag="ELI_0438"
FT   CDS_pept        424150..424269
FT                   /locus_tag="ELI_0438"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826061"
FT                   /db_xref="GeneID:9882338"
FT                   /translation="MLFVAFFTKRQGRPQMEFCKISKKTALKTNFFQFIGNLL"
FT                   /protein_id="YP_003958418.1"
FT   gene            424373..425302
FT                   /db_xref="GeneID:9882339"
FT                   /locus_tag="ELI_0439"
FT   CDS_pept        424373..425302
FT                   /locus_tag="ELI_0439"
FT                   /gene_family="HOG000156869" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826062"
FT                   /db_xref="GeneID:9882339"
FT                   /translation="MVSPIKKIKYVLTVFLCLLMGLAGVGCGGSEASGSGTYTLPELVI
FT                   PAYSGADTSSCDVGGFDTTGADSGYVMASYTGDVPAKLQVVKDGVKYNYDIPATGEYTI
FT                   FPLQMGNGTYSIRLLVGVGDNRYTAVLEEDVDASLSSEFAPFVVPNQIVDYNADSACVA
FT                   FAREQAAGMSSDADVVKAVYAYIKDHVTYDVAKAQSPPVGYIPSVDDTFLTNTGICFDY
FT                   ASLAAAMLRSCGIPTKVETGYISPSGIYHAWNEVYVKDSGWIEVGFKIDANTWTLLDLT
FT                   FAAGSSKSDLSGFIGDGNENTYETQYTY"
FT                   /protein_id="YP_003958419.1"
FT   gene            425314..426366
FT                   /db_xref="GeneID:9882340"
FT                   /locus_tag="ELI_0440"
FT   CDS_pept        425314..426366
FT                   /locus_tag="ELI_0440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826063"
FT                   /db_xref="GeneID:9882340"
FT                   /translation="MGRVSKKQAMSSAELSALFTSMSMVLDSGVTVNDCLSMMVQDAED
FT                   SRFKRVLESVEKNLLEEYFLYKAMEKTGGFPEYALGMIEVGETSGRLAEVLASLGDYYL
FT                   QEDGIKKQAKSAVLSPLLLIAMMAVVVLFLVYAIMPVFKDVFRQLGVDLNGASGNALAF
FT                   QAGNVIMIVVGVVLVLLLCCVLFYVFSPAGRQFFNGLAERFGATRDIFYRLDAARFMGA
FT                   LSILMTSGIAMEQALGLARQTVSSQAFGEKIDACRASVEQGEPFEEAVLKTGLLRGVYA
FT                   KVLMGGSKSGSLDRAAAHISKIYFEEAEDKIDGLIAVIEPALVSLLSIAIGAILVAILL
FT                   PLIGIMAGIG"
FT                   /protein_id="YP_003958420.1"
FT   gene            426397..426702
FT                   /db_xref="GeneID:9882341"
FT                   /locus_tag="ELI_0441"
FT   CDS_pept        426397..426702
FT                   /locus_tag="ELI_0441"
FT                   /gene_family="HOG000158380" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826064"
FT                   /db_xref="GeneID:9882341"
FT                   /translation="METKKNKIHFLPSVIIFAVIVLLVWLLFSRASASMDTDGGQTLET
FT                   ALENSAVLCYSLEGFYPPSLDYLADNYGVVVDQEHYIVHYDVFASNIMPDIRVVPK"
FT                   /protein_id="YP_003958421.1"
FT   gene            426717..427232
FT                   /db_xref="GeneID:9882342"
FT                   /locus_tag="ELI_0442"
FT   CDS_pept        426717..427232
FT                   /locus_tag="ELI_0442"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826065"
FT                   /db_xref="GeneID:9882342"
FT                   /translation="MFHNKQNESMLSTFVLPISLVCLFALSALVLTFLGSESYKHIKAN
FT                   YDDTSEATVAVSYLSTKVRQNNRENAITVVHRADGDRLEILENIGDKAYRTVIYCQDGA
FT                   LYESTFSDGQPGGLEANAMRVADLDALRVRAEGSRLLNFEVTGKNGTVHTFSQSVVGAD
FT                   SQEAGDAQ"
FT                   /protein_id="YP_003958422.1"
FT   gene            427229..427666
FT                   /db_xref="GeneID:9882343"
FT                   /locus_tag="ELI_0443"
FT   CDS_pept        427229..427666
FT                   /locus_tag="ELI_0443"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826066"
FT                   /db_xref="GeneID:9882343"
FT                   /translation="MKQRFRSSGFFVELIITIVFFAIACCIIVQLFAKAGLISSEAFDK
FT                   RGAAAQCQTLCETIKGTGSLDSVLEDGCYEKSGSSIRVFYDRNWKMTTRDAAVFSVTVT
FT                   TEAVAQTAGSLEKMRFEALKGTTPLYTMSGAQYFEEPAEVQ"
FT                   /protein_id="YP_003958423.1"
FT   gene            427666..428109
FT                   /db_xref="GeneID:9882344"
FT                   /locus_tag="ELI_0444"
FT   CDS_pept        427666..428109
FT                   /locus_tag="ELI_0444"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826067"
FT                   /db_xref="GeneID:9882344"
FT                   /translation="MRKNKQGMSVGVVSLIMIFVVFLLVSLAVLSLTTASANARMADKS
FT                   LAMQSAYYEADARAQETLAQVDGVLRSGGADPGALEALGRDVVYDPETGVIAFDTKVSS
FT                   TATLKSELRVEGNSVLVTRWQTVTDGEWQTDSDTKNLWKGGAS"
FT                   /protein_id="YP_003958424.1"
FT   gene            428110..429177
FT                   /db_xref="GeneID:9882345"
FT                   /locus_tag="ELI_0445"
FT   CDS_pept        428110..429177
FT                   /locus_tag="ELI_0445"
FT                   /gene_family="HOG000008425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826068"
FT                   /db_xref="GeneID:9882345"
FT                   /translation="MELLDYLEESVARKASDVFIITNFPCSYRIDGRIVRGEGEVFTPQ
FT                   ETERLIREIYDLTGGRSIEKFEENGDDDFSFALKGIGRFRANVYRQRGTLAAVIRVVSF
FT                   GLPDPASLSIPQTVLELSKKKNGLVLVTGPAGSGKSTTLACIIDKINHEKSGHIVTMED
FT                   PIEYIHRHNQCIVTQREIPHDSQSYVTALKAVLRQSPDVILLGELRDLETIEIAMTAAE
FT                   TGQLVFSTLHTTGTANTIDRIIDVFSANQQHQIRTQLSMILQAVVSQQLVPTVDGSLTP
FT                   AFEIMLVTPAIRNMIRDGKVHQIDSAIFSGTKDGMCTMDTSLLELYRQGRITEQTALMY
FT                   SQNHESLAQKLKAAK"
FT                   /protein_id="YP_003958425.1"
FT   gene            429248..429610
FT                   /db_xref="GeneID:9882346"
FT                   /locus_tag="ELI_0446"
FT   CDS_pept        429248..429610
FT                   /locus_tag="ELI_0446"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826069"
FT                   /db_xref="GeneID:9882346"
FT                   /translation="MIDKNGIERCDFAHAHEDIVRTVMDRMPDEETLYDLAELFKVFGD
FT                   STRVKILCVLFEAEMCVCDIAELLSMSQSAISHQLRVLKQSKLVKNRREGKTIFYSLAD
FT                   EHVRAIFNQGMEHIME"
FT                   /protein_id="YP_003958426.1"
FT   gene            complement(429662..429784)
FT                   /db_xref="GeneID:9882347"
FT                   /locus_tag="ELI_0447"
FT   CDS_pept        complement(429662..429784)
FT                   /locus_tag="ELI_0447"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826070"
FT                   /db_xref="GeneID:9882347"
FT                   /translation="MYSVLSTILILAFFTGFVKKIFPIFSKRFYPVKRQPARQV"
FT                   /protein_id="YP_003958427.1"
FT   gene            429788..429862
FT                   /db_xref="GeneID:9882348"
FT                   /locus_tag="ELI_0448"
FT   tRNA            429788..429862
FT                   /db_xref="GeneID:9882348"
FT                   /locus_tag="ELI_0448"
FT                   /product="tRNA-Gln"
FT   gene            429930..430049
FT                   /db_xref="GeneID:9882349"
FT                   /locus_tag="ELI_0449"
FT   CDS_pept        429930..430049
FT                   /locus_tag="ELI_0449"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826071"
FT                   /db_xref="GeneID:9882349"
FT                   /translation="MRNIGTGFSFRVIRRIIWPFYGNGKAVAPDQLLSGSDWG"
FT                   /protein_id="YP_003958428.1"
FT   gene            430152..430967
FT                   /db_xref="GeneID:9882350"
FT                   /locus_tag="ELI_0450"
FT   CDS_pept        430152..430967
FT                   /locus_tag="ELI_0450"
FT                   /gene_family="HOG000226513" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826072"
FT                   /db_xref="GeneID:9882350"
FT                   /translation="MNTLNKALAGKLDSLRDVIRGYEKPCIAFSGGVDSTLLLRVAVET
FT                   RGAAAVPMTVNGSMMPRSEFGDAKALAQSMGASLCVLDVDVFSVPEFVENGSQRCYYCK
FT                   KNIFTQIKGHAQELGCDVIFDGSNLDDLDDYRPGLLALEEMMVVSPFIKAGLTKQDIRG
FT                   LSAFYGLPTADKPAMACLATRIPGGEPITRKKLLMVEQGEECLKVLGLRQYRLRYIGSM
FT                   AKIECAEEDFELLMDRRQELVSNLKAIGFKTVTLDLSGYQCGSMNEVKK"
FT                   /protein_id="YP_003958429.1"
FT   gene            430964..431716
FT                   /db_xref="GeneID:9882351"
FT                   /locus_tag="ELI_0451"
FT   CDS_pept        430964..431716
FT                   /locus_tag="ELI_0451"
FT                   /gene_family="HOG000230756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-
FT                   carboxylate (AIR) carboxylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826073"
FT                   /db_xref="GeneID:9882351"
FT                   /translation="MNAEQLKALLTQVKNDDTSVEDALEQLRELPYHDLEYAKVDYHRE
FT                   LRNGFPEVIYSPGKSLGQIRGIVTDMLARTTGNILASRASEEVYEAIRELTPDAVYYKE
FT                   ARSVVVKREPYRVSEGTIAVVSAGTSDIPVAEEAAVTAEVMGNRVNRLYDVGVAGIHRL
FT                   LDNVDVINHARVIIVVAGMEGALASVVGGLTDKPVVAVPTSIGYGANFGGVSALLGMLT
FT                   SCAGGIGVVNIDNGFGAACLASKINQLQ"
FT                   /protein_id="YP_003958430.1"
FT   gene            431725..432879
FT                   /db_xref="GeneID:9882352"
FT                   /locus_tag="ELI_0452"
FT   CDS_pept        431725..432879
FT                   /locus_tag="ELI_0452"
FT                   /gene_family="HOG000007120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826074"
FT                   /db_xref="GeneID:9882352"
FT                   /translation="MKVLYFDCFAGISGDMTLGAFLDIGADPAHLERELAKLGVPGFHL
FT                   EIDKTQKRGITGTKCRVVMDGHEHAHRHFSDIVDIIEGSGLDEAVKKTAIAIFRRVAEA
FT                   EGKVHGVPMEQVHFHEVGAVDSIVDIVGAAICFHDIAPDVVYGSAVNAGQGFVKCAHGL
FT                   LPVPAPATAEIIGKTDFPIYAKGVDGESATPTGMAILAELASYSAGFPQMAVDTIGYGF
FT                   GDREFEILNGLRLFVGHTDSEDCGILVMETNIDDMTGETAGYVLEGLFEQGVRDAFYTP
FT                   IYMKKNRPAVKLTVICDAGKEETVTRYIFAQTSSIGLRKYQVDRAVMNREIETVDTPFG
FT                   PVRVKVCTYGGIVKRSPEYEDLKRIAGETGKSFMEIEAAVYKYL"
FT                   /protein_id="YP_003958431.1"
FT   gene            433025..433372
FT                   /db_xref="GeneID:9882353"
FT                   /locus_tag="ELI_0453"
FT   CDS_pept        433025..433372
FT                   /locus_tag="ELI_0453"
FT                   /gene_family="HOG000112144" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826075"
FT                   /db_xref="GeneID:9882353"
FT                   /translation="MASFNLGEELRKVLLAGVGAVATTAEKSQELINQLVEKGELTVEQ
FT                   GKVMNEELKRNIRDKVKENVTVVVKDDEPSVDKVVETMDKMSPEELQAIKDKLARMERE
FT                   NAEDAEVKDAE"
FT                   /protein_id="YP_003958432.1"
FT   gene            433338..434999
FT                   /db_xref="GeneID:9882354"
FT                   /locus_tag="ELI_0454"
FT   CDS_pept        433338..434999
FT                   /locus_tag="ELI_0454"
FT                   /gene_family="HOG000264439" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826076"
FT                   /db_xref="GeneID:9882354"
FT                   /translation="MQKTQRSKTQNNPLNHENEPSGAHDTKEYNRQRLREIMAILAKYD
FT                   IVKGITPVKLRLIIEDLGPTFVKLGQVLSMRQDILPAEYCHELTKLRTEVRPMDFEEVV
FT                   TVIEEEYGKPLNEIFTFLDRTPLGSASIAQVHRAELKDGSSVVVKVQRPGIKDTMARDI
FT                   ALLERAATLLKIAGGTGNAIDFKMVLDEMWFTAQQEMDFLIEAHNADEFYELNKDIVYV
FT                   TSPIIYHKHTTSKVLVMEYIAGEEIDQTDRLRELGYDLDEVALKLSENYIKQVIDDGFF
FT                   HADPHPGNIRIRDGQIVWIDLGMMGTLSSKDKDLFKQAVEAMATGDVDGMKNVVLSLGV
FT                   HTGRINHAKLYSDIDNMMDEYGTMDLGTMNIGTMMEDLLQLSNNHHIAMPKGVTMLARG
FT                   SLTIEGVLSMLAPQTNVVQIMINHMSAERLENLDPKREALELGRELYGAAKSTLSLPGQ
FT                   ALDLLRMTVKGQTKINLEITGSEEPLNTIDQMVNKIVKCIIAAALLIGSSFISTTNMEP
FT                   KLLGIPALGTIGYIVALILGANLIYSIHKKKKEINK"
FT                   /protein_id="YP_003958433.1"
FT   gene            complement(435035..436204)
FT                   /db_xref="GeneID:9882355"
FT                   /locus_tag="ELI_0455"
FT   CDS_pept        complement(435035..436204)
FT                   /locus_tag="ELI_0455"
FT                   /gene_family="HOG000208217" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF214"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826077"
FT                   /db_xref="GeneID:9882355"
FT                   /translation="MRLSTILKYASASLLSNKLRSLLTMLGLIIGIASVILLVGIGQGA
FT                   NQSVSQKMDALGGDILTASVYAENPNDGLKSPDLGELKKLPGIQTLAPFKFLSAKAYFE
FT                   KNTSKRSILAGTDDQYLGLRNLKLQSGRNLSIIDLEEKSKVCVIGAGIALDLFHTTRVA
FT                   GSRLKLGGDDYKIVGVLERQGESLGVNTDNLILVPLTTSRYFDLGDDVGSFYVKAENKE
FT                   QISKVKSAVSAYLTIKKGLPPTMYSVSSQDEMLSAGSDISGSLSQLLAGIAGISLIVGG
FT                   IGVMNVMLVSVSERVQEIGIRKALGTKRRDILAQFLAEALSMSLLGGVFGVGAGIAAGF
FT                   LSTLLGFQFAVPALMVLVSFGASTLIGLAFGIFPAYRASNLNPIEALRR"
FT                   /protein_id="YP_003958434.1"
FT   gene            complement(436183..436884)
FT                   /db_xref="GeneID:9882356"
FT                   /locus_tag="ELI_0456"
FT   CDS_pept        complement(436183..436884)
FT                   /locus_tag="ELI_0456"
FT                   /codon_start="1"
FT                   /product="ABC-type antimicrobial peptide transport system"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826078"
FT                   /db_xref="GeneID:9882356"
FT                   /translation="MIRLSHIEKSYCLGSEAVQALSDISLHVRPGEFVSIVGPSGSGKS
FT                   TLMNILGLLDIPDSGAYYLDGQEVSTLSDNGLAALRNQKIGFVFQNFNLLSKLSALENV
FT                   KLPLSLRGIRQKEMTAAAHDYLQRVGLGGRERHIPSQLSGGQQQRVAIARALIGQPEII
FT                   LADEPTGALDSKTSIEIMSLFQRLNQQGQTIVLITHNLGLARETGRVLQIFDGRLCEDT
FT                   SGGAPCGCPQS"
FT                   /protein_id="YP_003958435.1"
FT   gene            complement(436884..437777)
FT                   /db_xref="GeneID:9882357"
FT                   /locus_tag="ELI_0457"
FT   CDS_pept        complement(436884..437777)
FT                   /locus_tag="ELI_0457"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826079"
FT                   /db_xref="GeneID:9882357"
FT                   /translation="MKHAKQILIIAILLSVIGVMAYAYLRSNTAAQAKAFENSQVMTAN
FT                   AVKKNIVQTFTSSGEIKTRRTQSLKPNTDYKFKALCASVGQTVSEGYPVVEYTNGKTLN
FT                   APFDLVITGTALPAKGEALTAEHAVEVSDVHNLQVQMSVFENDLASLHEDQPVSITVAA
FT                   LGNKAFAGKLSSINQIGKYDTSGSKFTVSADFENDGSLKLGMSASCSINVRSADNVLSV
FT                   PVAAIQSGEDGKYVTVKAGDAEEQRKVETGISDGQDVEITSGLNEGDTVILPSAGEPSD
FT                   AETSGGEMNMTEQEVL"
FT                   /protein_id="YP_003958436.1"
FT   gene            complement(437799..437984)
FT                   /db_xref="GeneID:9882358"
FT                   /locus_tag="ELI_0458"
FT   CDS_pept        complement(437799..437984)
FT                   /locus_tag="ELI_0458"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826080"
FT                   /db_xref="GeneID:9882358"
FT                   /translation="MNIKVFKAIIALLTVVILILGGLLMAQKTEMTKKIEPLPDIDTSV
FT                   SAQQRKATAKAFSTTG"
FT                   /protein_id="YP_003958437.1"
FT   gene            438146..438829
FT                   /db_xref="GeneID:9882359"
FT                   /locus_tag="ELI_0459"
FT   CDS_pept        438146..438829
FT                   /locus_tag="ELI_0459"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826081"
FT                   /db_xref="GeneID:9882359"
FT                   /translation="MKLLIIEDDPNLSDVIRQCVAPFYQTEQAFDGEEGLYYASQNIYD
FT                   LILLDLMLPLIDGYEVLRQLREQKIYTPVLILTARGTMTDKTKGFRTGADDYLVKPFDR
FT                   DELLLRIEAILRRSTGHYDIAALCFKELRVETMTRTVTVAGEALDLRGKQYDILEYLVS
FT                   HQEQLVTKAQIFDKIWGFTTDTSSNVVEVYVSALRRILSGCGYDSCLKTIRGVGYMLTS
FT                   GEKAH"
FT                   /protein_id="YP_003958438.1"
FT   gene            438826..440139
FT                   /db_xref="GeneID:9882360"
FT                   /locus_tag="ELI_0460"
FT   CDS_pept        438826..440139
FT                   /locus_tag="ELI_0460"
FT                   /gene_family="HOG000102442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826082"
FT                   /db_xref="GeneID:9882360"
FT                   /translation="MNEKKWIRREFIRSLLLFILAFSCIYSVLGLLIYGIVRTNLYASV
FT                   DEILLADQGTTYAALMMEEGSVLEAEEPESGDVAADQAELIGDLPEINPRVLYIARDRD
FT                   GSPLYYSDINGDLYEELYKGFTFNSNELDTLYFMTLGGRYHYRAINRMIEKADGQKEYL
FT                   QILINVDAEDEILRNVVAGLAVSLGAAVFLSAGVGWLLSRRILKPVTEAYQKQTEFVQN
FT                   ASHELRTPLTIIRTTQELLLSDPESRIIDKFEAINRTIDETRRLTKMTEDLILLAMTDT
FT                   SQTKLQKEPVSLEHLLSGVGEAYCEIAGLEGKKMRMDFRFKGNIEADSDKLRQLAVILL
FT                   DNSFKYTEPGDSIAMSTEEKDGKVVLRISDTGIGISDEDMRHVFERFYRADKARSRQTG
FT                   GSGLGLTIAENIALLHGGSIQMRHHTPKGVEVIVKLPA"
FT                   /protein_id="YP_003958439.1"
FT   gene            complement(440153..441454)
FT                   /db_xref="GeneID:9882361"
FT                   /locus_tag="ELI_0461"
FT   CDS_pept        complement(440153..441454)
FT                   /locus_tag="ELI_0461"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Histidine kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826083"
FT                   /db_xref="GeneID:9882361"
FT                   /translation="MIFYFFRALLGFLMQTVPPAFLCIYPFWARQTWERKRPVLFFVFG
FT                   GFLILGIFIAMVFMDTIRAGKPASNVNLINLLMFLEQGCCFLIYLFVIRAPFFKKLYCL
FT                   TFISSFYAGIALVASFLNRLLFPELSVGPFVQDGYLWPLSGLCLYVVLVAATYPFLFRL
FT                   MRRMSSHLLTPTRTGFWPSLCVPPVLFYLWIFLTPNDLFYGWIITSATALMLVLLLCVA
FT                   FFSLQNLTWVAELEEKTTPPDPQKALSREACAVFNEKLQSSEMLLHDFRHHLLVLKKLL
FT                   DDDDLGPANHLLQNLLDETETAEPILTSGNYLIDTLVNGRLGALSEKGVAVSAQASVPD
FT                   ILPLDYNTLYPTLLAVLNTAAAACEAASPCSESELTLSLDYSRQCLRVVCTFPGTQPLD
FT                   TLSPDLQALSVSGKCRFECERCADGRTQLSLWLS"
FT                   /protein_id="YP_003958440.1"
FT   gene            441489..441617
FT                   /db_xref="GeneID:9882362"
FT                   /locus_tag="ELI_0462"
FT   CDS_pept        441489..441617
FT                   /locus_tag="ELI_0462"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826084"
FT                   /db_xref="GeneID:9882362"
FT                   /translation="MLITVYHKKIWWTTIKKQQRPGVLFFKKTVYFFILPLVLDKR"
FT                   /protein_id="YP_003958441.1"
FT   gene            complement(441578..442162)
FT                   /db_xref="GeneID:9882363"
FT                   /locus_tag="ELI_0463"
FT   CDS_pept        complement(441578..442162)
FT                   /locus_tag="ELI_0463"
FT                   /gene_family="HOG000291516" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826085"
FT                   /db_xref="GeneID:9882363"
FT                   /translation="MNKESFENFEEELTGAIKHWWVFLILGILAIGLGVWLFFTPANGF
FT                   AALAIVFAITFLISGLASTAVTLINRKSIPAWGWNLVSGILMLVLGIIMIANMGITADV
FT                   LVFYVAFAILFGGFNTIGFAFTAKSKGDKAWGWTLALGIVVVILSIVLLFHPVFAAFTI
FT                   VIWAGIAFLSMGISFCTLAYRLSKTNGRMKK"
FT                   /protein_id="YP_003958442.1"
FT   gene            442386..442580
FT                   /db_xref="GeneID:9882364"
FT                   /locus_tag="ELI_0464"
FT   CDS_pept        442386..442580
FT                   /locus_tag="ELI_0464"
FT                   /gene_family="HOG000016978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826086"
FT                   /db_xref="GeneID:9882364"
FT                   /translation="MAECHNKLDCACTYPGCPRHGKCCECVAHHRDTEGGFPGCFFTKE
FT                   GEALWDRSFEALMKDRENN"
FT                   /protein_id="YP_003958443.1"
FT   gene            442581..444005
FT                   /db_xref="GeneID:9882365"
FT                   /locus_tag="ELI_0465"
FT   CDS_pept        442581..444005
FT                   /locus_tag="ELI_0465"
FT                   /gene_family="HOG000279222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative carbon starvation protein CstA"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826087"
FT                   /db_xref="GeneID:9882365"
FT                   /translation="MITFFAALAILIAGYFTYSKVVERIFGPDDRPTPATTMTDGVDYV
FT                   PMKQWKIFLIQLLNIAGLGPIFGAISGALWGPVVFLWIVFGTIFAGGVHDFLSGMISIR
FT                   HRGNSISEIVGIYLGKGMKTVMRVFSVVLLVLVGTVFATGPAALLAMLTPDALDAGFWL
FT                   IVVLIYYFAATLLPIDKVIGKIYPFFGICLIIMALGVAGGIIIQGYTIPELTLQNLHPK
FT                   ELPVWPLMFVTVACGAISGFHATQSPMMARCITSEKQGRSIFYGAMVAEGVIALIWAAA
FT                   GVAFYQSTGGLQEALAAYGGQGGVVYEICNTLLGPAGMVLAMIGVIACPISSGDTAFRS
FT                   ARLTIADWFDISQDKMRTRLYITVPLLLVGLLLSQIDFDIVWRYFSWSNQTLAMIALWA
FT                   GAVYLCRNQKNFWIAAVPATFMSAVSATYILMAEEGLRLPVAFAYPAGVIFAAACAVVF
FT                   YFKAVRPPQALRPEKM"
FT                   /protein_id="YP_003958444.1"
FT   gene            444062..445072
FT                   /db_xref="GeneID:9882366"
FT                   /locus_tag="ELI_0466"
FT   CDS_pept        444062..445072
FT                   /locus_tag="ELI_0466"
FT                   /gene_family="HOG000237252" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826088"
FT                   /db_xref="GeneID:9882366"
FT                   /translation="MKTRRSARGLLLAALLLMSILLTGCVARQAENKEAPTDYAVAANW
FT                   LAMPDTPDKPVDVFYLYPTAWHKESAEEPNICTVDNATLRETAPEMLRQQASVFEPVAN
FT                   VYAPYYRQADAAYCLGLSHDEEYALLNGVPKTDVFAAFDYYLEHENNGRPFILAGHSQG
FT                   SNMLLYLLDEYMEKNPEVYARMVAAYVIGYSVTGDYLAQNPHLRFAEAADDTGVIISYN
FT                   TEAPGVTADNPVLLPGAKVINPISWTRDETLAPAEQSLGSASREDPSVKSLPSADARID
FT                   KVRGVLICDNQDTDALAPGNAVFPEGVYHGYDYAFYYYNLRENAGQRIEAYLARR"
FT                   /protein_id="YP_003958445.1"
FT   gene            complement(445221..445703)
FT                   /db_xref="GeneID:9882367"
FT                   /locus_tag="ELI_0467"
FT   CDS_pept        complement(445221..445703)
FT                   /locus_tag="ELI_0467"
FT                   /gene_family="HOG000224658" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Sensory protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826089"
FT                   /db_xref="GeneID:9882367"
FT                   /translation="MTKNKLIPILQLILAVVVVELVGFCSSLLAGDIAGKYAMLNKAPL
FT                   SPPGSVFGPVWIVLYLLMGIAIFLVLRTNTDEKLKRSAAGLFVIQLLLNFLWSILFFGG
FT                   SSFWLAAVVILLLDAAVIACIVWFKKISTLAAGLMVPYLLWILFATYLNIAFAILN"
FT                   /protein_id="YP_003958446.1"
FT   gene            445914..446498
FT                   /db_xref="GeneID:9882368"
FT                   /locus_tag="ELI_0468"
FT   CDS_pept        445914..446498
FT                   /locus_tag="ELI_0468"
FT                   /gene_family="HOG000049435" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826090"
FT                   /db_xref="GeneID:9882368"
FT                   /translation="MTEREKMLAGELYDCSDPELLAQWHKAKNLVRAYNQTASENLDEK
FT                   DRILGALLGKRGANLWITPPFYVDYGVNICFGENCEVNMNCTFLDDNKIVIGDNALIAP
FT                   NVQIYTAFHPASAADRFGPPREDGSFAFCKTQTAPVIIGDNVWIGGGAIILPGVTIGDN
FT                   VVIGAGSVVTKDIPSDKVAIGSPCRAVRENT"
FT                   /protein_id="YP_003958447.1"
FT   gene            446613..446825
FT                   /db_xref="GeneID:9882369"
FT                   /locus_tag="ELI_0469"
FT   CDS_pept        446613..446825
FT                   /locus_tag="ELI_0469"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826091"
FT                   /db_xref="GeneID:9882369"
FT                   /translation="MKLRKTIKKNFSPLLAALLVTLLLAVMILMVGLIGRSIKDQLLRS
FT                   GSLPQGQIVSLAEETRSGGEKRGVL"
FT                   /protein_id="YP_003958448.1"
FT   gene            447025..447393
FT                   /db_xref="GeneID:9882370"
FT                   /locus_tag="ELI_0470"
FT   CDS_pept        447025..447393
FT                   /locus_tag="ELI_0470"
FT                   /gene_family="HOG000259573" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826092"
FT                   /db_xref="GeneID:9882370"
FT                   /translation="MEWIIDSDRPVYKQLIEQIELRIVSGLFAPGDKLPSVREMAAEAS
FT                   VNPNTMQKALSELERTGLVYAQRTSGRFITEDNKMIQETKENLAIKEIENFLEKMEKLG
FT                   FKKEDIITLMEREDKEGK"
FT                   /protein_id="YP_003958449.1"
FT   gene            447393..448091
FT                   /db_xref="GeneID:9882371"
FT                   /locus_tag="ELI_0471"
FT   CDS_pept        447393..448091
FT                   /locus_tag="ELI_0471"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826093"
FT                   /db_xref="GeneID:9882371"
FT                   /translation="MNPILECIDLTKKFGTKEALSEVNCQLPRGRIIGLLGPNGSGKTT
FT                   LIKTATGLLTPTSGQLLVAGMAPSVETKKIVSYLPDRTYLSDWMTVTQLIAFFDDFYED
FT                   FNSVKAYNMISDLGIDTKDRIKTMSKGTKEKVQLILVMSRDAELYLLDEPIGGVDPAAR
FT                   DYILGTIITNYNENATVVISTHLIADIEKVLDEVVFINQGRIVMNASVDEIREKQHKSV
FT                   DELFREVFKC"
FT                   /protein_id="YP_003958450.1"
FT   gene            448085..448891
FT                   /db_xref="GeneID:9882372"
FT                   /locus_tag="ELI_0472"
FT   CDS_pept        448085..448891
FT                   /locus_tag="ELI_0472"
FT                   /gene_family="HOG000235369" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826094"
FT                   /db_xref="GeneID:9882372"
FT                   /translation="MLGKLMKYEIKGTARLLLPVYAALLAMTLINKIFLSINSEATGFI
FT                   MTTGISMALYVCIIIALVVMTFIVIIQRFYKNLMTDEGYLMFTLPVPTWQQIVSKLVIA
FT                   LMWTFVCGIVIMLSIMILAIDGASLQYMGEFFQELGRAFNSPEGGQAALILIELFILMI
FT                   VGVCCNVLQVYTSISVGQLFGKHKVIGAFVTYIAINIILQIIFTVMTVSFALTSDTSML
FT                   NAFFNNMDPVTAVNWMLNIGTLGNLILSAIYFAVTNYILKNKLNLE"
FT                   /protein_id="YP_003958451.1"
FT   gene            complement(448961..450556)
FT                   /db_xref="GeneID:9882373"
FT                   /locus_tag="ELI_0473"
FT   CDS_pept        complement(448961..450556)
FT                   /locus_tag="ELI_0473"
FT                   /gene_family="HOG000091866" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Carboxylesterase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826095"
FT                   /db_xref="GeneID:9882373"
FT                   /translation="MKTCKRQFLVLFLLILGLLLTAAGCSSTGGRAVDSDVQSIYTATT
FT                   LGRVQGLEQDGVSVYKGIPYAKPPVGSLRFLAPEPAEPWSDTLDCTEFGSSALQPTADD
FT                   IPTPDEDCLNLNVWTSAQEGEKQPVYVFIHGGAYFQGSGAKSMYDCTNFAKDGVVGVTI
FT                   NYRLGALGFLGLEASKAEDGTTGNFGTLDQIQALKWVKENISAFGGDPENITVGGESAG
FT                   SFSVSALIMSPLAKGLFNQAIMESGCILDASAVSPYSGGDASASAAVSGAFARSFGADD
FT                   SLEGLNRLRQIDGHALTAMSQFNMDMTLPNALSFWPVNDGVVLPVDPQKALANGDYNPV
FT                   RLLVGNNRDEGLIFIPDGLEAGDYAAYAYRILGAEAAEQALARWPVDAEHTASDRARQL
FT                   LTLAGFRLGATTFADTLSQNGHPVYYYEFNYSTPDNPAAYHASELPLVFGNELDSLKLD
FT                   KAGKQTAVDMHTAWVNFIKTGNPNQGTALASGVVWEPYTSQSKRVMMIDDQWSSNEMSQ
FT                   TDDLDFLRKTVYGK"
FT                   /protein_id="YP_003958452.1"
FT   gene            450740..450964
FT                   /db_xref="GeneID:9882374"
FT                   /locus_tag="ELI_0474"
FT   CDS_pept        450740..450964
FT                   /locus_tag="ELI_0474"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826096"
FT                   /db_xref="GeneID:9882374"
FT                   /translation="MRYSYEFKLRCVELYKEGSQMETPENVKIKFFGDKIRQWCRIADS
FT                   CGSQVLKHSDQSKEWAPDFSFRSRLAVST"
FT                   /protein_id="YP_003958453.1"
FT   gene            451008..451223
FT                   /db_xref="GeneID:9882375"
FT                   /locus_tag="ELI_0475"
FT   CDS_pept        451008..451223
FT                   /locus_tag="ELI_0475"
FT                   /gene_family="HOG000023133" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826097"
FT                   /db_xref="GeneID:9882375"
FT                   /translation="MSRKGNCYDNCIMETFFGRLKTEIYYDHESEYKSFEVFSVAVKEY
FT                   IYDYNNKRIQAKTKWMPPVIYRQAST"
FT                   /protein_id="YP_003958454.1"
FT   gene            complement(451326..452858)
FT                   /db_xref="GeneID:9882376"
FT                   /locus_tag="ELI_0476"
FT   CDS_pept        complement(451326..452858)
FT                   /locus_tag="ELI_0476"
FT                   /gene_family="HOG000277392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826098"
FT                   /db_xref="GeneID:9882376"
FT                   /translation="MTLKPAIIIIITGSVTSQFFRDGHCYSFCEKLIHIQKGVIFMRQE
FT                   SYPAGENKMGVMPVNRLLITMALPMMISMLVQALYNIVDSMFVSMISENALTAVSLAFP
FT                   VQNLMIAIATGTGVGINALLSKSLGEKNFTEANRAANNGVFLAVLSSLAFVIFGLFFTR
FT                   FFFETQTNIGEIVDYGTQYLAICSVVSFGIFGQITFERLLQATGKTLLTMCTQTTGAII
FT                   NLILDPIMIFGLFGFPKMGVAGAAAATVIGQVVAMLFACILNLRKNHELTLKLRGFRPN
FT                   GGTIRRIYAVGVPSIIMASITSVMTFGMNKILLAFTSTATAVFGVYFKLQSFIFMPVMG
FT                   LNNGMVPIIAYNYGAQKKDRLVKTIKLSMLYAVGLMILGFLVFQLFPGVLLSIFNASPD
FT                   MLAIGTVALRIISLSFLFAGFCIISLSVFQALGNAVLSLIVSVARQLVVLLPAAYLLSL
FT                   TGNLDAIWWSFPIAEIASVLFSAAFLRRIYHQKILPISDAVPVPGTQTETVE"
FT                   /protein_id="YP_003958455.1"
FT   gene            452968..453507
FT                   /db_xref="GeneID:9882377"
FT                   /locus_tag="ELI_0477"
FT   CDS_pept        452968..453507
FT                   /locus_tag="ELI_0477"
FT                   /gene_family="HOG000086496" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826099"
FT                   /db_xref="GeneID:9882377"
FT                   /translation="MNEALRAMVEACDFEETVAVDPRQIHITQDVRDACAKNDCGHYGQ
FT                   NYMCPPAVGDLDHYREVVNSYTNGLLFSQVYRFKNRQDYRRMNEIMAGFEKTVEKLHRA
FT                   IRKSDMEGTVFSAGCCTICKECGILTDDPCRFPDEAMPSLEASGIDVVQLTKDTGLVYN
FT                   NGPKTMTIIGLILYNE"
FT                   /protein_id="YP_003958456.1"
FT   gene            453877..455703
FT                   /db_xref="GeneID:9882378"
FT                   /locus_tag="ELI_0478"
FT   CDS_pept        453877..455703
FT                   /locus_tag="ELI_0478"
FT                   /gene_family="HOG000258896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826100"
FT                   /db_xref="GeneID:9882378"
FT                   /translation="MCGIVGYIGLNQAQKVLIDGLSKLEYRGYDSAGIAVLDKDNAIKV
FT                   KKRKGRLKNLEDELEKEALTGTAGIGHTRWATHGEPSDINSHPHCSIDNRIAVVHNGII
FT                   ENYIELKEELIKKGHLFVSDTDTEVIAHLLNSLYTGDMVETLRLAIDKIKGSYALGILC
FT                   NEEPDRIIAVRKDSPLIVGLGEGENYIASDIPAILRYTRKVYLLDNDEIAILTRDSVTV
FT                   LDESGREAGKQVFNVDWDPGDAEKGGYDHFMLKEIHEQPKAMADTLTGRCFPDKIVLDD
FT                   VNLDAETMKSINRIQIVACGTAYHAGMVGKYLIEKFARVAVETEPASEYRYKDPLVDAH
FT                   TLLIVISQSGETADTLAAIRLAKEKGARVLAITNVVGSSIAREADDVLYTNAGPEIAVA
FT                   STKAYVTQVGCMILLALHFGLLNGQVDEGTMKRVTNGLKDTSALIEKALGDHDKIREYA
FT                   YEHFKVDDMYFIGRGLDYYTCLEGSLKAKEISYIHSDAYAAGELKHGPIALVDVGTVVI
FT                   AVCTQGNVFDKMLNAIKEVKARGANVMAIAKEGHEEIIPEVDQVFFIPQMDDEITPIPT
FT                   VVYLQLLAYYLSVARGCDVDKPKNLAKSVTVE"
FT                   /protein_id="YP_003958457.1"
FT   gene            455875..456525
FT                   /db_xref="GeneID:9882379"
FT                   /locus_tag="ELI_0479"
FT   CDS_pept        455875..456525
FT                   /locus_tag="ELI_0479"
FT                   /gene_family="HOG000223258" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826101"
FT                   /db_xref="GeneID:9882379"
FT                   /translation="MDLLDMITEGIVELDEEKVIKIVKRAIVAEIPKIDIIAALSEGLD
FT                   KVGEKYSKGEYVMYDLMMSGILYEEVMSLEELSLAENLKSEEKKGLMVIGTIEGDVHDI
FT                   GKSIFKNAVSMSGFDVIDLGVDVPPEVFVQAIEEHAPDIVGISIIMTEAINNAKRTVEK
FT                   IREKVGADLDIIIGGVATNLKIAQFIGADAYSNNVLNGVNICLRMVNGDGKKY"
FT                   /protein_id="YP_003958458.1"
FT   gene            456509..457219
FT                   /db_xref="GeneID:9882380"
FT                   /locus_tag="ELI_0480"
FT   CDS_pept        456509..457219
FT                   /locus_tag="ELI_0480"
FT                   /gene_family="HOG000228717" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826102"
FT                   /db_xref="GeneID:9882380"
FT                   /translation="MEKSIKYIQISDEIKNKILSGILKPNEMLSSENQLAAEYNVSRVT
FT                   IRKALMRLIDEGYLFSVPGKGTFVDYFNKNTYRIPLSLESILKSPYDGETLIGSKIINP
FT                   DIDMVYHLQIAPKEKVISIEWLLSIENNPVVYDIKYIPFFPALPIGEIDLKYSSLSRIL
FT                   SSKFNLRDLQEEIAIECVCPNDKICRYLGMNFDSNEAVILLNKFIYDRENNPVGWSLNY
FT                   IRSDYCTLKAEFQC"
FT                   /protein_id="YP_003958459.1"
FT   gene            457213..457920
FT                   /db_xref="GeneID:9882381"
FT                   /locus_tag="ELI_0481"
FT   CDS_pept        457213..457920
FT                   /locus_tag="ELI_0481"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826103"
FT                   /db_xref="GeneID:9882381"
FT                   /translation="MLEKKKKIETTTYDAIYKDIKNKIDHGELNPGDKLDSVRKLCEVY
FT                   NTSDITIRKSIELLKQNHYVYSKERAGVYVSGGEKKYFFLKFHEVTNIIESVNHREIIE
FT                   FGNIATADFNHYIGLKNETVRCVKIATIGYNEAFPVFYDEKYIVNNAKLVFENKEKETL
FT                   LTTIEDVLDNYDVAKKLYIEVENSRTDIRKNLLLPERIGMFRFVKEFFTRSGKFIGLSK
FT                   TYIGGDNISLKCL"
FT                   /protein_id="YP_003958460.1"
FT   gene            458147..459424
FT                   /db_xref="GeneID:9882382"
FT                   /locus_tag="ELI_0482"
FT   CDS_pept        458147..459424
FT                   /locus_tag="ELI_0482"
FT                   /gene_family="HOG000166292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826104"
FT                   /db_xref="GeneID:9882382"
FT                   /translation="MSIRVKRFIQLLCLCVGATVIYFIPVHLRATFYVPMQEVFSLTNT
FT                   QIGDLAGLYGTMTIFTYLPGGWLADKFSPRKMLALSYFGTGILTFFLLLKPGYSMMMVI
FT                   FALCGVTTTLTFWAALLKITRDFGKNDGQGKAFGGLEGGRGLAATVILMGATLIYGMMG
FT                   GNPTSMMIIISIFGILNILTGIFTLIVFDEIKEEKKTGENPFAGIVECAKNPNVWLISF
FT                   IVLGIYTVHSVSQYIAPFANEVFAATVVFGSILSLSKQWMKPVGGFIGGFFADKIGITN
FT                   MLSIGVVLLVISTGVFALVPGNPSLLILLIINTLIMFTIVAGLRGLYFANMNEAGIPLR
FT                   LTGTVIGFASTIGFTADVFIPVISGRLLDAYPGGLGYRMMFGIGALFCVISFVLLQVFK
FT                   KRNAKTIDAIKLEKLGHQKVEENAAE"
FT                   /protein_id="YP_003958461.1"
FT   gene            459421..460857
FT                   /db_xref="GeneID:9882383"
FT                   /locus_tag="ELI_0483"
FT   CDS_pept        459421..460857
FT                   /locus_tag="ELI_0483"
FT                   /gene_family="HOG000250777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MttB3"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826105"
FT                   /db_xref="GeneID:9882383"
FT                   /translation="MKPYEKYIKKENVEKIHKISMDILENVGVKFEDESILEVFKEHGA
FT                   RIDGDIVYIDHKLFEAAMQTVPSEFTIRSGKGDVHIGNGSKVFLPAGGNVYIQDGESIR
FT                   SMTNEDNINQFKLYDTSPVISCGHVNIFLDEQNQTLDERIYGPVAFVLKYSNKPSIHTK
FT                   INTFPIREKDKVRESFQKGLKLVKRFEGLDEAYVKISSINPISPLCYDHDPLEKIIGAC
FT                   EENQPLWIISAAMPILSGPTSVASIMAMTNAEILAGIVLTQLLKPGIPVVYGNTSTSTD
FT                   MRTLQMSLGSPETALMIYATAALADYYHLPFRTGGLLSDAKELDVQAGSESTMLGMATL
FT                   DCNPDMVLHAIGVLGSFNLVSFEKILVDEEIIMLINRMLKGIDCSDEKLCYEMIKKIGP
FT                   RGSCLNGRTPKMFKEEFTMSKYFNKVDANQWQNNGSKSVLEATHEDVLKRIESYRMPQI
FT                   TKEQDDLIRQYLPAQYRDRI"
FT                   /protein_id="YP_003958462.1"
FT   gene            460870..461493
FT                   /db_xref="GeneID:9882384"
FT                   /locus_tag="ELI_0484"
FT   CDS_pept        460870..461493
FT                   /locus_tag="ELI_0484"
FT                   /gene_family="HOG000223258" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobalamin B12-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826106"
FT                   /db_xref="GeneID:9882384"
FT                   /translation="MADYTKLVELLLDGDDEEIVVEIETLLNRGVPAAEILQNGLIPGM
FT                   DIVGQEFEKEELFIPEMLAAALAMKESVKKIKPLLSEEEKQSTGKVLFATVEGDIHDIG
FT                   KNLCIVMLEGAGFEVQDLGIDVALTEILEATKKEKPQVLCLSALLSATMPAMQKVVDQF
FT                   KMEEIHTKVLIGGAPVTQEFADKIGADAYADDASECVSVVKQLI"
FT                   /protein_id="YP_003958463.1"
FT   gene            461463..462740
FT                   /db_xref="GeneID:9882385"
FT                   /locus_tag="ELI_0485"
FT   CDS_pept        461463..462740
FT                   /locus_tag="ELI_0485"
FT                   /gene_family="HOG000166292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826107"
FT                   /db_xref="GeneID:9882385"
FT                   /translation="MCFCCKAIDLKKGLFMKEGKMKRFLQLICLSVGATVIYFVPIHLR
FT                   SLFYVPMQEVFGYTNTQIGNLAGWYGIMTIVTYLPGGWLADKYSARKLLAGSYIVTGLL
FT                   TLVMALYPPYEVALWIFILVGISSTLTFWASLLKLTRQFGKDKNQGKAFGSLEGGRGLA
FT                   ATIIFAASSVLFTKIGNAWVGLRILIVVFGAVTILVAVMTLLVFDEKDADHQATNVFHG
FT                   FLRSLRNPNTWLIAFIVMGIYTVHAISQYIAPFATNAFGTSVLIGSLLSQSKQWVKPLA
FT                   GIGGGILADRFGVSKILLIGSVLLAASVGVFALIPGNSQLFWLLVVNTVIIFLLLGLLR
FT                   GLYFADLNEAGIEWHLTGTVIGFATTIGMLGDVFVPFLAGRLLDHFPADKGYTYIFGMG
FT                   VVSSCFAVIMLLIFRKYNKQRIEDKE"
FT                   /protein_id="YP_003958464.1"
FT   gene            462744..464165
FT                   /db_xref="GeneID:9882386"
FT                   /locus_tag="ELI_0486"
FT   CDS_pept        462744..464165
FT                   /locus_tag="ELI_0486"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MttB3"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826108"
FT                   /db_xref="GeneID:9882386"
FT                   /translation="MDINYDRYQAMSIDDVEKIHEYTVDVLTNTGIWVEDNEARDIFKK
FT                   NGCRIENEKVFLNEKVIQTALENAPSEFRICAIEPRNSKTFGVEASIFAPAGGAVTICE
FT                   SDNIRRAPTMEDVNDFSKLVQCLDVIGLNRPAVHPSDVDPMKKFLYITLADFKYNNKIY
FT                   QLRRETLEMICIIYGITPEKMKKDAENGIHYGYSTSNPVSPLELSSAATDTIRFQAEYG
FT                   VPNIIAPMPIGGISAPATVEGTILIQNCENVAAIVFSSLINPKAPVFYGCIGSVGDMKK
FT                   GSATAAAPEMRIIEAAGAQMARYYNIPSRGAPGSPDAVAMDFQAGAESAMGFYSSVRSG
FT                   VHLITNMGFMGNWMQASKAKLVLDAEIIESVLRIMQPLEITEEKTALDLIKKLGARSTY
FT                   LTEKHTLKNYKKNFYNPKVFRRTTFEKWEKEGKLEAAQSAENKAKALLDQYVSPDRDPS
FT                   IVKELETYIAKHDRR"
FT                   /protein_id="YP_003958465.1"
FT   gene            464171..464965
FT                   /db_xref="GeneID:9882387"
FT                   /locus_tag="ELI_0487"
FT   CDS_pept        464171..464965
FT                   /locus_tag="ELI_0487"
FT                   /gene_family="HOG000015344" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydropteroate synthase DHPS"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826109"
FT                   /db_xref="GeneID:9882387"
FT                   /translation="MLYIGESINGTIPAVNQAILKHDADFILKLAATQVECGADYLDVN
FT                   AGTGGIGNERDDLKWLIELLQDNVECPLCLDSSEPEILMETYENYRGKPMFNSVCDGKK
FT                   LDIMAPAISEQECSVIALAHGEDGIPDNAELRFVFADKIIKRLRNANVKDCDIYIDPII
FT                   MSLSTNTGAGKVTLDTIKRIHEAYPEVNIILPISNIGFGIPKRKRINDTFAAMCIQNGA
FT                   NAFIADVRDKSFIGTTLAAEALLDKDRFCKRYIKAYKKGRIE"
FT                   /protein_id="YP_003958466.1"
FT   gene            465078..465884
FT                   /db_xref="GeneID:9882388"
FT                   /locus_tag="ELI_0488"
FT   CDS_pept        465078..465884
FT                   /locus_tag="ELI_0488"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826110"
FT                   /db_xref="GeneID:9882388"
FT                   /translation="MGTKRKQAGHGGENLKRFKGRKSVQAIELAAGSRYNGGVWKDILQ
FT                   WKGKRMTEAIIFDMDGLMFDTETISIPSWVKAGEILGYPITEAMIFELFGMNPVAVNAY
FT                   WKEHFGDSFDCGAAMKLHLDYMEDYVRENGVPLKPGLITLLDFLKERGYWFTIASSTQR
FT                   PMIKMYLERAEIGHYFTDQIVGGDEIINGKPAPDIYLKAAQKLGTAPECCMVFEDSLAG
FT                   IESAWRAGMKPVMVPDKVPADAVTEERLYAKLKTLDEGIELLIKES"
FT                   /protein_id="YP_003958467.1"
FT   gene            complement(465912..466574)
FT                   /db_xref="GeneID:9882389"
FT                   /locus_tag="ELI_0489"
FT   CDS_pept        complement(465912..466574)
FT                   /locus_tag="ELI_0489"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826111"
FT                   /db_xref="GeneID:9882389"
FT                   /translation="MTTLYLIRHGTTDANANGIFQGVLDLPLNDLGLKQARALGERFKD
FT                   IDVDVLYCTPLQRTRQTAEGLRGDKDLPILVEPGIVEVDGGLMEAKKISVIDEAFPGLM
FT                   ETFKTDLPNFQAPGGESTRDVYDRVTSALTRIVAENAGKTIACISHGFAIQTFLWYAKG
FT                   LPFEEMEQQILRNTAVCKFIFDSDNQLEIAYINDDRHLSEDLKCEQPPEFRVTNEKS"
FT                   /protein_id="YP_003958468.1"
FT   gene            466766..468262
FT                   /db_xref="GeneID:9882390"
FT                   /locus_tag="ELI_0490"
FT   CDS_pept        466766..468262
FT                   /locus_tag="ELI_0490"
FT                   /gene_family="HOG000268118" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826112"
FT                   /db_xref="GeneID:9882390"
FT                   /translation="MIEVPMKLNCILEDPEIVEVRNNNPEIDIEHIAYNSQKVVPNSMF
FT                   VAIRGLKTDGHKYIGDAISRGAILVIYEHDLDEYQDDIMYVKVKNARHMLGTMSSRFYG
FT                   HPSEALSITGVTGTNGKTTITHMLKSIFQKDGRKCGLIGTINNQIGDEIIDNAGRTTPD
FT                   SLEVQEIISEMVEAGCQNLVMEVSSHALDLDRVNGVAFDYGIFSNLTQDHLDYHKTFEN
FT                   YFEAKAKLFTYTSKANIINCDDVWGKKLYDRCAQKKGVAVYSYGLNPECDFYARDMKYS
FT                   IEGTRYTLVTKDGEEEIFISIPGEVMVYNSMAAIINALLEGISIEVIKEALASMSGVEG
FT                   RMERLDLDTEFDIIIDYAHSPDSLERLLKSVKTMYDGKVYLVFGCNGDRDKEKRPIMGR
FT                   IAGEFADHVIVTSDNPASEDPQSIIDTVAAAVAEKTDACETVLRRWDAIYYAATLPKAG
FT                   DVLVLAGKGHEKQETMKDENLYYNEWETAEEAVRRLKAGK"
FT                   /protein_id="YP_003958469.1"
FT   gene            468363..469166
FT                   /db_xref="GeneID:9882391"
FT                   /locus_tag="ELI_0491"
FT   CDS_pept        468363..469166
FT                   /locus_tag="ELI_0491"
FT                   /gene_family="HOG000012387" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826113"
FT                   /db_xref="GeneID:9882391"
FT                   /translation="MKAYVTAIIENYVREYEKTSATKWGRPLVGFADAAHPMLPELRVV
FT                   ADKNHVMPQKVLEDAAIVVCYFLPFTRETAKSNIGDGHASPEWARAYEDTNALFTRLNA
FT                   HLIEQLEARGYRAAVSPEATTFDREVLMSRWSQRHMAWLAGMGTFGLNNMIITDAGCCG
FT                   RFSSVVTNLDVTPGAPLTTENCLYKREGKCGVCVRHCFSGALTTEGYDRKKCFGVCSEN
FT                   AAVYNDFGNSYAADAEGVIMDTGSEVCGKCLVGVPCAFGKPFREE"
FT                   /protein_id="YP_003958470.1"
FT   gene            complement(469199..470851)
FT                   /db_xref="GeneID:9882392"
FT                   /locus_tag="ELI_0492"
FT   CDS_pept        complement(469199..470851)
FT                   /locus_tag="ELI_0492"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826114"
FT                   /db_xref="GeneID:9882392"
FT                   /translation="MTIKEKKCKFIPALFMILLAMGTSVLLFLSNLLPHANNRFEAGPV
FT                   TMLDTHWTITGDGLTRSGITLPASLPATQAALTNTLPVTLPEDAVLGIPTAFQSLTVSI
FT                   DGTEVYSLPADSAFGSLTHLVSIPKGSEGRTVTLTFESVYPTANMSVGNIILGSRTAVL
FT                   FGQLDKDTGSLLVSLIMLIIGILLLAVSGFLAGPKTGRYRFVCLGTFSILASLWILTDS
FT                   NFLQFLPFNSTMGVLLSFYSFTLMGAPIIQFIKLSSHKRYHKAYDIVTLLMLSNFLLNL
FT                   CVSMVSVLYLPKLLIITHALLISAILLFLWTLVHSWVKCHEKRFSTLFAAFFLLCAAGI
FT                   IDLIRFYDNPVDNDNSLFFKIGLLVFIGILGLSSIKDSLNLFRDAVHVEIYKKLAYTDP
FT                   TTHLANRTAYERDLQNTRNALPIESLTIISFDLNNLKLTNDTLGHSVGDTLIIDSGACI
FT                   HSSFKDCGACYRIGGDEFCVIAENLDAAVLENCLEVFDSSILDYNRAHSPKLDIARGYS
FT                   QGMVRTPEDLDALIRRADHAMYTCKAHSHLSEI"
FT                   /protein_id="YP_003958471.1"
FT   gene            complement(470953..473382)
FT                   /db_xref="GeneID:9882393"
FT                   /locus_tag="ELI_0493"
FT   CDS_pept        complement(470953..473382)
FT                   /locus_tag="ELI_0493"
FT                   /gene_family="HOG000250826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826115"
FT                   /db_xref="GeneID:9882393"
FT                   /translation="MKKHSAAGRQPITRLTPDPELGLTSEQAQHRMRAGWHNLTKEQLS
FT                   KTEGQIIRDNIFTFFNFLFFALAFCLFMVKAYTDMLFLGIVIVNVLIGIVQELKVKRTL
FT                   DKISLLSGQNAHVVRDGAVQTLPTDHLVLDDIVHFTAGSSICADAILCGGTVEVNEALL
FT                   TGEADIIVKHPGDQLLSGSFIVSGNCSARLDRVGSDSYAASITHEAKRRKKHRSQMMRD
FT                   LDRLLKFIGIGIIPLGLIMFFKQSALLNTGVPYAVSSTVAAMVGMIPEGLYLLVNIALA
FT                   VSVINLARRRTLVHELSCIENLARVDTLCLDKTGTLTEGVMEVTGAIPLAGLTQEALER
FT                   QLAAFLQASASENATAKALKSHFQQIAPPLSVKKEIPFSSERKWNALILSDGSACFLGA
FT                   PERLLGKNYSRYTPQLKPILSSGKRALLLARGTAEDTESPENSCLTPLGFILLSDKLRD
FT                   DVQETLAYFKEQGVTIKVISGDNAETVSEIARRAGVNGASAFIDASTFSDDADMAAAAE
FT                   NHSVFGRVTPEQKRRLICGLKENGHTVAMIGDGVNDVLALKDADCSIAMAAGSDAAQHV
FT                   SQMVLLDSDFSVMPQIVREGRRVINNIERSAALFLVKNIFSFILSLILLFAAIPYPFLP
FT                   IHITLISGLMIGIPSFALTFEPNYRQVHGHFLRNVLSSALPGGLVNAFNLLAVLIAGTL
FT                   LGIPMDQISTICTLLVGVTGLLVLLRLCQPLNLPRAGLVAVMGVGFFGAAFLFGPLFSL
FT                   SSLTLESWTVFGAFTALSPLLMAGLTALLQHLTLWPAKTKTLKASKSLSLRETDRP"
FT                   /protein_id="YP_003958472.1"
FT   gene            complement(473532..473687)
FT                   /db_xref="GeneID:9882394"
FT                   /locus_tag="ELI_0494"
FT   CDS_pept        complement(473532..473687)
FT                   /locus_tag="ELI_0494"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826116"
FT                   /db_xref="GeneID:9882394"
FT                   /translation="MDGSFCFVKIRKRNEKVYVNPPHHGEGLSDAVVLCYISIIPSKCD
FT                   DNMNAV"
FT                   /protein_id="YP_003958473.1"
FT   gene            complement(473723..474169)
FT                   /db_xref="GeneID:9882395"
FT                   /locus_tag="ELI_0495"
FT   CDS_pept        complement(473723..474169)
FT                   /locus_tag="ELI_0495"
FT                   /gene_family="HOG000249817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826117"
FT                   /db_xref="GeneID:9882395"
FT                   /translation="MRISAKGRYGLAAMIAIAQGDFEGDYVPVIVIAEKLGLSKIYLEQ
FT                   VFSLLKRAGLVNSVKGAQGGYRLTREPDQINAHEILTALEQILFENTETSVEEASPAIE
FT                   HTMQKCVFTPLDRAVQEHLEKITLDELVAEAGRYKGNNHFMFFI"
FT                   /protein_id="YP_003958474.1"
FT   gene            474318..475943
FT                   /db_xref="GeneID:9882396"
FT                   /locus_tag="ELI_0496"
FT   CDS_pept        474318..475943
FT                   /locus_tag="ELI_0496"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826118"
FT                   /db_xref="GeneID:9882396"
FT                   /translation="MKALRKDTVREIRKSLSRFLSIVAIIALGICFFGGVKSTSPSMKY
FT                   TANQYFEAQKLADIHLVSTYGFTDDDVAALKKVEGVAAVTPAYSTDVIVENGEKRPVFK
FT                   VLAVPAKDGLNQPLLLEGRMPEKDNECVIEMPDTTGPHTGRNAYSIGSTIRMSPEVGEK
FT                   KLEDTLSQSEYTVVGYIRSPQYISIERGSTSVGSGDVSFYMMVKPEVFKSERYTDAYVY
FT                   STASADGVSAYSAEYKDAVSDLEKRLETVGYDRLQINYDDIMTTGTQEIDKAKRELLDA
FT                   QTTFDNEITKAEQQLREAEQQIADGEAELAEGQRSYDEMVVSTTRTLNEKQAELQNAET
FT                   QWNTGQQQYTDGQSQYEQNKAAFDAGKPEAEKQIADKKAELDQLGGMIGSIKSQIAVIE
FT                   AIPEEKRTEEQKQALIQLKAQLQTLQPVYDQGTEALDAAIQQLKDAESQLAAAKAQLDQ
FT                   SKAARWTARRPRLSRERPPLLRAGSSLSRERLRQSSSSQKGGRNWTTQDASWLRDALSW
FT                   KQNAPRDSRSWMTPGRKLRTAKRN"
FT                   /protein_id="YP_003958475.1"
FT   gene            475970..477640
FT                   /db_xref="GeneID:9882397"
FT                   /locus_tag="ELI_0497"
FT   CDS_pept        475970..477640
FT                   /locus_tag="ELI_0497"
FT                   /gene_family="HOG000166293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826119"
FT                   /db_xref="GeneID:9882397"
FT                   /translation="MFNRDDNPGYSGYGEDANRIDNVAGIFPVFFLLVAALVAFTTMTR
FT                   MVEEQRMELGTLKALGYSPASIASKFVIYAALAAVVGCAIGVVSGINTLPRLIVGAYSL
FT                   LYQVPELSLSVPWGAIIISCIITILCTVGAAILICSVELREEPSELMRPKAPKIGKRIF
FT                   LEKIPFIWKRMGFISKVTARNILRYKARFFMTVIGISGCTALILAGFGLQDSIFSIIPK
FT                   QFEEISVYDGMMAFKNEDTLEAKAPLESELRADPQVEDAMLAKQLKMSVSLADGGHSKD
FT                   AYLYVPETPGDMNHFINLRHRKEPDQKLDLDDSGAIITEKLANDLGIKVGDTIRLYSDD
FT                   KEFKIEVADITENYIENYVYVSPKAYESASGEPVKYNIAYFNLKDTGTDAENTFGEKWL
FT                   ENSDVVSVSFTGSIVKSSTDSLSSLNMVVLVMLVAAGALAFVVLYNLTNINVSERVREI
FT                   ATIRVLGFYDRETNNYIFRENIILSFIGMLIGLGLGVILNNFIITTVETDIVMFGRGID
FT                   PSSYIFACLFTMAFTLIVNLFMAPVIKKVDMVESLKSIE"
FT                   /protein_id="YP_003958476.1"
FT   gene            477719..478165
FT                   /db_xref="GeneID:9882398"
FT                   /locus_tag="ELI_0498"
FT   CDS_pept        477719..478165
FT                   /locus_tag="ELI_0498"
FT                   /gene_family="HOG000054578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826120"
FT                   /db_xref="GeneID:9882398"
FT                   /translation="MIIKTIENSEKVNFMELLLLADEDWKMIEKYLYRGELFALYDDDL
FT                   KSVCVVTQESDCICELKNIATYEKWHGEGYGSKLLDHIFSYYKDKHATMLVGTGNVPWI
FT                   MRFYKKSGFKVSHRIRNFFTDNYDHPMFEDGVQLVDMVYLKKDL"
FT                   /protein_id="YP_003958477.1"
FT   gene            478217..478339
FT                   /db_xref="GeneID:9882399"
FT                   /locus_tag="ELI_0499"
FT   CDS_pept        478217..478339
FT                   /locus_tag="ELI_0499"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826121"
FT                   /db_xref="GeneID:9882399"
FT                   /translation="MKQETVLTETAEWRISGESRFNGIIIGGALDIVSHHFEEA"
FT                   /protein_id="YP_003958478.1"
FT   gene            478311..478850
FT                   /db_xref="GeneID:9882400"
FT                   /locus_tag="ELI_0500"
FT   CDS_pept        478311..478850
FT                   /locus_tag="ELI_0500"
FT                   /gene_family="HOG000252320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0157"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826122"
FT                   /db_xref="GeneID:9882400"
FT                   /translation="MFPIILKKHNPNYKDWYEEEKQRIIRHVKPENIVRISHIGSTAVE
FT                   GLAAKPTVDILLEIDGACSVSEATEALENLGWGLMSRENDPVKLSFNKGYTPQGFADRV
FT                   YHLHVRYFGNWPELYFRDFLKAHPDVAGEYERLKLKLWKQYEYDRDGYTEAKTDFIKRY
FT                   SDIAKIEFNNKYLPER"
FT                   /protein_id="YP_003958479.1"
FT   gene            complement(478950..479390)
FT                   /db_xref="GeneID:9882401"
FT                   /locus_tag="ELI_0501"
FT   CDS_pept        complement(478950..479390)
FT                   /locus_tag="ELI_0501"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826123"
FT                   /db_xref="GeneID:9882401"
FT                   /translation="MDPFRKTIVRRLRLSLLVAVIGALAAIAGILYSLLSGGLPDTSVL
FT                   SKSMGLFAGIEAVSIFRILRYARALKTPDQLEALEIAEKDERNQSIQLRTCRSTLYLTL
FT                   ALLGFGGIVCSFFNPALFLILGAILIAVLVIFLAFWLYYRQH"
FT                   /protein_id="YP_003958480.1"
FT   gene            complement(479397..479603)
FT                   /db_xref="GeneID:9882402"
FT                   /locus_tag="ELI_0502"
FT   CDS_pept        complement(479397..479603)
FT                   /locus_tag="ELI_0502"
FT                   /gene_family="HOG000225389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826124"
FT                   /db_xref="GeneID:9882402"
FT                   /translation="MKTRIRELRKQRHISQAELAKAVRVTRLTITSIENEKYTASLALA
FT                   YKISKYFGLTIEEVFDFSEIEEE"
FT                   /protein_id="YP_003958481.1"
FT   gene            479731..480489
FT                   /db_xref="GeneID:9882403"
FT                   /locus_tag="ELI_0503"
FT   CDS_pept        479731..480489
FT                   /locus_tag="ELI_0503"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826125"
FT                   /db_xref="GeneID:9882403"
FT                   /translation="MRMAFIEIKQVSKSFGSVRALNQLALSVSQGSICALLGHNGAGKT
FT                   TTLRLILGLLSPDSGEIAVGGLDPEAEGDAVRRFCGVLSEDTGLYEPLSVYDNLSYFAR
FT                   LYGMKRQDYDARIDTLLAHFDILDKKNLAVKGFSTGMKKKVALIRALLHRPRLLLLDEP
FT                   TNGLDPVSIEHLRSMLRELAEESGATIILTTHNLNEVERMADQIAILRHGRNIFTNSLD
FT                   ALRQETNEDGFDLERLYMKIEGQAEKYGRN"
FT                   /protein_id="YP_003958482.1"
FT   gene            480476..481861
FT                   /db_xref="GeneID:9882404"
FT                   /locus_tag="ELI_0504"
FT   CDS_pept        480476..481861
FT                   /locus_tag="ELI_0504"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826126"
FT                   /db_xref="GeneID:9882404"
FT                   /translation="MDGIRAVCTQQWRLALKDSGTLAFYACGALAIGGLSLWRPAGPFV
FT                   LNAMVLYPLFLLGQWASEAFAAEKETRTLESLLSTSVEKKQLLFGKGAFCLEASCACFC
FT                   LSLAPVLILKEAVGALPDVSGEMLLAVAGLFILGAVCLTLTGLYTSAVSADVQEAGSRG
FT                   QRFFIPIGFCLVVLLTLVSQRQDEAAVLLSAVFLVLTALVSGWVLWRLKRLNRGGLLAD
FT                   GGKNPVAGSGYQRDIRSQSLIVLGHEWRYFKALGRFKLSLLMFTLAPAIFMVLWDYFFG
FT                   GVNLYTALAVLSLGTARITVNLTAYTIGGERAYKTFESLLSTPIGTGALFLGKGLLALL
FT                   FSLIISVLAVLLVLVVSVFIGGTALLSPDQWLVLTAGLLFSLLMTYVTGLSTMLMKKPR
FT                   QGLYVAAVLSFLAAAPALAVWLLPGSPMLWALGSLILLLTADLLLAVFIHRKISREQLM
FT                   RCI"
FT                   /protein_id="YP_003958483.1"
FT   gene            complement(481940..482212)
FT                   /db_xref="GeneID:9882405"
FT                   /locus_tag="ELI_0505"
FT   CDS_pept        complement(481940..482212)
FT                   /locus_tag="ELI_0505"
FT                   /gene_family="HOG000086397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826127"
FT                   /db_xref="GeneID:9882405"
FT                   /translation="MKGCDFVAELTSMRNIGREIEKKLKAVGICSAEELSQLGSKEAFL
FT                   RLKTRFSNVCLVHLYTLQGAIDHIEYNQLPDEVKRDLKSFSDELK"
FT                   /protein_id="YP_003958484.1"
FT   gene            complement(482287..483177)
FT                   /db_xref="GeneID:9882406"
FT                   /locus_tag="ELI_0506"
FT   CDS_pept        complement(482287..483177)
FT                   /locus_tag="ELI_0506"
FT                   /gene_family="HOG000039326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826128"
FT                   /db_xref="GeneID:9882406"
FT                   /translation="MGNKFIVDSMCDISEEILRRYEFESLPIPVTLDDKTYYDGIDITP
FT                   EMVINFVKNNPSSFPKTSQVQALAYQETFEKHLKNGDDVIYLALSSGLSGTYQTACLIA
FT                   SELLEKYPGRKISIVDSKCATTGMMMILHQGLKLDKLHKPHEEIVASMRFLAEHIQIFF
FT                   MVGDIRWLAQGGRISKNVALIGEMLKIVPILYFKDGQILAFDKVRGQKKALKKMMASVD
FT                   ERMADKDQIVGMINSTAPELQEKVKKYMTKEFGTKNFLIPEAGAGSALTVHIGVDCLGI
FT                   MFFDALPDNYVRVYP"
FT                   /protein_id="YP_003958485.1"
FT   gene            483557..483970
FT                   /db_xref="GeneID:9882407"
FT                   /locus_tag="ELI_0507"
FT   CDS_pept        483557..483970
FT                   /locus_tag="ELI_0507"
FT                   /gene_family="HOG000290245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826129"
FT                   /db_xref="GeneID:9882407"
FT                   /translation="MCEYMILEDFNMDKYIYDNSNGLWYELQGDYYIPCLVLPDEKEER
FT                   HIGIWGHRHLRYIREHKKVFYTDLLISGKLQSYLADVEEQAQELFDRLMKQRAEREGIT
FT                   ETLKAENQMLWVGRMNALRSAVTETVNTEVIFV"
FT                   /protein_id="YP_003958486.1"
FT   gene            484252..484890
FT                   /db_xref="GeneID:9882408"
FT                   /locus_tag="ELI_0508"
FT   CDS_pept        484252..484890
FT                   /locus_tag="ELI_0508"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826130"
FT                   /db_xref="GeneID:9882408"
FT                   /translation="MRTYNEEARKAKKTDIMERSFACYAENGFSSVGIKAIAKACDCSV
FT                   ATLYLYFDNLDDLIVKSTEYCMGKVEDEFMAKAPTDVEDLWRFIDEIPYWTAKNHGKKY
FT                   RLMYQVYTHPKYREYGQKFFAGVDERYTQYAKSFESKLGIPYEKLTPLIFILIRACVHY
FT                   ALFEDAFYLKAQIEALKETLELFIMKYNPKVRSGVVTEKAKIFKGISPQ"
FT                   /protein_id="YP_003958487.1"
FT   gene            484981..485820
FT                   /db_xref="GeneID:9882409"
FT                   /locus_tag="ELI_0509"
FT   CDS_pept        484981..485820
FT                   /locus_tag="ELI_0509"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826131"
FT                   /db_xref="GeneID:9882409"
FT                   /translation="MKTIKKLIPVLSILLFVVSLFMIITANKEPKSEGIANQMKEYYLN
FT                   DTGPEGNTFYDYNVSSTSLPETDEKGKCKLIKLPLFRQSHNFTCGVACVASVLRYAGYD
FT                   FDTREDRLLWELEATPENGTNYMNIAEYLESVRTEGFPNTPVIATEVVCVDYASNEYGL
FT                   KLTDSLLLQFRAALDDGSPIICAIQAWKDDGDYNTETEDDGHYVVLIGYQKDAKKDTYI
FT                   YYFMDPSTSGSYTYLTEEEFILRWHDNLEGKSKRIGIKVSYLNSTQEVPINIAYHID"
FT                   /protein_id="YP_003958488.1"
FT   gene            485947..487068
FT                   /db_xref="GeneID:9882410"
FT                   /locus_tag="ELI_0510"
FT   CDS_pept        485947..487068
FT                   /locus_tag="ELI_0510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Penicillin V acylase-like amidase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826132"
FT                   /db_xref="GeneID:9882410"
FT                   /translation="MNKAKKRILIVLLAILAVVVFALLAFLGLYFTRIQTIGSIEQLTD
FT                   YADGYNLYRMDVKYDYDLDDIIDYGIQDDQTMIDAILKEALPLLPVTIKAPNFGCTVFS
FT                   LTDTDGDVHMGRNYDFSKDTSAMLVYCAPKDGYKSIAFAALDNVSANVPDENIKKELAS
FT                   LTAPFICLDGMNEKGVSIAVLTLDSEPVRQNTGKPVIATTLAIRLVLDRAATTEEAVEL
FT                   LRSYDMFASSGRDYHFYINDASGDGRVIEYDIDGEPRELIDTPSEAVTNFFIRYKDEVL
FT                   PNQKNGIYGHGKERYDAVMEVLEAEKGNYTNDTVWNAMKSAAQDPNPDDITSNTQWSIS
FT                   YNNTDLTADIAIRRHWSDVTHCELETKVTTPLK"
FT                   /protein_id="YP_003958489.1"
FT   gene            487069..487245
FT                   /db_xref="GeneID:9882411"
FT                   /locus_tag="ELI_0511"
FT   CDS_pept        487069..487245
FT                   /locus_tag="ELI_0511"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826133"
FT                   /db_xref="GeneID:9882411"
FT                   /translation="MVQGSKMKGNAKAPRFQGAGTLVVNPTKLDDAYDAFVKLGLDVIY
FT                   SQDYEKCKDNMKS"
FT                   /protein_id="YP_003958490.1"
FT   gene            complement(487458..488882)
FT                   /db_xref="GeneID:9882412"
FT                   /locus_tag="ELI_0512"
FT   CDS_pept        complement(487458..488882)
FT                   /locus_tag="ELI_0512"
FT                   /gene_family="HOG000156909" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826134"
FT                   /db_xref="GeneID:9882412"
FT                   /translation="MARHSFIQMSKLSNVKGRISYITSKARQENLYATYRTADNTFWGN
FT                   LARECQQEFKRSGTPGRCIEARELIIALPEVYTTYEPQQVLEDFTEEFHRRYDVECVSA
FT                   LHHNKKKTNYHIHLIFSERKLLPKPDVKIATRSVFYDETGQRVRTKKEITGEDGQMRKG
FT                   CTVIKKGEVYESHLFTTKDERFKSEAFIAEAKEVYTALINFHISDPEQRLKVFDKNSVY
FT                   LPTKKIGKNNPKEEEIKADNAARQEWNQAADMALITGISEETILEIKQTQIHEKVSQSI
FT                   RNSGWLPNLFRSIVSRAKDFLQNLIREQSMPPKPTLDIDMAEFRHMRNLMIKLQDKAKE
FT                   IKHLQDKVLPELKQQLAETKGIFKGKERKALEAQIQQTEREIADKLDKIPDTLKADGYP
FT                   DVQVFMATYRKAEAVVEQYNRELAEWERKVKENSKPDEKERYAPPERKSVRDQLRRLQA
FT                   ESRQIKPKHRTHDRER"
FT                   /protein_id="YP_003958491.1"
FT   gene            complement(489134..489349)
FT                   /db_xref="GeneID:9882413"
FT                   /locus_tag="ELI_0513"
FT   CDS_pept        complement(489134..489349)
FT                   /locus_tag="ELI_0513"
FT                   /gene_family="HOG000078315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826135"
FT                   /db_xref="GeneID:9882413"
FT                   /translation="MNAIKMGMTIEEAAETSGIGRNTMRKLVDWGKLPVLKVGRKTIIR
FT                   RDTLERFMTVNQGRNLLNEKDVRKVE"
FT                   /protein_id="YP_003958492.1"
FT   gene            489532..490194
FT                   /db_xref="GeneID:9882414"
FT                   /locus_tag="ELI_0514"
FT   CDS_pept        489532..490194
FT                   /locus_tag="ELI_0514"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826136"
FT                   /db_xref="GeneID:9882414"
FT                   /translation="MKEETMFTPKQVGERIKERRIELKLSMPELGKRISVNKSTIQRYE
FT                   ADGVDPKRTMIINGLAEALLTTPEWLTGLSEEKEYDAKTLCQRDIEAHIAKYLDSVSVV
FT                   QGEPHQQLLTTFLGKMIDLYSVLCYHFADAMAEVDRVAADEGLKESLMRYAIESGAITE
FT                   KVYRNEMEAPIEDMKRFLDGILHIYDEGRTKVSMGELFGIVTAAEERLAEKKNAVAP"
FT                   /protein_id="YP_003958493.1"
FT   gene            490303..491601
FT                   /db_xref="GeneID:9882415"
FT                   /locus_tag="ELI_0515"
FT   CDS_pept        490303..491601
FT                   /locus_tag="ELI_0515"
FT                   /gene_family="HOG000156908" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826137"
FT                   /db_xref="GeneID:9882415"
FT                   /translation="MAKGSVRKKGKKWYYRFYIEDESGNRVQKEFPGTESKAETEALLR
FT                   KAMEDYEEKKFVAKTENVTVGTLLDMWVEEELKPGNLSNGTVMAYQGTVNRIKQHPIGN
FT                   RKLKSVTADHLQAYIDFLSFGGTNADGTQAKALSKGYLRLFSAVLQGAFRFAVFPKRLI
FT                   SFNPMQYVVWRGKKEEYELFSDEDGDVTSVPTISHEQYLKLEDFLKKKYNPALLPIQIA
FT                   YYTGLRIGEVCGLTWQDINLEGQYLTVRRSMRYNGARHKTEIGATKRKKVRTVDFCDTL
FT                   AAILKTAKAEQHKNRFRYGELYSLNYYSEVKEKDRTYYEVYSLPRTEEVPEGYKEISFV
FT                   CLRPDGAFESPSTVGIMCRAARKKVEGLEGFHFHQLRHTFTSNLLSNGAAPKDVQELLG
FT                   HADVSTTMNIYAHATREAKRTSARLLDKVVGGE"
FT                   /protein_id="YP_003958494.1"
FT   gene            491749..493899
FT                   /db_xref="GeneID:9882416"
FT                   /locus_tag="ELI_0516"
FT   CDS_pept        491749..493899
FT                   /locus_tag="ELI_0516"
FT                   /gene_family="HOG000270498" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA binding S1 domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826138"
FT                   /db_xref="GeneID:9882416"
FT                   /translation="MEYLIDKLAQEFNIQPKQVQDTVELIDAGNTIPFIARYRKEVTGN
FT                   LSDVLLRDLDARLTYLRKLQKRKEEIAGSIEEQGKLTPELAAAIDKAATLQEAEDLYLP
FT                   YKQKKKTRASVAKEKGLEPLANKIYLQLDTEADLAEDAKNYINPEKGVETAEDALQGAM
FT                   DIIAETISDNADYRKKIRRMVTEKGAVKSTVTKAFAEEKTEFENYYDYGEPVKKIANHR
FT                   VLALNRGEKRKVLAVKIIDPAEEIRTYLKKSILRDKASGYLVSAIEDSYKRLIFPSIER
FT                   EIRTELKEKAEESAIKMFALNLKKLLLQPPFKDKTTMGFDPAFRTGCKIAVLDPMGKLL
FT                   DTATVYPTEPKNEVAKSEKILLGLIEKYKVDIISIGNGTASRESEQFVAEMLKKTDRPV
FT                   QYIVVNEAGASVYSASELGAEEYPDINVSLRGAISIAGRLQDPLSDLVKIDPKHIGVGQ
FT                   YQHDVNQKELEKVLDDTVEDAVNNVGVNINRASVSLLKHVAGVNKTIAKNIIDYREQNG
FT                   KFGSRKEIKKVKGLGAKAFEQCAGFLRIDDGDNILDNTGVHPESYKAVQNLLKSMGLTT
FT                   ADLEADKLAETVTRLNALDVKATAAMLEIGEPTLRDIIKELKKPGRDPRDSAPKPHLKS
FT                   DVLSIEDLKPDMELVGTVRNVIDFGAFVDIGVHQDGLVHISQISDRYISHPTDVLSVGD
FT                   VVTVKVLSVDVERKRIGLSMLV"
FT                   /protein_id="YP_003958495.1"
FT   gene            494076..495416
FT                   /db_xref="GeneID:9882417"
FT                   /locus_tag="ELI_0517"
FT   CDS_pept        494076..495416
FT                   /locus_tag="ELI_0517"
FT                   /gene_family="HOG000053129" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MATE efflux family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826139"
FT                   /db_xref="GeneID:9882417"
FT                   /translation="MEKTEMITGSLSKIFVHYVSLNVLSMIGLSCYILADTVFVAGGVG
FT                   NSGLAALNLVLPAYSFINGAGLMLGMGGATRYAVLRGEGRDTAADGVFTMTLAMGAALG
FT                   CLLTLIGIFFTPALAGLLGAEGETLSLSVQYLRTILLFSCAFIVNNILVCFIRNDGSPQ
FT                   LSMAAMLAGSFSNIVLDYSFIFPMGLGMFGAALATGLAPVFSILVLSLHFLRRRNHFRP
FT                   AACTPQRRIVREILTTGLPSFVTEFSSGVIILLFNFTILRLTGTTGVAAYGVISNIALI
FT                   AVAVFTGIAQGIQPIVSVNYGAGRTGRVWRTYAAALLLGAVLGLLFLALGLLEADGIVG
FT                   IFNWEGNVEMDRIASSGIHLYFLAFLFMGANIVTTSLFASINRPGPSFAVSILRGLAAV
FT                   VIFLLILPPALGMDGVWLTIPAAELTTLFVSGILLYRAKGLKSEKIH"
FT                   /protein_id="YP_003958496.1"
FT   gene            495503..495976
FT                   /db_xref="GeneID:9882418"
FT                   /locus_tag="ELI_0518"
FT   CDS_pept        495503..495976
FT                   /locus_tag="ELI_0518"
FT                   /gene_family="HOG000239163" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826140"
FT                   /db_xref="GeneID:9882418"
FT                   /translation="MYEIGDKIVYPMHGAGVVKDIEEKEIFDTTQMYYLMEIVSEGMEI
FT                   LIPVDKADEVGVRDIVTSDVIEKMLDSLEEPSDQMNGNWSKRYQDNMDILKSGDIFDVA
FT                   KVVKNLTLLDRKKGLSTGEKKMLTSARNFLISEMVLVQGRSKEESLQVIEEKI"
FT                   /protein_id="YP_003958497.1"
FT   gene            496124..497230
FT                   /db_xref="GeneID:9882419"
FT                   /locus_tag="ELI_0519"
FT   CDS_pept        496124..497230
FT                   /locus_tag="ELI_0519"
FT                   /gene_family="HOG000218447" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PilT protein domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826141"
FT                   /db_xref="GeneID:9882419"
FT                   /translation="MLQKFLRVCFSILGILLGSALAQMVIINEWIQATLHIQFTPEIEL
FT                   GTYIVIMVLCGLIFFIFFPLILKGVKNLTKMVEASMEDVRLVDIALGVGGLVIGLIIAM
FT                   LISFAFYQIPFPWVSSLLTAVIYIVLGYLGFTLPVKKRDDIVAAIQAGKKERDGSASTR
FT                   KISKKKNNAAAKVLDTSVVIDGRIYDICKVGFMEGPLIVPVFVLNELQLIADSSDDLKR
FT                   NRGRRGLDIINKMQNDLDVPVQISEEDYDDIQEVDAKLVRMAKETKCKILTNDYNLNKV
FT                   ATVQGAEVLNINELANAVKPVVLPGEEMKVLLVKAGKESGQAVAYLDDGTMIVVENGRK
FT                   YIGDNITVIVTSILQTAAGRMIFAKPRK"
FT                   /protein_id="YP_003958498.1"
FT   gene            497398..498786
FT                   /db_xref="GeneID:9882420"
FT                   /locus_tag="ELI_0520"
FT   CDS_pept        497398..498786
FT                   /locus_tag="ELI_0520"
FT                   /gene_family="HOG000218116" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA methylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826142"
FT                   /db_xref="GeneID:9882420"
FT                   /translation="MQIPEAFKEKMRGLLNDEDYEKLMSSYDGTVNKGIRTNTLKCTPE
FT                   EMARKTPFELEPVDWCPTGYYIDSDIRPGKNPAYYAGLYYVQEPTAMTSAEALAPEPGD
FT                   WVLDLCAAPGGKSTQLACMLGGQGLLVANELVNNRAEILASNVERMGVPNALLFNEFPE
FT                   RLAARFRERFDKILVDAPCSGEGMFRKDNGAAEEWNPERVLHCAKRQIKILESVDKLLK
FT                   PGGVMVYSTCTFSPEENEQVIEDFLGNDRYELMDIDLGGLNDRGRPEWSEKGTPALTKT
FT                   LHVMPFHVRGEGHFIAKLRKTAECPPEEEALRLKRKSRLKPAGRRELGDYEVFAEEYLN
FT                   RRFNNLHLQGDQLYSLPEGITLKDIEGLKVLRPGIHLGTLKKNRFEPSHTLAMVLKPED
FT                   FKTVYTVKDDEEAYTYLKGEPITGADLKGWVLVCFEKWPLGFGKASQGMIKNHFPKGLR
FT                   IRKK"
FT                   /protein_id="YP_003958499.1"
FT   gene            complement(498893..500155)
FT                   /db_xref="GeneID:9882421"
FT                   /locus_tag="ELI_0521"
FT   CDS_pept        complement(498893..500155)
FT                   /locus_tag="ELI_0521"
FT                   /gene_family="HOG000012574" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826143"
FT                   /db_xref="GeneID:9882421"
FT                   /translation="MKFSKIEKSWILYDVGNSAFVMLVSTIIPIYFKNIASSAGVSMAD
FT                   STAYFGYATSISTLIVAILGPILGTIGDTSGYRKRLFLLSLGVGAVGCVALGIPMGWLL
FT                   FLVMFVVAKIGYNGSLIFCDSMLTDVTTDDRMDEVSSVGYAFGYIGSCIPFAACMLLVL
FT                   FSGSIGISTQLATSISFVITAVWWVLMTVPLLRGYRQKFSVGHVSNPVKEGFVRLGHTI
FT                   KNIRQDKNIVLFLVAFFFYIDGVYTIIEMATSYGKDVGVGDNDLLMALLLTQIVAFPFA
FT                   LLFGWLSKRVKTEKLIYVGIIGYFFIALFAIQLDRAWEFWFLAVCVAIFQGGIQALSRS
FT                   YFAKIIPKEKSAEYFGFYDIFGKGAAFTGTLLVSVVTQLTGHSRYGIISISFLFVIGFV
FT                   LFVIAVRRINHEKSSGTHAGL"
FT                   /protein_id="YP_003958500.1"
FT   gene            500407..500700
FT                   /db_xref="GeneID:9882422"
FT                   /locus_tag="ELI_0522"
FT   CDS_pept        500407..500700
FT                   /locus_tag="ELI_0522"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826144"
FT                   /db_xref="GeneID:9882422"
FT                   /translation="MDRKRQQENEQAAGILKALAHPVRLCMVRGLMERGRNNVSYMESC
FT                   LDVSQSGISQHLSKLKAAGIVRGTREGNEIYYELCNEQVKEIVEVLFKEEQQ"
FT                   /protein_id="YP_003958501.1"
FT   gene            500697..503186
FT                   /db_xref="GeneID:9882423"
FT                   /locus_tag="ELI_0523"
FT   CDS_pept        500697..503186
FT                   /locus_tag="ELI_0523"
FT                   /gene_family="HOG000276710" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Multidomain redox protein (NAD(FAD)-dependent
FT                   oxidoreductase Rhodanese domain, Rhodanese domain,
FT                   SirA-like redox domain, Peroxiredoxin domain)"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826145"
FT                   /db_xref="GeneID:9882423"
FT                   /translation="MKKILIVGGVAGGATAAARLRRLSEEDEIILFERDEYISFANCGL
FT                   PYYIGDVIKDRSKLLVQTVAGMSKRFNLDIRNFSEVVSIDRAGSTVEVKNTKTGETYTE
FT                   TFDHLILSPGAKPIAPPIPGLAEADSIFTLRNVADTDKIKAEVTERSPKRAVVVGGGFI
FT                   GIEMVENLRELGINVTLVEKLNQVLKPLDYEMAQIIHQELNAHGVNVILGDGVDHFEDA
FT                   GKKVVLESGMKLDADMVILAIGVAPENKLAKDAGLKLGTRGHIVTTETYEVMDGANGEV
FT                   IKNIYAIGDAIEVRDFVDGSQTAVPLAWPANRQGRTVADHINGIPFKNHGIQGTSVAKV
FT                   FNKVFATTGNNVGQLRAKGLPFQQIHAHRGNHAGYYPDSTNIALKLIYDPKTLKVLGAQ
FT                   AVGQEGTEKRIDVIASVMKMGGTIYDLQDMELSYAPPFSAAKDPVNILGYIAQNIDEGV
FT                   YKTVEWDEIDDIIAGGGYLLDVRTPVEFGAGHVEGSHNLELDTLRDHIDEIPVGKDEPL
FT                   YITCQVGLRGYLAIRILEDHGFTNLYNLAGGYNTYKAGHYKLAEPNFDVEGSKLGEPEA
FT                   PEGAKADVNPVKTVDVTGLQCPGPLMATYKAVSEVKEGELVQTIATDFGFVQDVECWCK
FT                   TNGHTLISQETRGNKYIATIRKGGGASACGLAAADPAVQKNATMVVFDGELDKAIAAMI
FT                   IAQGAAAQGKDVTLFFTFWGLNVLRKPKAPKVKKNRIEKMFGLMMPKGARRLPLSKMNM
FT                   FGIGPAMIKSIMKKKNVDDIETMIHKAQDAGVRFIACTMSMELMGIKKEELIDGIEYAG
FT                   VGTYIASNENVGTTLFI"
FT                   /protein_id="YP_003958502.1"
FT   gene            503256..503369
FT                   /db_xref="GeneID:9882424"
FT                   /locus_tag="ELI_0524"
FT   CDS_pept        503256..503369
FT                   /locus_tag="ELI_0524"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826146"
FT                   /db_xref="GeneID:9882424"
FT                   /translation="MVKSKIKKLIFRYMDTPLFLESLHAGKREGKLKINYF"
FT                   /protein_id="YP_003958503.1"
FT   gene            complement(503415..504179)
FT                   /db_xref="GeneID:9882425"
FT                   /locus_tag="ELI_0525"
FT   CDS_pept        complement(503415..504179)
FT                   /locus_tag="ELI_0525"
FT                   /gene_family="HOG000034586" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exodeoxyribonuclease III"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826147"
FT                   /db_xref="GeneID:9882425"
FT                   /translation="MKLYSWNVNGIRAVAQKGFTEWVEAAQPDILCLQEVKAAEDQISE
FT                   DIRCIPGYHSFFHAAERKGYSGTAVYYKEEPISITTGLSEDRFNHEGRTIIMEYPEFTL
FT                   FNIYFPNGQKDDERLQFKMDFYDCFLKDVNALVAQGKKVIICGDVNTAHTEMDLKNPKS
FT                   NAKRSGFLPMEREWLDHFFENGYVDTYRHLHPDTVEYSWWSYRFNARANNAGWRIDYFF
FT                   VSDNAIDMVKDAAIHTEVTGSDHCPVSIEIKI"
FT                   /protein_id="YP_003958504.1"
FT   gene            504285..505784
FT                   /db_xref="GeneID:9882426"
FT                   /locus_tag="ELI_0526"
FT   CDS_pept        504285..505784
FT                   /locus_tag="ELI_0526"
FT                   /gene_family="HOG000222138" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826148"
FT                   /db_xref="GeneID:9882426"
FT                   /translation="MNYIIGIDGGTTKIKAVLFDTTGHEIETVAAPSDILEDGVRKELD
FT                   MDFFWEKTAACVRLLMEKGPATPEEILAVGVTGQGEGLWALDKNNRPVSRAILWNDGRA
FT                   HEENWAVNEKTPGIGKLVHRNLGTPAGAGSALLLLRWTKDNRPDVYRQIQTVFFAKDWL
FT                   RYCMTDKIATDPTDGGAAYLRLIDGAPAVQALTVLSLSEAESGIPEVLPSDTIAGQLTA
FT                   AAAEKMGLRAGIPVVTGAMDVVASAVGTGAVGVGDAAVVLGTTCAVEQVLRLRDCDVTR
FT                   CRRHCLHHVQADLAIDLSSTINGMENVEWMMREIARSGNYRVVEGLIEDTRPGSGGVVY
FT                   HPYLSAAGERAPFQHRDASASFFGVNSGTTKGDLMRAVYEGLAFSVRDCLEGGGYRGRL
FT                   LLSGGGAGSETLSQMIADVTGQSVVVSRGAEFGALGAAMTAGVAVGLFDSIGNAAVKCC
FT                   RLKKIYKPRQNAMYEKCYTFYRELRAAFGPLWERRAEIFEK"
FT                   /protein_id="YP_003958505.1"
FT   gene            506075..507016
FT                   /db_xref="GeneID:9882427"
FT                   /locus_tag="ELI_0527"
FT   CDS_pept        506075..507016
FT                   /locus_tag="ELI_0527"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826149"
FT                   /db_xref="GeneID:9882427"
FT                   /translation="MEDKNLYIKIAHWYYTLGMTQDEIAKRLSFTRQRVNRIISSLRDM
FT                   GIVTIKVNGYAQGNVAYEGAIEEHFGLKRVIIAESYDGESNYMPSLANTASQYLEDYLQ
FT                   PGMSIGVSWGETLAATISNLSFKRRSECTVVQMVGAQNIDMDMLKSDEIARSLADKLDS
FT                   VCYILYAPVVVDHAETKRMLMEERTIQKSYELMRRCDVALFGIGQVSRESTMCKRGLLK
FT                   VEDIDRLRQDGFIGDVCVNPVTIDGRWQDCFIRDRVISANMEILKNIPNVVAIAGGEDK
FT                   TEAIIGCLASGGIDTLITTDMTAERIVRTLGL"
FT                   /protein_id="YP_003958506.1"
FT   gene            507124..508656
FT                   /db_xref="GeneID:9882428"
FT                   /locus_tag="ELI_0528"
FT   CDS_pept        507124..508656
FT                   /locus_tag="ELI_0528"
FT                   /gene_family="HOG000222138" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826150"
FT                   /db_xref="GeneID:9882428"
FT                   /translation="MKYIIGIDAGTSNVKAVLFDVDGNEILVEVLENEPIYIGDTDVEQ
FT                   NMNILWEKVALCIKMIMENGPAKADDILGIGVTGQGEGIWLMDENGEPVQDAILWCDGR
FT                   AADEVAKVTEDDPKLGEMIFKTTGTPPLTGTQLMLLKWMKNNRKEVLDKAKTMFFCKDW
FT                   VRYKLTGTINGDMSDTGTSLMDAEKGEVAVDLLKALDLGEYVDLIAPVVISNKIVGNVL
FT                   DRVAKDLGLNPGTPVVAGAIDVVAAAVGIGAVEDKDICVILGTTCANEIFMKKEDCEFG
FT                   KEGTRLEKHAVGDLFVNLMPTMNGTPNIDWVLNEIALTKDFSKVDIMIKDVPAGSGGVI
FT                   YHPYISAAGERAPFYHPHAKANFFGISANTKRADLVHAVYEGITLSIKDCLQGADRNSK
FT                   IFIAGGGAKSSIWAQMISDVTGMEVVVSAGNEFGAKGVAMMVGLAVGEYESYTDAARRT
FT                   CKSERIYRPRPDQNAIYEDIYTLYKGIRIACESLWTARADVMKTISKRTREN"
FT                   /protein_id="YP_003958507.1"
FT   gene            508679..509713
FT                   /db_xref="GeneID:9882429"
FT                   /locus_tag="ELI_0529"
FT   CDS_pept        508679..509713
FT                   /locus_tag="ELI_0529"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826151"
FT                   /db_xref="GeneID:9882429"
FT                   /translation="MKIFFTAEYDEEQLKPLYEMGEVVKDGWAIGLPKMQEEELMEKSA
FT                   DADIIITSYDDITRAVIENAPNLKLIACTRATPVNVDMAAAKERGIPVIYTPGRNSDTT
FT                   AEMTVGLMLSIARKIPMAYKALKEGKFTADPNAQKVTKEGLKVDMVWDMEPGSPYMVFK
FT                   GTQLHGKTLGIVGYGSIGRRVGKIARAFGMELLIYDPFLCPIDLEEVGVKKAEKLEDLM
FT                   KNADFITCHMKITPETTGIISREMIALMKPTAYFINSSRGAILDEEALIDALREKRIAG
FT                   AAFDVYAKEPIASNHPYITELDNVVITPHIAGATDDVLVNHTKQIVADVKRFAEGRRML
FT                   YEYR"
FT                   /protein_id="YP_003958508.1"
FT   gene            509768..510430
FT                   /db_xref="GeneID:9882430"
FT                   /locus_tag="ELI_0530"
FT   CDS_pept        509768..510430
FT                   /locus_tag="ELI_0530"
FT                   /gene_family="HOG000218184" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="class II aldolase/adducin family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826152"
FT                   /db_xref="GeneID:9882430"
FT                   /translation="MLLQKEREDVVKYCQMLITHGLTKGTGGNISILNREEGLFAISPS
FT                   GIDYFETEPEDIVVMNLKGEIVDGDRKPSSEHELHRIFYTDRDDIAAVVHTHSVYSTVL
FT                   ATLREGLPASSYLVAFSGYDVRCAEYASYGSMELAKNTFEAMKERNAAFMANHGLIAGG
FT                   SDILNAFNIVEQIEQCAEVYVKARAIGTPVLLDHDEMTRMIDSFNNSYGQRKAKKDL"
FT                   /protein_id="YP_003958509.1"
FT   gene            510527..511180
FT                   /db_xref="GeneID:9882431"
FT                   /locus_tag="ELI_0531"
FT   CDS_pept        510527..511180
FT                   /locus_tag="ELI_0531"
FT                   /gene_family="HOG000218184" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ribulose-5-phosphate 4-epimerase-like
FT                   epimerase/aldolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826153"
FT                   /db_xref="GeneID:9882431"
FT                   /translation="MKYTEERQAIIDACLWLQDTGMVIGTWGNVSVRLDEETIMVTPSR
FT                   IEYADLTPADMVIVDMAGNKVEGEHKPTSEMHVHRLIYAARPDVGAVVHCHPVYASAMC
FT                   AAEHGIPVIFEEMSQMIGGEIPITAEYVNAGQHVRLGEVTAEALGDKNAVLIRNHAPVC
FT                   VGRDLKEALTCSQVTEKAAKCYLALRGGVEITTIPEAMVKAERHRFLYSYGHEQ"
FT                   /protein_id="YP_003958510.1"
FT   gene            511353..512015
FT                   /db_xref="GeneID:9882432"
FT                   /locus_tag="ELI_0532"
FT   CDS_pept        511353..512015
FT                   /locus_tag="ELI_0532"
FT                   /gene_family="HOG000218184" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ribulose-5-phosphate 4-epimerase-like
FT                   epimerase/aldolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826154"
FT                   /db_xref="GeneID:9882432"
FT                   /translation="MEYAKERKAIVEACRWLEANEMVIGTWGNVSARLDGGKLLVTPSR
FT                   VAFTDIYPEDLVVVDTEGCKVEGVWYPSSEVHIHRLIYARRGDVNAIIQCYPTYASAMC
FT                   ASQQGIPPIFEEMSQLIGGGIPVTPEYINAGQHRRLAEAVIQTIGQKNAILIRNHAPMC
FT                   FGRDMTEALTCCKVTEKAAKSYLALKGGVDVAVIPDEMVDAERERYLNRYGHEGCEE"
FT                   /protein_id="YP_003958511.1"
FT   gene            512095..516132
FT                   /db_xref="GeneID:9882433"
FT                   /locus_tag="ELI_0533"
FT   CDS_pept        512095..516132
FT                   /locus_tag="ELI_0533"
FT                   /gene_family="HOG000160452" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="celll wall surface anchor family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826155"
FT                   /db_xref="GeneID:9882433"
FT                   /translation="MPVGYKKAKVSELRKEKTMKKIVSAVISLLMILQFSLPQAAFAQE
FT                   NGSVVNETVAPAAVDQTVEKNAEPEQPEQAAATEGQLKKVTEPAAILPEASEKVLVQPA
FT                   AENQPKAGGRDIKEIFQSLGYSEADSTILTGMTVTYQDVAGKPVAEPTIDDTVRFDITF
FT                   ALPEDVRAQMQAGDYYQFELPDNIKIANNTSIPLIDAAGNQYATALVGKDGTVTITFTD
FT                   EVTKNSDISGNLNFSGGFDKDGMTGPGNTVIKIPNEEKLPPAEVVVRPSAGSAIEKNGY
FT                   FDRNMNPEKVIWNVDINKSLDTVAGAAVTDTLPAGLTLESVTVYQIEVDFDGNVVEGSQ
FT                   KPVDPSEYTVAADGTVTFKNTIHAAYRIEYTTRIDPEKKPADGGTIIFKNEAALSGDNI
FT                   SEITASATVDAEYGKILEKSRENYDAQTQTFSWEIKYNYSEGKIPQKQAVVTDKIGSGM
FT                   DYVDGSLVLKEVYFNTDGSVKIVRTLEEGVDYQLDKTADGFKIQFLGDVDYAVQMTYQT
FT                   KVSGILDENQKYKNEVEIGTGQTDSASGSAKQQGVIKKFVSADQENRRINWSISVNKNN
FT                   YTMKDWSLTDTLSPGLFLDESSLVIKNQDGKTLERNKDYTLNYEQSSNNFDIVLIGDYN
FT                   PTSDSFKITYTTDYDTGATIFPDGNVYFKNDAVSSWTDTQGGKHSSKDEADYRPNDDAS
FT                   YNGFKNGSYNAVNKTITWTVGVNYNDLLLGRPTAIEDPITGNQVYVSGSVKIYHYTLSS
FT                   KGEPVKGDEIAPEEYDQFRIQEPNGQENILKILFPESAEGRYLIEFQTTLDGQVIHDSA
FT                   TYKNTATFTNGREVHLLEGEVSITNGGKLAAKSGIQDDDGYVKWQITVNPSQSALTDVQ
FT                   VIDRPSDNQIIDLSSLRVYGAQVDEGGGLTLDENIVLALGTDYTVDYVTNPETGQQELT
FT                   VNFLKEIDRAFFITYRTKVLLEEGSEQKVSNEVIIKGNNEEEVEGGDNQELGVIVNDGG
FT                   GTVVGKRGSILLEKDSATTHNPLAGAVFQLYDSNGVSLGAPVTTGSDGQVLFKELVYGN
FT                   YILKELKAPDGYNLDSALKQGITITVNAESSQTGKIQHLQNDPVQVTLAKEDENGDPLA
FT                   GAVFTLEIKQGENWKPIREETELKTGEDGHLTVEALEEGTYRFTEIQAPDGYVLNTQPI
FT                   EFTLVKNADGVIPALTLDPVVNYQGGLEITKTDANGRPLAGAVFKLTKDNVTVIEGLTT
FT                   EKDGTAKANGLAPGVYELVETSAPEGYTLDSTPVRFEIEARAAGAPAPVAIYLVNQKEK
FT                   PTEVTVKVPPDAQSPGQTPGKAVEKSPGTGLQGPGGIGTSLLLLVAAGIILWRRTKPKE
FT                   KR"
FT                   /protein_id="YP_003958512.1"
FT   gene            complement(516234..516923)
FT                   /db_xref="GeneID:9882434"
FT                   /locus_tag="ELI_0534"
FT   CDS_pept        complement(516234..516923)
FT                   /locus_tag="ELI_0534"
FT                   /gene_family="HOG000049433" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826156"
FT                   /db_xref="GeneID:9882434"
FT                   /translation="MRKDNDQRIYLTDDNTSVVYLKNVIDDPDIQVGEHTYYHDERNDP
FT                   RDFVKNNILYHYPQFHRDTIIIGKYCSLAMGTTFLCPIANHNFASMANYPFPIANDHWD
FT                   LPESFGGKVSTLKGPTIVGNDVWFGYESVIMPGVHIGDGAIIGTRSVVTKDVPPYTVVG
FT                   GDPARFIRKRFDDDTIAKLMALKWWDLPDAEIRDFLPELINGHIDAALEAKWLGDTARK
FT                   VIERLGK"
FT                   /protein_id="YP_003958513.1"
FT   gene            517184..518374
FT                   /db_xref="GeneID:9882435"
FT                   /locus_tag="ELI_0535"
FT   CDS_pept        517184..518374
FT                   /locus_tag="ELI_0535"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826157"
FT                   /db_xref="GeneID:9882435"
FT                   /translation="MKKITGTLTVLLMVLLFSFSPVWAAQGADTKPAPTAPAKTDTTAQ
FT                   VDKPHPADKDSGEAADKAETDSAASAEKAAVLKSGNYYTFKLPESVVVTEELALPLTDK
FT                   DGKLYGTAYVGTDGVVIISLTEEAAGDAAVADRLEAAGAEPAVVQTLGTQTGPQGSVVF
FT                   RKQDENSNGLEGARFELLKTDENNRIVAAVTSGADGSVRCDGLAPGTYRVVETQAPNGF
FT                   LRNLEILDFTVSDSAQTQHVVVDAGIHTSYQGRLSILKMDEERTPLPGARFKILDANGY
FT                   TLQKDLVTDSDGRIWVSNLAPGRYQVMETEAPSGYHLDATPVSFEVASEAEGEPAAMEV
FT                   KAINVRRSSKLRYSAGTASPNADTGVDSMDFLGLGFVVVAAVIGAGVMVYQKTKRK"
FT                   /protein_id="YP_003958514.1"
FT   gene            complement(518453..520351)
FT                   /db_xref="GeneID:9882436"
FT                   /locus_tag="ELI_0536"
FT   CDS_pept        complement(518453..520351)
FT                   /locus_tag="ELI_0536"
FT                   /gene_family="HOG000271635" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826158"
FT                   /db_xref="GeneID:9882436"
FT                   /translation="MNLLSVINLKKTYGVKTLFEKINFSIEDSDKIGVIGVNGTGKSSL
FT                   LRIVAGQDTPDAGEVRVYGSKRIEYLAQTPELDPNITVLAQVFRADTPEMNTLRDYEHT
FT                   LDLLMRYPEDEKLQRHLLALTDTIDAGGLWNLKSQVETILTQLGIRDFDKTIGTLSGGQ
FT                   RKRVAMASVLLTPCDLLILDEPTNHLDNETITWLEKYLENRKGALLMVTHDRYFLDRVV
FT                   NKTIELDGGALYEYTGNYSEFVEKKAARRAFESVMEQKRQNLYRRELAWIRRGARARTT
FT                   KQKARIQRFEDIKNSASDLSEDILEINVGFTRLGKKVVDLDHVSKSFKNQCVVKDFIYI
FT                   LGPDERIGIIGKNGRGKSTLLNLIAGKIRPDNGAIVIGDTVKIGYFSQESEDMDLNLRA
FT                   IEYIREGAETVENARGEVITAAQMMELFLFDRYAQWVRISELSGGERRRLYLLRILMSA
FT                   PNVLLLDEPTNDLDIDTLKILENYLDDFQGSVLTVSHDRYFLDRVCDTIFSFTGGGEIL
FT                   VQTGNFTDYMQKHAGRDQDAATNKPSEQKSEKPRQKAVKLSYREQQEYDRIDADMAQME
FT                   ARLEAIDTEMAGIATDYTRLQALTEEKDALEDTLLEKMERKEYLEDIVRQSKKNQI"
FT                   /protein_id="YP_003958515.1"
FT   gene            520729..521910
FT                   /db_xref="GeneID:9882437"
FT                   /locus_tag="ELI_0537"
FT   CDS_pept        520729..521910
FT                   /locus_tag="ELI_0537"
FT                   /gene_family="HOG000012238" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826159"
FT                   /db_xref="GeneID:9882437"
FT                   /translation="MAKEVVLAGAVRTAIGSFGGSLANVPVVDLGTIVIKEALNRAGVK
FT                   PEDVDEVLMGCVLQAAQGQSVARQSAVNAGIPVEVPALTLNNLCGSGLKCINLAAAMIQ
FT                   AGEADIIVAGGMESMSGAAYAVPKGRYGYRMGDGQFIDTMIKDGLTDAFNHYHMGITAE
FT                   NVAEQYDVTREDQDDFAAKSQQKCEAAQAAGRFDDEIVPVPVKVKKEIVEFKVDEFPRK
FT                   GVTAEGISKMRPAFKKDGTVTAANASGINDGAAAIVVMSAEKAKELGVKPMAKFVVGAS
FT                   AGVDPSIMGVGPIFSSRKALEKAGLTIDDMDLVEANEAFAAQSCAVGKTLNIPEDKLNV
FT                   NGGAIALGHPVGASGCRIMVTLLHEMQKRGAKKGLATLCVGGGMGVSTIVEMD"
FT                   /protein_id="YP_003958516.1"
FT   gene            521938..522714
FT                   /db_xref="GeneID:9882438"
FT                   /locus_tag="ELI_0538"
FT   CDS_pept        521938..522714
FT                   /locus_tag="ELI_0538"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-hydroxybutyryl-CoA dehydratase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826160"
FT                   /db_xref="GeneID:9882438"
FT                   /translation="MGFVKYEPQGAVAVITIDREKALNALNSEVLEDLDKVIDGVDLET
FT                   IRCLIITGAGQKSFVAGADIGEMSSLTQAEGEAFGKKGNAVFRKIETLPIPVIAAVNGF
FT                   ALGGGCELSMSCDIRLASENATFGQPEVGLGITAGFGGTQRLARLIPTGKAKEMLYACT
FT                   NIKAADALSWGLVNAVYPADELMPAALKLAGKIANNAPIAVRNTKKAINDGLEMGMDDA
FT                   IAFEAKQFGGCFESADQKEGMAAFLEKRKHEPFQNK"
FT                   /protein_id="YP_003958517.1"
FT   gene            522842..523681
FT                   /db_xref="GeneID:9882439"
FT                   /locus_tag="ELI_0539"
FT   CDS_pept        522842..523681
FT                   /locus_tag="ELI_0539"
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826161"
FT                   /db_xref="GeneID:9882439"
FT                   /translation="MKVGVIGAGTMGSGIAQVFASTDGYEVVLCDIKQEFADGGKAKIE
FT                   KALAKQVAKGRIDQAKMDATLAKITTGLRDAVADCDLVVEAVLEQMEMKHELFQALQGI
FT                   CKPECIFASNTSSLSLTEMSQGVDRPVIGMHFFNPVPAMKLVEVIAGYHTSQETVDTIK
FT                   KIATDIGKTPVQVNEAAGFVVNRILVPMINEGIEVYAAGTASAADIDTAMKLGANHPMG
FT                   PLALGDLIGLDVVLAIMEVLQAETGSDKYAPSPLLRKMVRAGVLGMKTGKGFFDYTK"
FT                   /protein_id="YP_003958518.1"
FT   gene            523715..524854
FT                   /db_xref="GeneID:9882440"
FT                   /locus_tag="ELI_0540"
FT   CDS_pept        523715..524854
FT                   /locus_tag="ELI_0540"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826162"
FT                   /db_xref="GeneID:9882440"
FT                   /translation="MDFNLSKEHQMLRTLYREFAENEAKPIAQEVDEEERFPQETVDKM
FT                   VKNGFMGIPFAKEVGGQGCDTLAYILAVEELSRVCGTTGVILSAHTSLGTDPIRKFGTP
FT                   EQKEKYLPRLASGELLGAFGLTEPGAGTDASGQQTKAVLEGDHYVLNGTKIFITNGGKA
FT                   DVYIIFAMTDKSKGTKGISAFIVEKDYPGFSIGTKEKKMGIRGSSTTELIFEDCIVPKE
FT                   NLLGKEGKGFGIAMQTLDGGRIGIAAQALGLAQGAFDETVAYVKERKQFGRSIAKFQNT
FT                   QFKLADMYARIEAARNLVYKAAIAKDTQKVFSVEAATAKLFAAETAMAVTTECVQLLGG
FT                   YGYTRDYPVERMMRDAKITEIYEGTSEVQRMVISGNVLK"
FT                   /protein_id="YP_003958519.1"
FT   gene            524879..525661
FT                   /db_xref="GeneID:9882441"
FT                   /locus_tag="ELI_0541"
FT   CDS_pept        524879..525661
FT                   /locus_tag="ELI_0541"
FT                   /gene_family="HOG000247878" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826163"
FT                   /db_xref="GeneID:9882441"
FT                   /translation="MNIVVCVKQVPDTNEVKLDPVTGTLIRDGVPSIMNPDDKAGLEAA
FT                   LELKDATGAHITVVSMGPPQADDVLREALAMGADEAILVTDRAFGGADTWATSTTIAAA
FT                   VKMLDYDLIITGRQAIDGDTAQVGPQIAEHLNIPNVSYAEDIKVEGDAVIVKRQYEDRY
FT                   HTIKVQMPCLVTALGEMNTPRYMTPGGIFDAYRTDEVKVWTLENIEVDTSNIGLKGSPT
FT                   RVFKSFPKALKPAGTVVQLDPQESADFLLEKLKEKFII"
FT                   /protein_id="YP_003958520.1"
FT   gene            525681..526691
FT                   /db_xref="GeneID:9882442"
FT                   /locus_tag="ELI_0542"
FT   CDS_pept        525681..526691
FT                   /locus_tag="ELI_0542"
FT                   /gene_family="HOG000247864" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826164"
FT                   /db_xref="GeneID:9882442"
FT                   /translation="MSLQDYKGVFVFVQQVDNVITPVSFELIGKGKELANDLDTEVTAV
FT                   VLGSKIDAMGKELARHGADRVIMVDDPALEVYTTEPYVHAFTEIINKYKPEVVLFGATA
FT                   IGRDMAPRVSARVHTGLTADCTKLEINPEDKGLMMTRPAFGGNIMATILCPDHRPQMST
FT                   VRPGVMQKLPTNDAAECEVIKEEVAGLSDHMNVEVMEIVKTVAEKMDIQDAKILVSGGR
FT                   GMASPENFKLLEDLADALGGTISSSRACVDAGWVEKDRQVGQTGKTVRPNLYIACGISG
FT                   AIQHLAGMEESDVIIAINKDETAPIFNVADFGVVGDVFKILPLFTEAVKKEMATR"
FT                   /protein_id="YP_003958521.1"
FT   gene            527021..527545
FT                   /db_xref="GeneID:9882443"
FT                   /locus_tag="ELI_0543"
FT   CDS_pept        527021..527545
FT                   /locus_tag="ELI_0543"
FT                   /gene_family="HOG000049430" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826165"
FT                   /db_xref="GeneID:9882443"
FT                   /translation="MSGKNIFIAKSADVLGKVRIGDYSSIWYQAVLRGDMDSITIGERS
FT                   NVQDGSVVHVAPGGYCVKIGDGVTIGHNCTIHGCTIENNVLVGMGSTILNGAVIGENTI
FT                   IGAGSLVTQNKVIPPNSLVMGSPAKVIRPLTDAEIESIRANAREYMECMRLEPGKSYYE
FT                   NSDGIIVVRQL"
FT                   /protein_id="YP_003958522.1"
FT   gene            complement(527597..527908)
FT                   /db_xref="GeneID:9882444"
FT                   /locus_tag="ELI_0544"
FT   CDS_pept        complement(527597..527908)
FT                   /locus_tag="ELI_0544"
FT                   /gene_family="HOG000217613" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826166"
FT                   /db_xref="GeneID:9882444"
FT                   /translation="MILVNTDYISGKEFEMLGLVKGSTIQSKNIGRDISQGFKTIVGGE
FT                   LKAYNEMMNDARALATKRMVQEAEGLGADAVVNIRYASSAIMQGAAEVIAYGTAVKFV"
FT                   /protein_id="YP_003958523.1"
FT   gene            complement(527889..528110)
FT                   /db_xref="GeneID:9882445"
FT                   /locus_tag="ELI_0545"
FT   CDS_pept        complement(527889..528110)
FT                   /locus_tag="ELI_0545"
FT                   /gene_family="HOG000164341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826167"
FT                   /db_xref="GeneID:9882445"
FT                   /translation="MKVKKIIAPLVIGLLLILYFVGFIIVCFLIDIPLIVKILCSILPL
FT                   ALAGVSLHVLIQRIDEIRSGEEDDLSKY"
FT                   /protein_id="YP_003958524.1"
FT   gene            complement(528174..529505)
FT                   /db_xref="GeneID:9882446"
FT                   /locus_tag="ELI_0546"
FT   CDS_pept        complement(528174..529505)
FT                   /locus_tag="ELI_0546"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826168"
FT                   /db_xref="GeneID:9882446"
FT                   /translation="MKKLMTAILTFALIFNFTVQTACASAYKAGSVSVMTSTHDPGEGN
FT                   GETETPPTENPDPNPDPQPDPDPNPDPQPDPEPNPAPNPEPDPAPNPDPEPSDNNSNGG
FT                   DDGYYDSYDNNDYTPSYRNSYDDSDDYVPTESTTVETTVEEQVQEVQKVEGDYPITLTV
FT                   KETTIDVNLPSNVYTAATNQNTVTAAFNNDALNAAIAAGTAKLTEKQQAGSSALTKLVL
FT                   KAPAIETKGLTDPEVNIHVPAPALKNMQTAKVTLNVPINRDSIIVSPSILKSDDLNRLT
FT                   DGDKLVLGLKKGPSLSNSSYKLSETKLTPVTTPFTLEASTLKSTGALSALSAFEKPLEI
FT                   NIALTDDQASKLQTESQFTASKYNSGSDSVDPVVTTYHNDTKVATFNVNAPGDYLILLK
FT                   TADKGINPLFIAVPIVIVLIGGGVFAFFKLKNRRKRNIFGDYDD"
FT                   /protein_id="YP_003958525.1"
FT   gene            complement(529598..530086)
FT                   /db_xref="GeneID:9882447"
FT                   /locus_tag="ELI_0547"
FT   CDS_pept        complement(529598..530086)
FT                   /locus_tag="ELI_0547"
FT                   /gene_family="HOG000055774" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane spanning protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826169"
FT                   /db_xref="GeneID:9882447"
FT                   /translation="MNITTKKVCYTALLMAVTFIMISVVKIPIPNGYIHLGDAAVFLCG
FT                   FILGPVYGTIAAVIGAGAADYFAGFGAYIIPTMLAKGVMAYLTGYFLRGNPGRQKEITV
FT                   MVIAGVIMTLIYYVSEIILYGSFVSPLVNIPFNALQAIVGIVISMLLFRPLTQFRIES"
FT                   /protein_id="YP_003958526.1"
FT   gene            complement(530198..530797)
FT                   /db_xref="GeneID:9882448"
FT                   /locus_tag="ELI_0548"
FT   CDS_pept        complement(530198..530797)
FT                   /locus_tag="ELI_0548"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826170"
FT                   /db_xref="GeneID:9882448"
FT                   /translation="MNTKKKVLLGVLAVIVIVVGIMFFVPMFNGSKDAAKTTPTSAPSV
FT                   ADNTPTATPQPTVDNSATSGSLQTPPEMQAVIDANQADLYGNEDGQLAQSYPSNLLPLY
FT                   KVSGVGDSHDITTNNGNPGWTAVYGSTADTAELAQFYSDLMASAENFNAAGSDASTTIT
FT                   GTVDGCDISVTISPNNPQRTGLDYASSVSIFIEKVS"
FT                   /protein_id="YP_003958527.1"
FT   gene            complement(530898..531044)
FT                   /db_xref="GeneID:9882449"
FT                   /locus_tag="ELI_0549"
FT   CDS_pept        complement(530898..531044)
FT                   /locus_tag="ELI_0549"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826171"
FT                   /db_xref="GeneID:9882449"
FT                   /translation="MIVVLAAFQHRGCLSGKRVITASSSLHLVDSYMKSILPNFLKKIK
FT                   CIL"
FT                   /protein_id="YP_003958528.1"
FT   gene            531274..534393
FT                   /db_xref="GeneID:9882450"
FT                   /locus_tag="ELI_0550"
FT   CDS_pept        531274..534393
FT                   /locus_tag="ELI_0550"
FT                   /gene_family="HOG000246403" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826172"
FT                   /db_xref="GeneID:9882450"
FT                   /translation="MAVFKNLSNECVSETENKIASRWEEMDILDRTIKNRDDAENFVFY
FT                   EGPPTANGKPGIHHVIARTLKDSVCKYQTMKGYRVLRKAGWDTHGLPVEIEVEKQLGIS
FT                   SKPEIEAYGIAEFNKKCKDSVFSYEKQWREMSKRMGYFIDLENPYITLDNNYIESVWWI
FT                   LNKFFNEGFIYEGHKILPYCPRCGTGLASHEVAQGYQEIKTNTVVAAFKRADANEYFLV
FT                   WTTTPWTLAANVALAVNPEADYIKARSKSEVYICAKVLAPKLLGDDYEIIEEMKGKALE
FT                   NIPYERLMDFVPVPPNKKAFFVTCADYVTTEDGTGVVHIAPAFGEDDYQVGRKYNLPVL
FT                   QPVGEDGKYTETPWKGRFVMEDGLDIEIITWLKENGKLFKKEKVLHNYPHCWRCKTPLL
FT                   YYAKPSWYIEMTKIKDRLIENNNGVDWYPEFVGEKRFGNWLENLNDWAISRSRYWGTPL
FT                   PIWRCDDENCGELASVGSRAELAERAIEDISEDIELHRPYVDDVHLRCPKCGKPMTRVK
FT                   DVIDCWFDSGSMPFAQYHYPFENKELWESQYPADFICEGIDQTRGWFYSLLAISSFVTG
FT                   KSPYKKVLVNDLILDAEGQKMSKSRGNTVDPFELFDQYGADALRWYLLYVSPAWTPTRF
FT                   DVEGLKEVQSKFFNTLKNTYNFFTLYANTDGIDPRTFFVDYHKRPEIDRWILSKYNRLV
FT                   QEVRGEMEIYDLTKAVRKIQNFVNEDLSNWYIRRNRRRFWGSELTEDKKAVFNTTFEVL
FT                   EGLARLVAPFAPYISEEIYTKLTGAESVHLADYPAVNEDLIDEAVEEPMDLVRDLVSLG
FT                   RSAREEAQIKVRQPLSEIIIDGKYKDILGDLTKLMEEELNIKKVDFEENLGDFMNYTLK
FT                   PNFKVAGPILGKNVKLLGKALAGVNPAEVVAKLDAGEVYPVEIDDQTIELTKDFVDIRI
FT                   AAKEGFNVQTANNKFIILDTTLNEDLINEGYARECVSRIQQLRKGNGFEVNDHIDITYQ
FT                   ADAEVSAAIEAFANFIKKETLAESITKGEGNLEACTLNGHEAAFGVEKVK"
FT                   /protein_id="YP_003958529.1"
FT   gene            complement(534458..534592)
FT                   /db_xref="GeneID:9882451"
FT                   /locus_tag="ELI_0551"
FT   CDS_pept        complement(534458..534592)
FT                   /locus_tag="ELI_0551"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826173"
FT                   /db_xref="GeneID:9882451"
FT                   /translation="MLSHSLKVMDNPSFLLVLSSPYRLSRILILFLAFCKNIYFKNYV"
FT                   /protein_id="YP_003958530.1"
FT   gene            534661..536247
FT                   /db_xref="GeneID:9882452"
FT                   /locus_tag="ELI_0552"
FT   CDS_pept        534661..536247
FT                   /locus_tag="ELI_0552"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826174"
FT                   /db_xref="GeneID:9882452"
FT                   /translation="MDVKKKYTENSGWDWFLKTSVVWILVILFFAFLAYRYVSTMLPGD
FT                   TQGTFTDILLKITVLVIVIGLFLNFFILQNYYIAISRIIGILDENNSSPVDDYYTTQNP
FT                   AGHIFQTFDQFYKEYDTYKSKVEQQKDILFENFLIRLLKGHIQNEAIYYQLMEEYDFDI
FT                   RSHEFVLVLFDVVSDENQIEDEKLNYIYAFIRENFSSYMKRIYQCYGTEIDGRIACFIL
FT                   SDVASLDTTVSSIEIERMVKLMRDNIWHEFNYDLWVCVSGVHRGIPGCKTAYFQTVETL
FT                   QKARLTGSDTHILFYTDYMAGQPYKGNEQLWFKYEHHFINAINAGDYEEASKIFNKLLK
FT                   NDYITGASSLNLARFRLFGLLNSMINALGEVRLSLDVEFFDQLDAQRLLLECKSLPELE
FT                   AVSQEIFEKINQYSAGDLVSAADSKMQRVSAYLKSHYQDSNLNAVAVAEEFNMNPSYFS
FT                   RSFKKAMGTRFSDYLSRLRIQEACRLLRESDRTITDIAEQVGYNNALTLTRTFKKIEGT
FT                   TPGQYRQSNHI"
FT                   /protein_id="YP_003958531.1"
FT   gene            536262..538031
FT                   /db_xref="GeneID:9882453"
FT                   /locus_tag="ELI_0553"
FT   CDS_pept        536262..538031
FT                   /locus_tag="ELI_0553"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826175"
FT                   /db_xref="GeneID:9882453"
FT                   /translation="MKNDNLVGYKQNIIRCNLGFRYALICGTCWGMAYILITSVMKIHQ
FT                   SDSYSMTMLPTVLATATTFMVTAINLVWIGSQHKFKEFLRCLHSPSVISKVALAALAGG
FT                   IAAFCTYILALSDTVFSTIAVLFYPVLTAAIARKWYKEIISWQCALGILVILVCSSLIY
FT                   LPNLFAESSNSLMLSLFGIAAGIGWGVEAAIVGKLCETSDSDVCLGIRFCFESLLWLMV
FT                   CLFLLFTGSPILAAFKACFQSQSAWMILGIGIFLAVNYINWYRSIVFIGACRGPAVSNL
FT                   SGFILLVLSMVFFMDTPDWYTILAASGSLIGVVIVYMDCANSDGLPLLRQKNTVSSLVE
FT                   REKNVKRPPAKIAILEHLEDAQKLWDYEIADYIEAYEKNYTTEYRELVREWTVEMRAMG
FT                   LIEIVQETVDNGEHFQRGKRLCQYRLGGFYFLFKGFSESFLVGLEPFQTGHKVLGVEKV
FT                   LVGVQGGVVNTGRAAPAQIVEGPLYGYLVEILFLNGCQRLNAAGFMEFFVVSFYEQGRS
FT                   AQVNDAIGIREPGGEAVVDGQTQLEQTGVDFCHIIVKAAADLAVVQVFKVAGVEVAVAD
FT                   VGNHGIIIGVWNH"
FT                   /protein_id="YP_003958532.1"
FT   gene            complement(537552..538820)
FT                   /db_xref="GeneID:9882454"
FT                   /locus_tag="ELI_0554"
FT   CDS_pept        complement(537552..538820)
FT                   /locus_tag="ELI_0554"
FT                   /gene_family="HOG000162567" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826176"
FT                   /db_xref="GeneID:9882454"
FT                   /translation="MVDGKFIEMQTEIMKNYPPANAQALLNIFNAASGMQEYLDDVLAK
FT                   TRESYLYTQLRDLVENYYDIGTLLDVYQIFGGYINTSFGIYTEKNGEKQTWFVRKYKNG
FT                   KELESLLFEHSMLKYARENGFSYGAVPIPAKDGKTYHEVTETTTEGETKSYFAVFNFVG
FT                   GKAHYDWIPNWANAGVADLTVTSAAKSLAEFHNSTRGFDPEGRHGDNIMDNEDITVNEI
FT                   IRKFPKTLKEYRKSYAEAGFENVYTEYYDANYDYFAKMCERSVIPDADYNTMVSNVCHC
FT                   DFHPGNFKYLDNGEVCGSFDYDMAKIDSRLFELGLAIHYCFSSWLSDTNGIINLGRASL
FT                   FVKTYDEELHKAGGIEPLTAIEKKYLYEVTIQGALYDLGWCSSACVYDSTLDPYEYLFY
FT                   TQHFVACLKWLEANEEAFRKAFK"
FT                   /protein_id="YP_003958533.1"
FT   gene            complement(538881..538997)
FT                   /db_xref="GeneID:9882455"
FT                   /locus_tag="ELI_0555"
FT   CDS_pept        complement(538881..538997)
FT                   /locus_tag="ELI_0555"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826177"
FT                   /db_xref="GeneID:9882455"
FT                   /translation="MLAENLQKFPLKSNFDILHWRIVISKTADFDFKKTVLS"
FT                   /protein_id="YP_003958534.1"
FT   gene            538958..539131
FT                   /db_xref="GeneID:9882456"
FT                   /locus_tag="ELI_0556"
FT   CDS_pept        538958..539131
FT                   /locus_tag="ELI_0556"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826178"
FT                   /db_xref="GeneID:9882456"
FT                   /translation="MISMEIFEGFQPAHHLFLISDHKKLKEASKFDFGEICMQMSEPAR
FT                   CQRGGKQAMIEP"
FT                   /protein_id="YP_003958535.1"
FT   gene            539065..539199
FT                   /db_xref="GeneID:9882457"
FT                   /locus_tag="ELI_0557"
FT   CDS_pept        539065..539199
FT                   /locus_tag="ELI_0557"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826179"
FT                   /db_xref="GeneID:9882457"
FT                   /translation="MHADVRTCALSAGGKTGYDRAMKRTGRSEKQKFRRSNKHDEFKN"
FT                   /protein_id="YP_003958536.1"
FT   gene            539180..540607
FT                   /db_xref="GeneID:9882458"
FT                   /locus_tag="ELI_0558"
FT   CDS_pept        539180..540607
FT                   /locus_tag="ELI_0558"
FT                   /gene_family="HOG000250777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trimethylamine methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826180"
FT                   /db_xref="GeneID:9882458"
FT                   /translation="MMNSKIEVLSPEAMDRVHEASMEILAKKGVIFESEKARDLLKKAG
FT                   CKVEGEIVFFPRALVEASVKQCPSTFKLQAMDDAKSVNCGAQLSVHPAGGEVFVSDLKQ
FT                   GRRAPLLKDFANMQKVYHACENIPIAGYQPMSPSDVPQRYKGMYMTYESFKHCDKPLLA
FT                   PMELDSIAEKEENLRLYEVAFGKEGFCQDHYVTWHAVCPNSPLYYSEFACEGIEVYAAW
FT                   NQPVSIVSAPMSGITSPVFLYSTVALQNAEQLAGLVYAQLIKPGVPVILSASLTYGNLK
FT                   YASWECAAPDTALMLIAATQMYKDYYHLPARAQTGVTSSKAIDYQAGMETMQSFILTAL
FT                   AGVTLTSQSVGTLENLMCTSFEKTVLDDELIGRVQHILKGMETTEETLALDEIYEADFR
FT                   GDFMTNDSTLDYCHDDWQPTVSDWESYEQWEKNGSPDLIEQASKRVQKILDEAPEMVVD
FT                   PAVEAEMKKYMKMVEAR"
FT                   /protein_id="YP_003958537.1"
FT   gene            540633..541637
FT                   /db_xref="GeneID:9882459"
FT                   /locus_tag="ELI_0559"
FT   CDS_pept        540633..541637
FT                   /locus_tag="ELI_0559"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative choline transport or trimethylamine
FT                   permease"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826181"
FT                   /db_xref="GeneID:9882459"
FT                   /translation="MSANKKKGILFGVASGLSWGFYTVLLYNVLNLYAGSTGTVDNFQG
FT                   WILIITTALVIGLCDSVFGLIFECCYLIKIGEFKDYLKILFSKSSFGIIPAALFSGLLG
FT                   AIPYSIASSYSTSVAGTISAAFPAIGAIVAAIWFKEKLTKLKFFGIILCIVGTGVMYGL
FT                   SGAGVPIFVYGIAFICAVGYAMEGCFGYNMMRGDVSSTVSTTLRRTFLLLLYLILIIII
FT                   SIATNNFGYVLSLVQSFDMNMAIPAFAGLGGVKIAVWIILFIGSCLGGVSYITWYYSME
FT                   YSGVATAQVLNITYGIWIVIILMFPPFLEMPGLGTILGALVLFGGAALVSKES"
FT                   /protein_id="YP_003958538.1"
FT   gene            541664..542458
FT                   /db_xref="GeneID:9882460"
FT                   /locus_tag="ELI_0560"
FT   CDS_pept        541664..542458
FT                   /locus_tag="ELI_0560"
FT                   /gene_family="HOG000015344" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="B12 binding domain./Pterin binding enzyme"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826182"
FT                   /db_xref="GeneID:9882460"
FT                   /translation="MIIIGEKINGSIPAVGEAIKNRDGEEIRHRARIQSEANATFIDCC
FT                   ASVAEEKEGETLKWMIDLIQETTDVPVCVDSPSPRACIEGMKYCKKPGLINSVSMEGDK
FT                   IDMIFPVIANTEWECVALLCDDRGIPDTTLRRMEVFHNIMDRAEAYNIAPSRLHIDPLV
FT                   VTLSTSEDALTMFAQCCRQIKAEYPEIHITSGLSNISFGLPGRKYVNQSFMVLAMEAGM
FT                   DSAIVDPTNRDMMAMIYAADALLENDEYCLEYIDAFREGVIG"
FT                   /protein_id="YP_003958539.1"
FT   gene            542510..543148
FT                   /db_xref="GeneID:9882461"
FT                   /locus_tag="ELI_0561"
FT   CDS_pept        542510..543148
FT                   /locus_tag="ELI_0561"
FT                   /gene_family="HOG000223258" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Predicted cobalamin binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826183"
FT                   /db_xref="GeneID:9882461"
FT                   /translation="MNENIQKVSEAIAKGKRKLIQGIVQEALDAGCDPMEILNTGMIGA
FT                   MDAIGERFKTGEVYVPEMLVAAKAMKLGVEVLKPHLASGDAASGGKVLICTVHGDLHDI
FT                   GKNLVSMMIESAGFEVTDLGVDVPKDKIIKTLQDNPDIELVALSALLTTTMPSLEETVA
FT                   AIREEDSVSHVKILIGGAPITADFGEAIGADAYASDAASAVTSVKELIA"
FT                   /protein_id="YP_003958540.1"
FT   gene            543218..544261
FT                   /db_xref="GeneID:9882462"
FT                   /locus_tag="ELI_0562"
FT   CDS_pept        543218..544261
FT                   /locus_tag="ELI_0562"
FT                   /gene_family="HOG000082967" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826184"
FT                   /db_xref="GeneID:9882462"
FT                   /translation="MLSFYVREMYNKSRGRKANDKNRGAIILENNESIKKTIFFKKKSN
FT                   TILTAILCTFLWGSAFPVLKIGYQWFQIPSGDIWSKMVFAGLRFFLAGFVVLALNRLFN
FT                   RGDRVRWHPEYGRWIVALALLGTTVQYFFFYIGVGNTTGVKGSIAATAGTFLVVLLAPL
FT                   FFKRDRLNRNKVLGMVLGFTGILLTAVNGGTEGLNFDFTLTGEGFLLIAGLGDAGGVLV
FT                   AKYLSDKINPFHFSFYQMVLGALVLLALGVGFGMAGGGLHLIFTLKGVLLLIYAAIISG
FT                   VAFSLWNVLLRYNEASAITAFKFLIPVFGSLLSILLLPGESFTGFILLGLLAASLGIYL
FT                   VNRKVGR"
FT                   /protein_id="YP_003958541.1"
FT   gene            544357..544662
FT                   /db_xref="GeneID:9882463"
FT                   /locus_tag="ELI_0563"
FT   CDS_pept        544357..544662
FT                   /locus_tag="ELI_0563"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826185"
FT                   /db_xref="GeneID:9882463"
FT                   /translation="MTIRSEKKRALTLLLAAFFVVFFFLSTAFMTEEAHHDCVGDGCPI
FT                   CMQMSALQNFFKQLDTGSALVAALLVLRLIFRCMTFKWDSFFLVTSPVRLKVRMNN"
FT                   /protein_id="YP_003958542.1"
FT   gene            complement(544639..544761)
FT                   /db_xref="GeneID:9882464"
FT                   /locus_tag="ELI_0564"
FT   CDS_pept        complement(544639..544761)
FT                   /locus_tag="ELI_0564"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826186"
FT                   /db_xref="GeneID:9882464"
FT                   /translation="MFYHKKTSIFSDFEYKETRIRCFYKQSYSLEVFSVVHPYL"
FT                   /protein_id="YP_003958543.1"
FT   gene            544750..545736
FT                   /db_xref="GeneID:9882465"
FT                   /locus_tag="ELI_0565"
FT   CDS_pept        544750..545736
FT                   /locus_tag="ELI_0565"
FT                   /gene_family="HOG000180308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic solute binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826187"
FT                   /db_xref="GeneID:9882465"
FT                   /translation="MIKQRLAWFLTIILLVGMLMLGAAGCQKTSEKTDGNDVIKVVATN
FT                   FPPYDFARQVGGDKVEVTMLVPPGAESHSYEPTPQDIIKIQNCDVFIYGGGDSDAWIDS
FT                   ILDSIDAPSMKKIAMMDCVQPVVEETVAGMEDEHGHDQDSSEAEPAEAPEYDEHVWLDP
FT                   QNAVKIVEKIDSTLDEIDPDNKQTFDQNTKIYTGKLNTLDGRFKDMAAGAVRKTIVVGD
FT                   RFPFRYLTDAYGLSYYAAFPGCSTETEPSAATVAFLIDEVKKESIPVVFHTELSNERMA
FT                   DSIAESTGAVKRQLNACHNVTQQDFDSGKTYLDYMNENVDVLREALY"
FT                   /protein_id="YP_003958544.1"
FT   gene            545738..546448
FT                   /db_xref="GeneID:9882466"
FT                   /locus_tag="ELI_0566"
FT   CDS_pept        545738..546448
FT                   /locus_tag="ELI_0566"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826188"
FT                   /db_xref="GeneID:9882466"
FT                   /translation="MALFTCKDVAFAYDGVTAVEGLNFEINAGDYLGIVGENGAGKSTL
FT                   IAGLLGLKSPGSGQIIMGEGLRKNEIGYLPQKSPIQRDFPASVYEVVLSGRLNRQGFRP
FT                   FYRKADKKAVEINLKRLGIEELRKRCFRELSGGQQQRVLLARALCATNKILLLDEPAAG
FT                   LDPVATRRLYELVKAVNKKLGISVVMVSHDIESVVRYNSHVLHLGGRQLFYGTVEDYRQ
FT                   SPVGRHFLGGGEHA"
FT                   /protein_id="YP_003958545.1"
FT   gene            546441..547268
FT                   /db_xref="GeneID:9882467"
FT                   /locus_tag="ELI_0567"
FT   CDS_pept        546441..547268
FT                   /locus_tag="ELI_0567"
FT                   /gene_family="HOG000181429" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC-3 protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826189"
FT                   /db_xref="GeneID:9882467"
FT                   /translation="MLDLIREMLSYPFLVRSMVVGILVSLCAALLGVSLVLKRYSMIGD
FT                   GLSHVGFAALAIAMAFNLAPLSVAIPVVVVSAFFLLRISENSKIKGDAAIALLSTSALA
FT                   VGVVVISLTTGMNTDVCNYLFGSILAMSVSDVRLSIILSVVVLVLFVVFYNKIFAITFD
FT                   ENFARATGVKTELYNMLVAILTAVTIVLGMRMMGTLLITSLIIFPALYSMRLCKTFRSV
FT                   LICASVMSLVCFLIGMGFSYVRATPTGASIVIVHIVVFGFFCLIDFVKGKVIR"
FT                   /protein_id="YP_003958546.1"
FT   gene            547265..547768
FT                   /db_xref="GeneID:9882468"
FT                   /locus_tag="ELI_0568"
FT   CDS_pept        547265..547768
FT                   /locus_tag="ELI_0568"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826190"
FT                   /db_xref="GeneID:9882468"
FT                   /translation="MKRKILTVLLLAAVLLFSGCSAQDGGSGASPPASAQSSGISAKGA
FT                   QEIPVDVDITEKMFVAQINDIYLNHQNYLGKTIRLEGMFKSTANLSTGDSYRFVYRNGP
FT                   GCCGTDTMPGFEVKGDGNYPEDNAWVRATGVLEEYEEDGRPYFQLRLKELVVLDKRGQE
FT                   TVSQ"
FT                   /protein_id="YP_003958547.1"
FT   gene            548028..548582
FT                   /db_xref="GeneID:9882469"
FT                   /locus_tag="ELI_0569"
FT   CDS_pept        548028..548582
FT                   /locus_tag="ELI_0569"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826191"
FT                   /db_xref="GeneID:9882469"
FT                   /translation="MNKLERILLFIVSLLGLATAFVMFALLFPVPYVSDTLAAYLVFEN
FT                   WLGYYLIGFSVVLMIAFLVLFFISILAPASSHYLTINKAKGKIKISKEAIESTARYAVS
FT                   DLIGNNAIDVKAKLNKRSHEPKIQADVYVDDADDITGLANNIQQNIYQTVGSTINQPVK
FT                   SVKVKVHEMDARSKGAHRQVL"
FT                   /protein_id="YP_003958548.1"
FT   gene            548598..548906
FT                   /db_xref="GeneID:9882470"
FT                   /locus_tag="ELI_0570"
FT   CDS_pept        548598..548906
FT                   /locus_tag="ELI_0570"
FT                   /gene_family="HOG000280191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826192"
FT                   /db_xref="GeneID:9882470"
FT                   /translation="MNNQTQNQMQGSMNVRQQASPQAVEKQPKESRFSRFYTWAKPYSG
FT                   RIIWILAGIITAVLFLTIGFWRTILIVILALIGYAIGVYKDNPMRFMRWLNILKRFS"
FT                   /protein_id="YP_003958549.1"
FT   gene            548994..549509
FT                   /db_xref="GeneID:9882471"
FT                   /locus_tag="ELI_0571"
FT   CDS_pept        548994..549509
FT                   /locus_tag="ELI_0571"
FT                   /gene_family="HOG000280086" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826193"
FT                   /db_xref="GeneID:9882471"
FT                   /translation="MAAEATMHTMNNNQQKGGNAQQQNMQQKTSLTYDDKVVKKIAGLV
FT                   AQEVPGILAMSGGLISNITEKITDNENITKGIGAEVGKKQVALDLDVICEYNRNIPQIF
FT                   KDTIDKVTKTVKDMTGLDVIEINMHVDDVMTKKEYEEQQNNNNNNSRVDNDNNNGGFMG
FT                   MGGNSRVQ"
FT                   /protein_id="YP_003958550.1"
FT   gene            complement(549536..551365)
FT                   /db_xref="GeneID:9882472"
FT                   /locus_tag="ELI_0572"
FT   CDS_pept        complement(549536..551365)
FT                   /locus_tag="ELI_0572"
FT                   /gene_family="HOG000122844" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826194"
FT                   /db_xref="GeneID:9882472"
FT                   /translation="MRKQRNTYIFILICIFVMGFLLFSLIQMQGYANIINDAGIVRGGT
FT                   QRCAKLELSGEPNDELITYLDGLIRKLEASENKHLYTSHDSAAYHDNLEAVKTKWDEIK
FT                   AEIPALRLSSAIELREYFLSLSEEHFELANRMVYAAQYRAENELRNSIILSVVMILAVS
FT                   LIMYTLERRSQQELERVFYTDHLTALPNQAAFEISAAEKLRSAAPGAYLMIYLDLNNFK
FT                   FVNDSYGYNAGDKLLLSFSATLKRFCNSNEICAHLHADHFAILLKKREHVIEDLQTAVL
FT                   ASIESERELNLSDILTCSYGVYTIPDPDASIASCISKASVALKEGRSSQRTIAYYDQHL
FT                   LDKITNENKMTRWMHQGLSEKEFQIYLQPKVNLERSEVTGAEILVRWNSEPFGFLPPDE
FT                   FIPLFEKNGFIVDLDFYVLEATCQILKQSLKISPERTVVLSVNVSRVTLFQNDFIKRFV
FT                   QMAERYGVPPKYLEIEITENVFIFDANTVEQILSQLRSYGFSISMDDFGSGYSSLNLLR
FT                   ELPIDVLKIDRIFLQESIRVEKAYAIIKSVVEMAHSLNMVVVCEGVETLEHAEFLKTIH
FT                   CTVGQGYYFSKPIPLSAFQEKYSLLPTQKHPDS"
FT                   /protein_id="YP_003958551.1"
FT   gene            551354..551497
FT                   /db_xref="GeneID:9882473"
FT                   /locus_tag="ELI_0573"
FT   CDS_pept        551354..551497
FT                   /locus_tag="ELI_0573"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826195"
FT                   /db_xref="GeneID:9882473"
FT                   /translation="MFAHKLQHFRNRDEKRIHPFASVDYEHNTILRYIKIIIPHAVIHF
FT                   KN"
FT                   /protein_id="YP_003958552.1"
FT   gene            complement(551510..554428)
FT                   /db_xref="GeneID:9882474"
FT                   /locus_tag="ELI_0574"
FT   CDS_pept        complement(551510..554428)
FT                   /locus_tag="ELI_0574"
FT                   /gene_family="HOG000088535" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826196"
FT                   /db_xref="GeneID:9882474"
FT                   /translation="MKKSAVEYRYLFISALAVICLCGLFLCIPAYAKEDTSTVRVGYYE
FT                   DGDYMYLNAAGECIGYDFEFLQEISKFSDLRYDVVDCTSWDNTYQLLTEGQIDILPAVY
FT                   KNAEREQECLFSEQPMCNIYTTLNVRVDDTRYSYEDFSAFQGMKVGIIKDSVDGENFKS
FT                   YCAENNIALTVLPYSETQDLLNALDDGTLDGVAITHLGRNSTFRSVAQFAPAPLYIAIS
FT                   KSRPDVAEAVNSAMSTILLRDPNYTMNLYNKYFSVTNAQKPVFTKSELEYIASKKTVSA
FT                   VYDYMAPPFSYTSPDNGGFAGIAADLFSQIAENSGLRFQFSPEVYSLGLEKVKNGRADV
FT                   ICSVAGDYLWESRNNLSTTRYYLRSPTVLIRKNTSAPLARIAMSQDYGAAEAIISDYPD
FT                   ADVYYYSNTEACLDALTENKVNAVFANSQVADYLLSDASYTVLSSTPLSNYTIELSIGV
FT                   SNSADPRLFSILDKCIQYTSEENIDAIVMENSIQPKAMTVREFLTENAVTVIAITVAFL
FT                   GLIILLLVYNLRSKSKSNQQIQNLLYRDTLTGLDNLDKFLAECGSLLKSAPEGGYALIY
FT                   SDINQFKTINDRYGFTAGDQLLRAYAQIIQESVQEGEYCARVSSDNFVLLLKYRDWETL
FT                   CTRMTDIQKATDSWIQRTGFPAPVLTAFGVYLVDKAEKQDVQLMLDLANYARRSAKNTS
FT                   KSAIVLYDRQMRQNTLLRKELTDRLSAALSAHEFVPYFQPKVNMITGEIIGSEALVRWN
FT                   HPDRGLLAPGAFIPVFEENGSIEEIDWYIYEAVCYTLRSWMDRGLPVYPVSCNFSSIHF
FT                   DHSNFTDRITALADLYAIPHRLLELEITESIIVTHPKRVASQIASLREKGFMTAIDDFG
FT                   SGYSSLGQLEQMAARVLKLDRSFVQRGMLDSREQTVIANIVNLAHDLGMRILCEGVETR
FT                   QQANILIRLDCIYAQGFYYSKPVPLEEFEEMLLKPPFESINL"
FT                   /protein_id="YP_003958553.1"
FT   gene            complement(554549..555451)
FT                   /db_xref="GeneID:9882475"
FT                   /locus_tag="ELI_0575"
FT   CDS_pept        complement(554549..555451)
FT                   /locus_tag="ELI_0575"
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826197"
FT                   /db_xref="GeneID:9882475"
FT                   /translation="MTPISLTPEQQKSLRDYQSAMANTRTPVENPTVAYFGTLGSYTEQ
FT                   AAIGFFGEDCCRVSHRLSEDVFKSITSQGADYGVLPIENSTTGSIAAVYDLLAKYNCYI
FT                   VGETKVKIEHCLLGVPGSRLSDIREVYSHAQGFEQSGEFLAAYPDWKCLTYYNTAVAAE
FT                   HVAKSANPAFAAIASRRAAAIHGLSILAEDINLSETNVTRFVIVASRMELCPDCNKISI
FT                   AFHLPHVAGSLFQALSVFDANALNLCKIESRPIRDHNWEYLFFIDFIGNIDGTPLDTVM
FT                   EEVISKTEGFHFLGIYKDN"
FT                   /protein_id="YP_003958554.1"
FT   gene            complement(555465..556334)
FT                   /db_xref="GeneID:9882476"
FT                   /locus_tag="ELI_0576"
FT   CDS_pept        complement(555465..556334)
FT                   /locus_tag="ELI_0576"
FT                   /gene_family="HOG000023020" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826198"
FT                   /db_xref="GeneID:9882476"
FT                   /translation="MTPFNDPEMEELMKIKEPYKKANRKYKAEDTIINIGDIHFGEGNF
FT                   HVFSGPCSVESKEQITEVANRVKAAGATVLRGGAFKPRTSPYAFQGMAADGIELMLEAK
FT                   RETGLPIVSEIMNIALLDLFADVDILQVGARNMQNFDLLKALGRSKKPILLKRGLANTI
FT                   EELLMSAEYIMAGGNDNIILCERGIRTFETATRNTLDISAVPVLKKLTHLPVIVDPSHG
FT                   CGKAELVEPMSLAALAAGVDGLIIEVHNDPANALCDGPQSLTPDQFDTLMRDKIRPMSE
FT                   LMGKKLGA"
FT                   /protein_id="YP_003958555.1"
FT   gene            556335..556592
FT                   /db_xref="GeneID:9882477"
FT                   /locus_tag="ELI_0577"
FT   CDS_pept        556335..556592
FT                   /locus_tag="ELI_0577"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826199"
FT                   /db_xref="GeneID:9882477"
FT                   /translation="MFFLVSFIFVWWLKIEKGSASVTRDRPLIDHIIVQSDQAVRSWQL
FT                   NFGHQKKLKLKKLKLLKKVFIFLTLFKDVKIAMRLLLFTN"
FT                   /protein_id="YP_003958556.1"
FT   gene            complement(556650..557285)
FT                   /db_xref="GeneID:9882478"
FT                   /locus_tag="ELI_0578"
FT   CDS_pept        complement(556650..557285)
FT                   /locus_tag="ELI_0578"
FT                   /gene_family="HOG000010397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826200"
FT                   /db_xref="GeneID:9882478"
FT                   /translation="MSFRTDHYAALAKTLIAKMEKRHFEAHYCATKKEALVLALTLIPD
FT                   GASVTHGGCMTIEEIGLVDAVKQGVYNYIDRSIATTPDEKREAIAKGMMAHTFLMSANA
FT                   ISRDGELVNIDGFGNRIALLAYGPDQVIVLAGMNKVAGSLESAIDRARNEAAPINCVRL
FT                   NRQTPCLSTGVCGDCHSADCICSNIVITRNNPIPGRIKIILIGEACGY"
FT                   /protein_id="YP_003958557.1"
FT   gene            557522..558268
FT                   /db_xref="GeneID:9882479"
FT                   /locus_tag="ELI_0579"
FT   CDS_pept        557522..558268
FT                   /locus_tag="ELI_0579"
FT                   /gene_family="HOG000248344" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoglycolate phosphatase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826201"
FT                   /db_xref="GeneID:9882479"
FT                   /translation="MTTAKELFKPRYSGIIFDLDGTLINSLEDLVDACNQVMLHYGLEL
FT                   KSYQEGKKLIGRGLRNLIKRAVTPEMAKDEALVDEAVALMKDEYAKRYTHKTVAYDGIK
FT                   DLLRYLHVHKIPFAVCTNKPDGAAKTIVDALFDISEFVDVVGQNDNKPRKPDPTQTLEV
FT                   AAKMGVAPGDCIYMGDSSVDYETAKNAGMLPVLCTWGFTDPEKLMQYDDAIWIKNPLRA
FT                   IDALKYGDQMYEIFNEKKQDELKEEE"
FT                   /protein_id="YP_003958558.1"
FT   gene            558811..559707
FT                   /db_xref="GeneID:9882480"
FT                   /locus_tag="ELI_0580"
FT   CDS_pept        558811..559707
FT                   /locus_tag="ELI_0580"
FT                   /gene_family="HOG000166294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydrodipicolinate synthetase family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826202"
FT                   /db_xref="GeneID:9882480"
FT                   /translation="MADNVSFKGVMTELITPFTEDGQVDYPLLRGEVAYQLQNGIKALF
FT                   TNGIASESLSLTAEELVETTKTVVEAAGDRALVMGNIACQTLPEAMQVLRGYEAAGVDA
FT                   VCIQQPCVYSIPQEELVAYFDAIASATALPAGIYNAPQTGNTLSPASVAAIFKHNGNMQ
FT                   FYKESTIDFVHIQNTMRLIGPDRPMTFLNGSDATTFSVMQLGGAGVVSLISAVFPKAVL
FT                   KLVNAMEEGDIAGGRAAQNEILLIREALKTGPFVAGYKYAAGLMGVPLGYMRRPLAELS
FT                   EDEKEKIKTSLEKLRLV"
FT                   /protein_id="YP_003958559.1"
FT   gene            559741..560400
FT                   /db_xref="GeneID:9882481"
FT                   /locus_tag="ELI_0581"
FT   CDS_pept        559741..560400
FT                   /locus_tag="ELI_0581"
FT                   /gene_family="HOG000241645" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826203"
FT                   /db_xref="GeneID:9882481"
FT                   /translation="MDKKQLAGMMDHTLLKAVATPEQIAQICEEAREIGAASVCVNPCN
FT                   VRQAAELLKGSEVKVCTVIGFPLGANTPAVKAFETEDAIAGGAQEVDMVINVGALKAGD
FT                   QDTVYRDIKAVVDAADGTLVKVIIETCYLTDAEKTTACQMAAKAGADFVKTSTGFGTGG
FT                   ANPHDVALMKASIPDTMQVKASGGMHVWADAKANIEAGADRLGVSASLAILDSFDE"
FT                   /protein_id="YP_003958560.1"
FT   gene            560437..561240
FT                   /db_xref="GeneID:9882482"
FT                   /locus_tag="ELI_0582"
FT   CDS_pept        560437..561240
FT                   /locus_tag="ELI_0582"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826204"
FT                   /db_xref="GeneID:9882482"
FT                   /translation="MNHQKNTTSEKPVIAVTGGGQGIGRAILLYFTERGYNAAVLDMNL
FT                   ETAAAVAEECKARGADAIAVECNVTDSASVNAAYDQIGGYFGGRLDVQVNNAGVFRRER
FT                   VEDATDDVTDLLIDVNLRGPVYTSRAAIKIMKEQGHGSIINAHSILGQFPDFGLGVYSA
FT                   TKAGLFALTRVLAAECAPYGIRVNGYAPSVTDTPMVHHIIEERPEAKLDQIPMREFGTP
FT                   DQIAKICWFFASDLCEYTTGINVPCDGGTWDVQRPFMAWKAAGKL"
FT                   /protein_id="YP_003958561.1"
FT   gene            561281..562825
FT                   /db_xref="GeneID:9882483"
FT                   /locus_tag="ELI_0583"
FT   CDS_pept        561281..562825
FT                   /locus_tag="ELI_0583"
FT                   /gene_family="HOG000222135" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative erythritol kinase protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826205"
FT                   /db_xref="GeneID:9882483"
FT                   /translation="MKTGYIIGIDSGTSMVKAALFDMQGNEICVASRSTPVEEPHFGWS
FT                   EFDMDVDWKEVAGVISDLMGKCGVDKKEVLAIGLGGKGVGVCFLDKDNRPARKGILWND
FT                   ARCAGMTREWIESGKMEQIFGATANWLMTGDVGILLPWMKEHEPEVLERTAHFCLNTNW
FT                   MCYNLTGEFGSNATDFYSQIDETRTYSDKVMEIEGILDLKDKFLPLQEPWEICGHVTEQ
FT                   AARQTGLAAGTPVASIGWDVVCCSAGVGAVDDGQANIILGTSGVIMLTMPKFAHSPMLG
FT                   CQTIHNIPGKWQQLIAPLTGTPNSDWFVNNFTCADKLQAEKEGRSVYALFDEVIDKVNP
FT                   GCDGTIYHPYMNAAGERAPFTNTNARGNFFGLNLHSDRHVMQRAVYEGMAFANKHCLDA
FT                   YTYPVSDIRLSGGGSKSPVWCQIFADICNAPISLPGGTEFGAKGVAWNAALAAGYFGSW
FT                   QEASEAFCKVERVYEPIAKNVSIYADLYEVYKAIPYALFPAWEARTEFLKKHGFQG"
FT                   /protein_id="YP_003958562.1"
FT   gene            562908..563846
FT                   /db_xref="GeneID:9882484"
FT                   /locus_tag="ELI_0584"
FT   CDS_pept        562908..563846
FT                   /locus_tag="ELI_0584"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826206"
FT                   /db_xref="GeneID:9882484"
FT                   /translation="MHFLCLARCQLGFLLRQFELFKLPVEKQNEILRKEIDLVSRQSIH
FT                   IHAGVSGSQMFRLFCDALGDPDPLRAVRKKQNGQMLRLLPEIRRAVEQKDDPLLYALRA
FT                   AASGNIIDVSFADEFDVAGALEKSMEEPFAIDDYAPFRERLLAAGTLTLVTDNAGEIVL
FT                   DRLLLEVLGQWRRARGLAPLAVSVMVKGGPIYNDALEEDARMAGLDREGEILDTGTDCI
FT                   GLHPRYMSREALENLRKADMIILKGLANYESDFGGEDFPEKVFYLFRSKCEVLSDALGI
FT                   ALGSSVLMAHSREEEKENALHTDQSFKEINR"
FT                   /protein_id="YP_003958563.1"
FT   gene            563803..564144
FT                   /db_xref="GeneID:9882485"
FT                   /locus_tag="ELI_0585"
FT   CDS_pept        563803..564144
FT                   /locus_tag="ELI_0585"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826207"
FT                   /db_xref="GeneID:9882485"
FT                   /translation="MPYIQISLSKKLTDEEKRTLAAGVAALVPMLPGKPGDRAIVQIDD
FT                   GRSLYRGGEPAACAFMETRLYGKTPEPYLRAYTEKLFELFEEQLGYAGNQIYLNILELD
FT                   HWGSKGSLR"
FT                   /protein_id="YP_003958564.1"
FT   gene            complement(564192..565154)
FT                   /db_xref="GeneID:9882486"
FT                   /locus_tag="ELI_0586"
FT   CDS_pept        complement(564192..565154)
FT                   /locus_tag="ELI_0586"
FT                   /gene_family="HOG000243107" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DeoR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826208"
FT                   /db_xref="GeneID:9882486"
FT                   /translation="MNTDQRLLQAIAKLYYEEGRTQSEIATQFSISRPKVSRKLAEARE
FT                   RGIVKIFIDDAIDDISEMEQQLLTAFHLKGARVASVPEDDVELAIQLTARLGAQFLKAF
FT                   LNPGDHIGVNWGWTLFELSKEFPDFALPDCSLVQLSGAVDNANCRSFAHEIISNLSQKL
FT                   GAESAFCLPCPALVESPIILDILLHDAKVRSLLERVEACNKLFVNIATPDEDSCLYQAG
FT                   YLNDENIARLKDVGAVGSICSRFFDKNGNICDPELDKRTVGVSLDAIKNAECVLACIVG
FT                   RQKARAVYYALKAGWIDVLVTDSLTAERVIDLAKREGVL"
FT                   /protein_id="YP_003958565.1"
FT   gene            565607..565876
FT                   /db_xref="GeneID:9882487"
FT                   /locus_tag="ELI_0587"
FT   CDS_pept        565607..565876
FT                   /locus_tag="ELI_0587"
FT                   /gene_family="HOG000204879" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1021"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826209"
FT                   /db_xref="GeneID:9882487"
FT                   /translation="MQKQKATIMDVKREVENYRGKRVKLEAHKSKKKLYQKEGVIEGTY
FT                   PSIFTVSVKEDKRPTQRLSFSYSDVLTKSVKIALVDEVEGAFSY"
FT                   /protein_id="YP_003958566.1"
FT   gene            566065..567300
FT                   /db_xref="GeneID:9882488"
FT                   /locus_tag="ELI_0588"
FT   CDS_pept        566065..567300
FT                   /locus_tag="ELI_0588"
FT                   /gene_family="HOG000284535" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arginine deiminase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826210"
FT                   /db_xref="GeneID:9882488"
FT                   /translation="MEEKLLNIQSEIGKLNAVLLHRPGKELERIVPNVLKEVLFEDIPW
FT                   LRRMQEEHDAFAGVLTGRGIHVYYVEQLLTDILADAQVRENLVRDVIDQNPSSGNYIDG
FT                   FLQEYLLSMEDCKLAESLIAGVLQKELDHVERERVLSDYINESEPYAFYMNPLPNLYFM
FT                   RDPAVTIGDGMSISSMATEVRKRESLYMHYIYKNHPLFASCGGKTYYEYDKFFSVEGGD
FT                   ILILSPTVVAVGCSERTQVQGVEELAKRLFEDNPALEGVLAVKIPKDRAFMHLDTVFTM
FT                   VDYDKFTVYPGILDHVETVMIRRGSKGHMRYEHIDSLHDALRRALNLTSIKLIESGGGN
FT                   PVAAAREQWNDSTNTLAIAPGVIVAYGRNERSNEVLAENGIDVISIEASELVRGRGGPR
FT                   CMTMPLNRDPLK"
FT                   /protein_id="YP_003958567.1"
FT   gene            567497..568951
FT                   /db_xref="GeneID:9882489"
FT                   /locus_tag="ELI_0589"
FT   CDS_pept        567497..568951
FT                   /locus_tag="ELI_0589"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826211"
FT                   /db_xref="GeneID:9882489"
FT                   /translation="MKKTKILGILLCVLLAVSFTACAKTDSAQQGASSTGSVDGVLKSY
FT                   ASGTLVVTRNDGSELAFDLSKATVSCTNMLSGDKVTILYDGTIEGTDTSGVTVTEIKDK
FT                   GSAAPKEQTMVGTVRNLTQHSLTLKEPDGTEYSFNTAGARQAYKNGIENGNWVQVKYVG
FT                   EINGTDATGVRVLEIVDNDENIKKAQEPAKVEIKAADEKVWATDTVHVRESYTTDSNVL
FT                   GDLAPGNEITRTGVCENGWSRVNYNGKDAFVYSQYLTTTQPASPSSPAPAKPQPSPSQP
FT                   AQPSAQPTPKPTPVPTPAPAPTPEPTPAPTPEPTPAPTPEPTPEPTPEPTPEPTPEPEV
FT                   KTLTGYVVSYADGELVIFANGADYPLNVTDAQHSYVSGILTGNEVTVTYTGDLQAYESV
FT                   VVLSVSDSELNAGDRSVITGVIASASMNTLDLTTDDNTEIMFETMNAEVNSQNYQVGAR
FT                   VSVTLDLSQSVDTSNIFHALKVDDAQ"
FT                   /protein_id="YP_003958568.1"
FT   gene            569409..572066
FT                   /db_xref="GeneID:9882490"
FT                   /locus_tag="ELI_0590"
FT   CDS_pept        569409..572066
FT                   /locus_tag="ELI_0590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826212"
FT                   /db_xref="GeneID:9882490"
FT                   /translation="MEVKMSKKLRTRLASALSAVIIPVTLVCSSVPALAAGTAGSPVAD
FT                   TAAVESSEIADKAAEALENSLMLPEITRALEEMDGAPAAEAPAKEEAPAAQNKADEAPA
FT                   AGAPVCTVTTGAQSRQAGADVTYGTLEEAFASIKDGQTATITLTGDAVVEGTIVVHGSV
FT                   TLTANGDYTVSLSADTSSRSFFTLYDENQLTVDGAGHSITLTAPEGVDGIINVRMNSVL
FT                   SLKAGTTLENCSINAKNNAMLNITGAAVTGTSDGETPALVGVSDSAALKATGAALPIVG
FT                   ILDECAASFDGCEVYGIASLSPNVQVHGSSVDIIENYGSELLISDSSVDNLLNVMLAAQ
FT                   VTLAGKTDIAYIMLAKKPIILAEDFSSSVVSRVYAAYPLIFENPAVLAVAASGALSETA
FT                   ANSFCYFFEDGSDPQTYTPYLKDGRLETARVLETYVSVNIEHNSYPYTGRDPQAEGGLG
FT                   KVTITVKDEDDKVITPAEGKLTTTYTHYMDVLQTPPTQPGDYTLNVSYAGEEDRAAQTI
FT                   TCGSSGAVGFIITRAELKGDFANFPSEISVSQGSVRADFRPAEGIDAALLKLNYTWTLT
FT                   DKDGAATTVPGDTLELTKADIGKTAQVSVEDTSGFYYGEITSSSFTIGRVATGVRIDGL
FT                   SYDSGSNYFESNDALQALLAKDRAVIVTYLDPEGYKNIAYDKDEISLKYYSVDDGRLLD
FT                   RAPTEPGTYSLNVAFTPNDAHQAQDLQFTSVSYTYTLMMPTTTEINASALKGSYDVSDT
FT                   QSLDKDMIRATTVRDKDGRVIKLDQDSGLLSFEAYTDAEGKNIAQTPAAGSYYVRAFYN
FT                   RDGREKAHIASSSELVKITLTQKAGPDSGTTADTTTGTTPGNPATGTPYSAGLSLVLLA
FT                   ALAGGSALVLKKRG"
FT                   /protein_id="YP_003958569.1"
FT   gene            complement(572115..572534)
FT                   /db_xref="GeneID:9882491"
FT                   /locus_tag="ELI_0591"
FT   CDS_pept        complement(572115..572534)
FT                   /locus_tag="ELI_0591"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826213"
FT                   /db_xref="GeneID:9882491"
FT                   /translation="MMKGKTYLKVTGILLLIGGIIGVLCYGLLALLMGVAVVDQGAGSG
FT                   AVSVTLIVVIYLIAAIIQLVAGVMGIKGCNKSDKADGCFKIGIVVLIISILAAIVNMAG
FT                   AGFTFSGILYALLGLVVPGLYIYGAKLNRDSLPIT"
FT                   /protein_id="YP_003958570.1"
FT   gene            572760..573785
FT                   /db_xref="GeneID:9882492"
FT                   /locus_tag="ELI_0592"
FT   CDS_pept        572760..573785
FT                   /locus_tag="ELI_0592"
FT                   /gene_family="HOG000022686" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826214"
FT                   /db_xref="GeneID:9882492"
FT                   /translation="MGINLKGRSFLTLKDFTPEEINFMLDYAAALKKKKKEGRPGRLLA
FT                   GKNIVLLFEKTSTRTRCAFEVAGFDEGACVTFLTNSQMGKKESIEDTAKVLGRFYDGIE
FT                   FRGFKQETVEALAEFSGVPVWNGLTDTYHPTQILADMLTIQENFGELAGRRLVYVGDAR
FT                   NNMGNSLMIGCAKLGMHFVAVAPKVLFPEESLVAEMRAICEETGGSITLTDDIKTGVKG
FT                   ADAIYTDVWVSMGEEDQMAERIKLLAPYQVNAEMMEATGNPDVIFLHCLPSFHDLNTDV
FT                   AKDVHERFGLTEQEVTDEVFRSPASKVFDEAENRMHTIKAVMCATLATNQVDADGKPIV
FT                   D"
FT                   /protein_id="YP_003958571.1"
FT   gene            573966..575450
FT                   /db_xref="GeneID:9882493"
FT                   /locus_tag="ELI_0593"
FT   CDS_pept        573966..575450
FT                   /locus_tag="ELI_0593"
FT                   /gene_family="HOG000040008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Phosphoglucomutase/phosphomannomutase C
FT                   terminal:Phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain
FT                   I:Phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II:Phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826215"
FT                   /db_xref="GeneID:9882493"
FT                   /translation="MEIQNITKLQNGSDIRGIAMEGVEGESINLTQDMAMKIAYSFSKW
FT                   LKAKTGKDSLSVAVGRDSRLTGPNLAQAVCLGLVSDGDHVYDCGIATTPAMFMTTLDPE
FT                   MDCDGAVMITASHLPFNRNGIKLFTKDGGLNKEDIAEILEQAETIVTDFKIGGRREDYA
FT                   FIPRYAANIVAMIREATGEETPLKGARIIVDAGNGAGGFFADGVLAPLGADTRGSQFLD
FT                   PDGHFPNHIPNPEDPDAIDAICQAVIDSKADMGIIFDTDVDRSAVIDEKGDAINRNGFI
FT                   AFIASMLLEKYPGTTIVTDSVTSTGLTEYIEGLGGHHHRFKRGYKNVINEAVRLNEHGV
FT                   KTHLAMETSGHGAIRENYFLDDGAYLVTMALIKFAQLHREGKPLSVFLKDLKEPAEARE
FT                   YRFKITAEDFRAYGQEVLDGFRKFAEEQPGWTIVEPNFEGIRVDCGEDAGNGWCLMRMS
FT                   LHDPIIPLNIESDEVGGCEKIKAAIDVFLKDYAELQ"
FT                   /protein_id="YP_003958572.1"
FT   gene            complement(575652..577682)
FT                   /db_xref="GeneID:9882494"
FT                   /locus_tag="ELI_0594"
FT   CDS_pept        complement(575652..577682)
FT                   /locus_tag="ELI_0594"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sensory box sensor/GGDEF/EAL domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826216"
FT                   /db_xref="GeneID:9882494"
FT                   /translation="MAAKPPYTPNIITAAASELLSDGIACFQSDDALTPRYLNPSLMDF
FT                   LGVSALPGSLASYMEEEDLPAFKQFLNHLKPGETARTCQRLADSKGGLTWVCASCQLVS
FT                   GPDDTPAVILCQFADLQYLKRSQSASNADRVPCGVFKTLTDEDLTLLYANSFFYQTYGY
FT                   TRESAEAAGFTNCRRIVMPNEYPQLRQKIGHYIDTGVYAFELENHCVTIDRKAIWVLVR
FT                   CQYNPQEDTLFGAVFDITDRKAAEEALRISEEENRIALRHSDKFIGRYDLRTRTLTRTG
FT                   EAARLLGLPESTRDVPDGAIESGIVAQESAADYARFFKDILDGRPEGHTSVKLRTTTKN
FT                   AYSWFNADYSLVYDTDGSPITAILTYFDSTDLHEREVAYERWARTYEQKRENCIAYYEF
FT                   NLTADVLEKYEGQTKGDIPTGYTHSLLSLAQFTADLYTVPEDRKKFVRFFNRDHLLEKH
FT                   RAGNDELSLDYRRYNRAGGVFWARADAQMVDDPFVGVVRLFVLIQDVDSEKRRSLELRR
FT                   LSQTDPLTGLYNRATLVKRLGRVLRRGTAASHALIILDIDHFKELNDTYGHQFGDTVLI
FT                   EVAAALKDCLRSNDFSGRLGGDEFMIFMRGLSDTAIIRERLNVLRDRLYNLDLTNTPLT
FT                   ISIGIAFFPAHGKSFQELYDRADTALYEAKRQGRDQIVFYE"
FT                   /protein_id="YP_003958573.1"
FT   gene            577648..577770
FT                   /db_xref="GeneID:9882495"
FT                   /locus_tag="ELI_0595"
FT   CDS_pept        577648..577770
FT                   /locus_tag="ELI_0595"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826217"
FT                   /db_xref="GeneID:9882495"
FT                   /translation="MILGVYGGFAAMSDSPLKLIILSILSFFPIKNNTVRYTKK"
FT                   /protein_id="YP_003958574.1"
FT   gene            complement(577794..580181)
FT                   /db_xref="GeneID:9882496"
FT                   /locus_tag="ELI_0596"
FT   CDS_pept        complement(577794..580181)
FT                   /locus_tag="ELI_0596"
FT                   /gene_family="HOG000291804" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826218"
FT                   /db_xref="GeneID:9882496"
FT                   /translation="MEYDPKEKNRIAGYEYNTLMSLMHVSVSKHLLDEHFTLVWANEFY
FT                   YELIGWDKDEYEARYNNLCDTYYADDQEELAKLTEVVMDAIEGSKGGYTHISHMPKKDG
FT                   EYVWVRMVATFADEYIDGYQVSYTVMTDINDLVLMQKAQTVTYNALPGFVAKFHIDKDF
FT                   GLTLLEANARYTAFFGDDCWDTGADPLFLQNYAQNQQAIEASREKILSGQPISLGLTVK
FT                   GVDGREARLQVNASCVDWQNQEPIYLAIFIDITDVTELREMQQKLEAQAAELKEALTAA
FT                   EQASRAKSDFLSSMSHDIRTPMNAIVGMTEIARIHLDDPGRVENCLDKIALSSQHLLGL
FT                   INDVLDMSAIESGSMALSNSAFSLPDFMENIVAIIQPAAAEKRQHLFIRTFGVEHEHLY
FT                   ADPLRLKQIFINILSNAVKFTPEEGSITLTLEEFPAAREGCGQFRFTFADTGMGMTDAF
FT                   MTHIFDSFTRERDSRVDKTEGSGLGMAITKRIVDMMGGRITVRSAEGKGSTFVVYLSLH
FT                   IEENPACYPALPPLRVLIADDDELMCEYAAQTLDALGIDAECAEDGEDTVRQIISAHDA
FT                   GQSFDVLILDWKMPGVDGLEVTRQIRARIGEELPILIASSYDWADIKKEALSAGANDFI
FT                   SKPLFKSTLCHTLKRLIYAENSPIADKEKKPQYNFGGRRFLLVEDNALNQEIGVELLSQ
FT                   AGAIVECADDGIQGCEKFAQSPPGYYSLILMDVQMPVMNGYEATQKIRALPRADARAVP
FT                   IIAMTADAFAADIEKARESGMDGHLAKPLDLPLMLQELSKLL"
FT                   /protein_id="YP_003958575.1"
FT   gene            complement(580165..581406)
FT                   /db_xref="GeneID:9882497"
FT                   /locus_tag="ELI_0597"
FT   CDS_pept        complement(580165..581406)
FT                   /locus_tag="ELI_0597"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826219"
FT                   /db_xref="GeneID:9882497"
FT                   /translation="MTGLNPAPLVIISAIYFYQNWFFFLYAASILQRPVKKRWIVLAFF
FT                   INYALFVVCSILQLHLVINWLLVFTLQFIEIRCFFRCRLSDSFILALFSMIIGLSLNIL
FT                   FRCVLAAAFDLPLVSFSNNIRESTNLKQYPVGLGFLAAGLYFQIARHFDAHMDNPRVIF
FT                   QDPARKRFLIQLCLAIYLYLVLNLLIYSVPGNILVLKLWGVKSCVFSLIGVYLAIRYAA
FT                   RISRLSQYRVLNREVREALKRKKKEELELSRIASTDPLTRCPNRQRAETVITRWLEAGK
FT                   SFCLCFVDLNGLKRVNDTQGHELGDLYLLTVVQTLWGACRQDADALFRYGGDEFVLLFP
FT                   DLPPAIIGSRMDRVNRSLRARSHMPGHPFDMSISYGLAQSGEYESADMLIKAADKRMYI
FT                   DKENTERNRHGIRP"
FT                   /protein_id="YP_003958576.1"
FT   gene            complement(581403..582620)
FT                   /db_xref="GeneID:9882498"
FT                   /locus_tag="ELI_0598"
FT   CDS_pept        complement(581403..582620)
FT                   /locus_tag="ELI_0598"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative signaling protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826220"
FT                   /db_xref="GeneID:9882498"
FT                   /translation="MTEIPNALMLLLILLLSGLYAHASWGLLSALKQDAIPLHYWWPVL
FT                   GLCLCALFLIMAVFNLPLPLFFLLLYGLKICELLHFPDTDRQNWAAVNESFLYTCAACL
FT                   VLIGLLSFALGMNVQALLANPLLRTTCLAALLLCNLITELFLSRHAEALAVFKDIYGSE
FT                   ESRLFIQFTFLGVVFVLADAGACLFDLPTTVVSLFLVGSNALLLMMVGFFMNQISIINQ
FT                   ENYLEHEHTLLTSTMQQQTARTEALKDTAYRDPLTGAYTRLYIFDYLALFLSRGEAFAL
FT                   AYIDLDGLKAINDSFGHLAGDQYLKAFSSRFSENLNREDVFARIGGDEFMVLFPGITAG
FT                   AARARLLTIRRRLEAARCENWSLSFSFGVSEAPTGTSKPREALIREADLSMYEDKSARR
FT                   KKEVQA"
FT                   /protein_id="YP_003958577.1"
FT   gene            complement(582666..584435)
FT                   /db_xref="GeneID:9882499"
FT                   /locus_tag="ELI_0599"
FT   CDS_pept        complement(582666..584435)
FT                   /locus_tag="ELI_0599"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826221"
FT                   /db_xref="GeneID:9882499"
FT                   /translation="MSENEQILRHYDIAPDSEYNMLMSVLRVSVSRHLMDEHFTVVEAN
FT                   PYYYEIIGYPKEEYETLYHNKCDLYFKNNPEDWASIVRAVEKAVDAGQTSYETLARMIH
FT                   KSGRPMWIKLVSVFTDETINGYPVAYTVMTDMTDYIEQEQALQRSNAKLLELAFVDPLT
FT                   RGPNRTKFDMDAGGAILESAPGDYVLVSADIRKFKLINDLFGIEMGDRTLRYVYEVLKQ
FT                   NLEEGEFLCRTAADNFCLLLHNTDKRKIINRLSVMAHDINRFNEDQERKYFLSLAFGIY
FT                   PVLDPNLPLTQQLDRANVALKNVKDTNDSRLFAFQFYSDLDRLKLMREKDMENRMQDAL
FT                   NAGEFVVYLQPKLSLKDDTISGAEALVRWQDPERGLIPPDEFIPFFEKNRFIVEVDLYV
FT                   FDQVCSLLRRWLDEGITPVPISVNMSRAHLAKTDFLDAYEAIRKAYGVPPELLEIELTE
FT                   TLVFTNPEALFQVIDQIHRRGYRCSMDDFGSGYSSLNLLKDLRMDTLKLDRAFFTSQNA
FT                   DNPRERDVVTSVIDLAEKLSMSTVAEGVETPAQTAFLKEARCDMVQGYVFSRPVPIPDF
FT                   EALAFGAADSEKA"
FT                   /protein_id="YP_003958578.1"
FT   gene            584624..585400
FT                   /db_xref="GeneID:9882500"
FT                   /locus_tag="ELI_0600"
FT   CDS_pept        584624..585400
FT                   /locus_tag="ELI_0600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826222"
FT                   /db_xref="GeneID:9882500"
FT                   /translation="MSQYHQTVIVEAGEGINDAMPKVKGRANRWRLHGYWLAHGAMPQV
FT                   IQCTPAQPLHCENRVSYKTTKNQTRPRLKVCDAELVYNSSELRGPTEVEGVPTFFMIEV
FT                   HRCPDCAERRQADPGFGGQVSHRILTADMVKYSSHLSGVFEDILLEDIVPGRPVAFPFS
FT                   EEHARRIKTQFGALIALARELVGALYAPVPEPLYRVPQGVRRDRRDSGRERRAQVIAYA
FT                   QAFTARRPGAPLMRGWYSRLLQFFADVNGDTAAVPR"
FT                   /protein_id="YP_003958579.1"
FT   gene            585506..585979
FT                   /db_xref="GeneID:9882501"
FT                   /locus_tag="ELI_0601"
FT   CDS_pept        585506..585979
FT                   /locus_tag="ELI_0601"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826223"
FT                   /db_xref="GeneID:9882501"
FT                   /translation="MQKKTTTELLEAFFTGGLFATPENEETELMEAISRKLIEFACILG
FT                   TVAVDARFAREAMGTTEAFPVSEIAADYGRSAQAFNKLLRDQGIQYKRGKRWYLYDRYQ
FT                   NRGYTATRLTARDTGGRVRTFSSMQWTVKGRRFLYDFLREQGIHPTAGKEARP"
FT                   /protein_id="YP_003958580.1"
FT   gene            585976..586629
FT                   /db_xref="GeneID:9882502"
FT                   /locus_tag="ELI_0602"
FT   CDS_pept        585976..586629
FT                   /locus_tag="ELI_0602"
FT                   /gene_family="HOG000166286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826224"
FT                   /db_xref="GeneID:9882502"
FT                   /translation="MNYLTEHLSFYVWLESHPRSTAFQSFWNYLLVRNNRAAFMGEDGF
FT                   MYWPVWYTVPNDDLRRLLGEPDAKRIWEHRRRLIGEGLIEYRPGSGGQSGVYALIPFER
FT                   GQTRLQVIPQGGGEAVTAWTPYQNSARTAAGAPPEGPAEQRAFSSDYNHINHKYINAKE
FT                   PCRYEGEPPVPYFNQLPMLTGEEMERLSAIHKDDASLVEAMWALKEQKKQEEES"
FT                   /protein_id="YP_003958581.1"
FT   gene            586629..586805
FT                   /db_xref="GeneID:9882503"
FT                   /locus_tag="ELI_0603"
FT   CDS_pept        586629..586805
FT                   /locus_tag="ELI_0603"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826225"
FT                   /db_xref="GeneID:9882503"
FT                   /translation="MRHKRENGYEPYRCRAEAVLLTTVHARSPEEAEGLLQDLLDAIED
FT                   DYPGLLFEGMWVD"
FT                   /protein_id="YP_003958582.1"
FT   gene            586827..587048
FT                   /db_xref="GeneID:9882504"
FT                   /locus_tag="ELI_0604"
FT   CDS_pept        586827..587048
FT                   /locus_tag="ELI_0604"
FT                   /gene_family="HOG000166295" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826226"
FT                   /db_xref="GeneID:9882504"
FT                   /translation="MGKGPPRPRLGLTQPQLAETAGISLSTVTRLERGSPVRDYVLEAL
FT                   EDLFEDRRPGEDGQNPHFQLTIYQDLLR"
FT                   /protein_id="YP_003958583.1"
FT   gene            587086..587322
FT                   /db_xref="GeneID:9882505"
FT                   /locus_tag="ELI_0605"
FT   CDS_pept        587086..587322
FT                   /locus_tag="ELI_0605"
FT                   /gene_family="HOG000166296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826227"
FT                   /db_xref="GeneID:9882505"
FT                   /translation="MAYQQDKIGHEMKLIFNYGEVNGSVKKKSKTYSGLNLDMAVATTE
FT                   AITRTGKAIGKLCTPIVNDIQNYMGYSNTEVSA"
FT                   /protein_id="YP_003958584.1"
FT   gene            587361..587597
FT                   /db_xref="GeneID:9882506"
FT                   /locus_tag="ELI_0606"
FT   CDS_pept        587361..587597
FT                   /locus_tag="ELI_0606"
FT                   /gene_family="HOG000060671" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826228"
FT                   /db_xref="GeneID:9882506"
FT                   /translation="METTTTTKALDLEFELENGKSFTVTCPDYLDDLTQEQIATQAAEI
FT                   IAAGAFAPDGFNLTKLRSFEYIDKTTRKTEIEA"
FT                   /protein_id="YP_003958585.1"
FT   gene            587621..588196
FT                   /db_xref="GeneID:9882507"
FT                   /locus_tag="ELI_0607"
FT   CDS_pept        587621..588196
FT                   /locus_tag="ELI_0607"
FT                   /gene_family="HOG000253777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Peptidase M15A"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826229"
FT                   /db_xref="GeneID:9882507"
FT                   /translation="MKTIRKRTALLILAALTAAGILYFARELNWAPARQNPPPAQTEAP
FT                   KPPEPDTPEAPPEATPPETPEPPGQPESGALEKQPVMVSEHFARDEYRCDCAGYCDGFP
FT                   AEPQPGLVSRIEALRQAVGAPVIITSGVRCEERNEEVGGVAWSFHKRGAAADLYSPGVP
FT                   VGTLAALAKDCGLNVLPYYSSGYVHVEI"
FT                   /protein_id="YP_003958586.1"
FT   gene            complement(588163..588306)
FT                   /db_xref="GeneID:9882508"
FT                   /locus_tag="ELI_0608"
FT   CDS_pept        complement(588163..588306)
FT                   /locus_tag="ELI_0608"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826230"
FT                   /db_xref="GeneID:9882508"
FT                   /translation="MNRFGHTAVMRRKKKLPEVFQATLAAKKPECTGGRSSHISTCTYP
FT                   LL"
FT                   /protein_id="YP_003958587.1"
FT   gene            588476..591352
FT                   /db_xref="GeneID:9882509"
FT                   /locus_tag="ELI_0609"
FT   CDS_pept        588476..591352
FT                   /locus_tag="ELI_0609"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative sensory box/GGDEF domain/EAL domain
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826231"
FT                   /db_xref="GeneID:9882509"
FT                   /translation="MENLFKNMDMDAGILYDLLSSICNDYLYIWDTHKDLFQVSPNMVS
FT                   DFGFEESGMAHYRQTMLERIHPRDYERLKKHFAGLWHSGEESFSLNYQMLNASGSYIWV
FT                   NDQGRVRRNPRTGEPMVILGAMKSLEGCEYTDDVTGLMHHRFCQEKIQSILDEAPEIRF
FT                   RLMLLGIDEFNKINTLNSRAFGDQVLKATAENLLQALPEEVNLYRYEGDQFLVAGAGAT
FT                   REEMLNIYRHVQQYALRSHRVEGQPCRFSVSAGLVAYPEDGDNWSDLEKKAAIALKRAK
FT                   LNGKNQCVEFKHSMLREQIDNQLLTNCMAESVEKDFEGFRLVFQPLCGARELTIIGAEA
FT                   LLRYRMPDGREISPVEFIPLLENSRLIIPVGLWVLEQAAAVCREWMKWIPDFMMNVNVS
FT                   YIQLKETDFCQKAEAVLRRQGLAPENLVLELTESYFMKEDDNVRDALRRLRGLKLRLAM
FT                   DDFGTGYSSLERLADLEVDIVKVDRFFVQSLHISRHNRDFIESVIRLCHNRRKKVCVEG
FT                   VETQEEWESIRLMNADTIQGFYISRPVEQDFFFSHYVAASFDGKGLLGAIDRKRLQDHL
FT                   VNDRELLFAMMNATPLSLMIWNRQFEILACNEEAVRLFGAESRSALIEGFNSYSPPTQL
FT                   DGENSEIGVHDRIVETFLKGRNQFKWLHVDHQGRRLPVEVTCVRIPYQDDCVVASYARD
FT                   LRAELEAEQSGRRFRERLRALLDATPLCLNLWNKQFENTMCNKEAMKLFELEDERDYLE
FT                   RFYELSPERQPDGQLSVEKANTKITEAMRTGRAQFRWLHQRLDGTPIPCEVTLVRIEHL
FT                   DDDGSAMVAGYTRDLREQAAAEKMQRVLSARVRAVMDATPLSCILWNVREEILDCNQMA
FT                   VKLFSAGSAEDVLKDFDSFLPQYQPDGTPSLDKKETYFKEVKEKGHCSFEWLYENRQRE
FT                   KIPCEVTLVRAAMEEDEDIIIAYNRDLR"
FT                   /protein_id="YP_003958588.1"
FT   gene            591369..592748
FT                   /db_xref="GeneID:9882510"
FT                   /locus_tag="ELI_0610"
FT   CDS_pept        591369..592748
FT                   /locus_tag="ELI_0610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GGDEF domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826232"
FT                   /db_xref="GeneID:9882510"
FT                   /translation="MTQKVKETTRMELAEVLAGNQVETENVLQALKMIRESIAFDGGAV
FT                   YQAERSGRFYLAEQQAAGQCAAAPSFETECAAWLAQQAVICIGRGGHNGQRETELLDLF
FT                   GADALVMSPVADENWELHELVVFFDRDQEKLPPETAVRLPLLLLTRYLSVRVYQSKLWR
FT                   ARRSLESVLDNTGIDIYVNDFNTHDILYVNQSMAAPYGGKEQFLGKKCWQILFPGQNGP
FT                   CAFCPQEKIADEDGNPTKVYTWDYQRPFDGAWFRVFSAAFQWEDGRMAHVVSSADITDN
FT                   KQKEALIQYMANYDALTDLPNRRMLLSEGQARISQAQPPEKLYLMFFDIDGFKAINDAY
FT                   GHDAGDAFLLQLSRFFSEIPLLQEAIYRNGGDEFVALVGGEAITKENIRNLSRFIHLRF
FT                   NRPWVLKEGQAFCNTSIGVACYPEDGKSIETLLRTADLAMYQAKKSGPGHVCFGSELKT
FT                   K"
FT                   /protein_id="YP_003958589.1"
FT   gene            complement(592824..594962)
FT                   /db_xref="GeneID:9882511"
FT                   /locus_tag="ELI_0611"
FT   CDS_pept        complement(592824..594962)
FT                   /locus_tag="ELI_0611"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826233"
FT                   /db_xref="GeneID:9882511"
FT                   /translation="MNKKDFAWLIMCSRKTIAYVADMDSYELKFLSPAAMELCGLTAPE
FT                   EYLNQKCFELIQGLDAPCAFCTNHKLRTDAPYKWEFYNQHLKCWASIEDSLIEIDGHPY
FT                   RLEVIRDISKDKAKIDSILNQLTMEEMLVKCIELLAYENDADVAIDRFLETVGDFYAAD
FT                   RTYIFEYDFEQDCANNTYEWCQPHISSEKDNLQQLPLELLADWGAKFERHGFFYINSVR
FT                   EDYAQDSPEYNILNQQGIQSVAAAPFIQDGRITGFLGVDNPSANTRDWTLLRSVSTFVI
FT                   DELKKRRLLLDLEYASYRDLLTGLSNRNYYQKFLDGLKLSPPDSLGIVYIDINGLKAAN
FT                   DGYGHQYGDYIITQSAMILKRFFPDCAFRIGGDEFIALSIDCAQASFEQKVADVKAAFD
FT                   QDKNVDVSIGSLWKQGEYNIENEIILADELMYSEKQKYYDTILREGRGSRTGQAAHLLQ
FT                   SIQNHQFTVVYQPQVELATGKIVGVEALIRKKGPGGKLITPDHFIPRYEREGIIRHIDL
FT                   YVFEVLCAQLKKWHDRGDRLRGSVNFSRVTLMETNIVKTLQNVCGQYGVAPEDVTVEIT
FT                   ESVSKVENAALNALINTFHAAGFSISLDDFGTAYSNLSILGELDFTELKIDKSMLQDLT
FT                   GNKKKQALVKNVILICKDFGNIISLAEGIESEEQYALLLKYHCLLGQGYYFSKPLSEKV
FT                   FNTYYRTKKTFRAPAYPH"
FT                   /protein_id="YP_003958590.1"
FT   gene            594931..595071
FT                   /db_xref="GeneID:9882512"
FT                   /locus_tag="ELI_0612"
FT   CDS_pept        594931..595071
FT                   /locus_tag="ELI_0612"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826234"
FT                   /db_xref="GeneID:9882512"
FT                   /translation="MISHAKSFLFIAKSSLHPKDNIFIVLYFLKWHLSIRNFKAALFYC
FT                   V"
FT                   /protein_id="YP_003958591.1"
FT   gene            complement(595135..595254)
FT                   /db_xref="GeneID:9882513"
FT                   /locus_tag="ELI_0613"
FT   CDS_pept        complement(595135..595254)
FT                   /locus_tag="ELI_0613"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826235"
FT                   /db_xref="GeneID:9882513"
FT                   /translation="MVQRFSMELFHGPVLSQRSYNTGSLPRAPLPACNALLLY"
FT                   /protein_id="YP_003958592.1"
FT   gene            595222..596691
FT                   /db_xref="GeneID:9882514"
FT                   /locus_tag="ELI_0614"
FT   CDS_pept        595222..596691
FT                   /locus_tag="ELI_0614"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826236"
FT                   /db_xref="GeneID:9882514"
FT                   /translation="MKELHRKSLYHYATALFVFLCYLGMCIAVFFYGIQHAVEGTTRAQ
FT                   LAENVTKQCDHLKDVIGLEFENLEGVAAYLGGQENPVKMENGDLLRAMVSESAFVRMTY
FT                   GTKDGTGYASDLPELQDMSGQAFFKEAMKGSRVVSDPIESPLDGTDLIVLAVPVYDSSG
FT                   GVTGVLAGSFDVSRLSEIFFGDLYGGAGYVYIINSAGESIMMDKKHGEDRRGKTFFAFY
FT                   SDVTFEKGDSLAQVQADLAAGTGAVRRVRRDEDIRYLTYEPVGYNNWFVCYVVPEKNAQ
FT                   QAYAFIRDYEIVLSLFVVAGLIILLAVLQYTNVRDRRLLEVKAQTDAMTGLLNAVSTRE
FT                   NVDVWLKNGECRGMQALIMLDVDRFKDVNDTYGHAVGDEALRQSAALLKRHFRGSDIVG
FT                   RVGGDEFIVFMKNIPGGTIVSSQLEKLCQAFHAIRIAEAQDLRLTCSAGAALAPADGGD
FT                   FDTLYKKADLALYSVKRGARDGFAIYKDSGS"
FT                   /protein_id="YP_003958593.1"
FT   gene            596732..597049
FT                   /db_xref="GeneID:9882515"
FT                   /locus_tag="ELI_0615"
FT   CDS_pept        596732..597049
FT                   /locus_tag="ELI_0615"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826237"
FT                   /db_xref="GeneID:9882515"
FT                   /translation="MIKHRTAAILFSILLILGLSAIGTGRAYAAQQPARNPLYANQSAG
FT                   QEPAADGENAAEVVEGSPTPLAQPIDGKNGPSPLMLCGIAAVVVAVVTAAVILRKARKF
FT                   E"
FT                   /protein_id="YP_003958594.1"
FT   gene            597302..599557
FT                   /db_xref="GeneID:9882516"
FT                   /locus_tag="ELI_0616"
FT   CDS_pept        597302..599557
FT                   /locus_tag="ELI_0616"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cna B domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826238"
FT                   /db_xref="GeneID:9882516"
FT                   /translation="MEKHIRSTARKFIALAFAIFFAFGAMPAAFAEGDTQRDLTNVLTD
FT                   LDVDMSLKQTNGTTVPIIVDNEKDPSFNETLVSGSTIIFGITWNLEEENFYGQVKEGDY
FT                   FTIDLPADHFTFRDTTLNTPLVYNGETLGHWGVQNNKIHFTLTDTGAQKRYIRGHFNAS
FT                   GTLKAAESGDIVIEVGGVTLPPVPVKPSTPSTPDPDVDFPAENYIPSPQKPLSKTGSTY
FT                   TGSETITWNLAVNFDNLLTAAVHSNPAITPLKNAVIEDTLEKDQTIKSINIQSLLYRLR
FT                   NADGELSTQWASSINVISQFTALNQTADESLDDFKDRVTNYGSPAYGISADQKYLVISL
FT                   GDVPGNGVKLAADDAALRAKIKSSNSRLTDAELDTMVKSWGTGGIAGGEAVGYYITIQA
FT                   ETGRAYEQYSNTATLTTTDNAPIESGKSVILEDLDGGIEAGEPHSVRLEKRSAEDGTLL
FT                   ENAAFQLEVQRDGVFMPYVPTDGGEPVRATGADGMVEFKKLGSGTYRFVETAAAPGYDK
FT                   DSVAYSPETFTISTEDTEGVVVTATNLPLTDKPPVDPIELTGRVSLKKVDQADPQKTLE
FT                   NAAFRLYERQPDGTALYYKDANNGLPLWSANPDEAQTFTTDAQGMITVDHLLLGTYYFE
FT                   EVTPPEGYRLSTTALAFTLDENDIETGKSVVFENTKTETPPADPENPEPPKTPETPEPP
FT                   ETPKAPAAQKPAVHKTEGPIAAGANPKTGIADISSAVTLLLILAGGSAGIIGLKKRR"
FT                   /protein_id="YP_003958595.1"
FT   gene            599813..600478
FT                   /db_xref="GeneID:9882517"
FT                   /locus_tag="ELI_0617"
FT   CDS_pept        599813..600478
FT                   /locus_tag="ELI_0617"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826239"
FT                   /db_xref="GeneID:9882517"
FT                   /translation="MKKKRNILIVIAIIAIVAAIGSTMAAFVASTTTTKDVSAAELGIK
FT                   IVQNGDAAKAVKSLDAAGDSKAGYQYAGMPGDTVQEHVAVKSDANSKDSYIRVTINRSW
FT                   TDKDGKKDFKLSPKEIGIARDNDSWLVTEDPEDPEIIYCYYTRKVGGNTQTENVMDSFT
FT                   ILKDKVTENSNAYAGYSANITFEADAVQAEAGAKAMLAEWGIMAELDAEGNLTGYTEQ"
FT                   /protein_id="YP_003958596.1"
FT   gene            600490..601218
FT                   /db_xref="GeneID:9882518"
FT                   /locus_tag="ELI_0618"
FT   CDS_pept        600490..601218
FT                   /locus_tag="ELI_0618"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826240"
FT                   /db_xref="GeneID:9882518"
FT                   /translation="MKKKCITLIITLALLLATGLTASAAETITFKGQAEKFVTDVSGDA
FT                   ESFDDMLPGEKRTISLTLKNEDSSEMKFYMSAEILDNIASKTADSQAVYDFVISKNGEP
FT                   FFNTIIGGGTAKNTSAGEKYLDESNNILLDTLAQGQSDVIEISLELEGNSTGNSYMKQT
FT                   GEIQLVFTASTTDPAAPGGSNSGGNVIERLVQSIVNPGATGPNTGLNGVSPYLIVACVC
FT                   VLIAVVAIVILIATRKKKEE"
FT                   /protein_id="YP_003958597.1"
FT   gene            601221..602087
FT                   /db_xref="GeneID:9882519"
FT                   /locus_tag="ELI_0619"
FT   CDS_pept        601221..602087
FT                   /locus_tag="ELI_0619"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA polymerase I"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826241"
FT                   /db_xref="GeneID:9882519"
FT                   /translation="MTAVKKKLTKTAAVLAASLMALLLMGMTLPATAHAEEGTYNIEFK
FT                   AGAEGAIAGGTSYTQPVTYGGKLDAESVAAMVQPNTGYYFTDWNKAVETTVTGKATYVA
FT                   QYAKIIEEASYRVRYLDTFGNELATQKVVAASKGGTVVEYARQIDGYIPDAEGKSTTIA
FT                   AEGTEIDFVYTPADNPAFETRPGVVPVSGQPGDTGTAATLPGGTTAGGGTNTPGDNNPG
FT                   ENIEGGDTPLAQPDEETIDPNETPLANAAKQVGGMANLIMIGVGGVALLAVLITAIIVY
FT                   RKKKARQ"
FT                   /protein_id="YP_003958598.1"
FT   gene            602302..603498
FT                   /db_xref="GeneID:9882520"
FT                   /locus_tag="ELI_0620"
FT   CDS_pept        602302..603498
FT                   /locus_tag="ELI_0620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826242"
FT                   /db_xref="GeneID:9882520"
FT                   /translation="MEEQNTTLRAQMFSGFSISDDSASLDEESIRSEMMTKLFIYILCH
FT                   RQKELTVQELAEALWEEEESDNPAGALKNLMYRLRSLIKKTWGRNDFILTGRSAYIWNQ
FT                   EISVSLDIEVFEEKIKEAEEEKDPGRKIDSYKAAINLYRGELLPKFASEYWVASLSTYY
FT                   HTTYLSAVKKTAALLEAQGRFSEMASCVSKALQIDNLDENLHCCFIRALMGQDNYKQAT
FT                   EHYQKAEKTLYDYLGVTPSEELRGLYETIIKKTHRHERDIVDVQNELMEDSITGAFVCE
FT                   YGAFKRIYCLQARQGARMGISVFLLLTTLSADEGIAENKKIELLRDAMVHLEDVLRTSL
FT                   RSGDPVAQYSSSQYVALLPTCQYETAQIVAGRIEKAFWGNYKNKQIQLRFDLDELHYD"
FT                   /protein_id="YP_003958599.1"
FT   gene            603520..603942
FT                   /db_xref="GeneID:9882521"
FT                   /locus_tag="ELI_0621"
FT   CDS_pept        603520..603942
FT                   /locus_tag="ELI_0621"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826243"
FT                   /db_xref="GeneID:9882521"
FT                   /translation="MKPQSIPSTSLRLCIDRFDEDDMAGRIMGVALENEIPFSSFRSFV
FT                   ASVDKAYDTIGQPQSGQISRSFGKQAVKPTPYVAVPRHYHEPGEIKSAAGSLKTFDLIM
FT                   QTRHHAEWQGVLKDAEGNPLGTFKSVLECIQLMTEY"
FT                   /protein_id="YP_003958600.1"
FT   gene            604120..607647
FT                   /db_xref="GeneID:9882522"
FT                   /locus_tag="ELI_0622"
FT   CDS_pept        604120..607647
FT                   /locus_tag="ELI_0622"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fibro-slime domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826244"
FT                   /db_xref="GeneID:9882522"
FT                   /translation="MKSVKRLSRYTSILLSMLLMLSAMSPGISALAQERANAAPTVLTY
FT                   EDDSITAELKAKEGTSLPAGAALTVKALNKDSQDEAEKALYAETEVGLKAKASEQGTTV
FT                   DGFTAYSVKLQNKEGKDMTPAQGEYTLKITYKEATAPEAFLNSESAEKGVTLYQKTEGK
FT                   DEQNNTIYTMEVTGEEDTKITADANGKVQAVESKITTLQPIALAWQSVGVNPTVDNEEQ
FT                   QLESALEEPANNVAMTAGLPQMEENTPVLEDNQYWYSFHYDNREGSWTKQDQYFSRWIV
FT                   NIVDANNNPINVKEILGENNSRHTTLNGKDNPDGQDKVDWKVSQISKPELEGYKFAEAR
FT                   IKTSKDDPLQVFTAMATWVPPSKPNQYQYDYKKGADGKNCFYSDVINNDGTYGAEITFV
FT                   YDKLTTVPTIDSQQLGVDIQMFDYSTPTPANTWAAYGDGSLKQGRLKKELNSDGIPVGA
FT                   MGLMDGKPLSESFSATSNNYQGKANHLFRKDIYDNPDTKGTFYYSSFENYAYWKESNDE
FT                   IDKEKPYDFTVYDQIGTPSDENAYFYKRGNFMPYNKIEAGKFSSNSNYYDEDGKNLDEE
FT                   SLRYGEKLYKTQQSGAPGAQNGNDYWFGMVMSSSFTQLEGGRYNGQDMVYEFNGDDDLW
FT                   VFVDGVLVLDLGGIHDAHSGSINFATGEVQVKDSRNVNGSAVEIFHKPTSIKEQFKNTE
FT                   KGKSMSEEDWDGNTFSDYSNHEIKIFYMERGGGASNCKMKFNLPVMPKDSITVRKEVTN
FT                   INEGSYSDVNFNFRLFLEDNNATEVDEDTIEKNGTFYSLAKNKTYTMDGETLNTGDDGK
FT                   FTLHHGQQAVFEEIADRKTKYILQEISVDQNRYDEFKVNGQAVQDGNIIPSETETGKYI
FT                   IQTDPLAIDKNAFVTFKNHCDSENLHDLDITKKMIEGQESNDTFQIQVKIGGQLYNGKY
FT                   KINGVDSGKTCQNGNLEIKPGQTIKIENIAADTSFEVIENYDKDNYENPQYTISEATVD
FT                   STTDKAAGKIEFKKNAKVEVTNTRKLGSLKITKTITDDSKVDYMDGDPIFTFKITGPNN
FT                   IEGQEPQVFYRTLRLSKDVGKTASIIIDNLPIGEYTVEELNTMRYTCTSDNPQTDTVQQ
FT                   NNTEETKNTPPTEFSFTNQLTNEDYFSHTDVVENSFKIGEDGTVTVEKHKVPEGQVPDG
FT                   TTPVQPSNE"
FT                   /protein_id="YP_003958601.1"
FT   gene            607662..608276
FT                   /db_xref="GeneID:9882523"
FT                   /locus_tag="ELI_0623"
FT   CDS_pept        607662..608276
FT                   /locus_tag="ELI_0623"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826245"
FT                   /db_xref="GeneID:9882523"
FT                   /translation="MLNNILKNRKLKYGLVSLLAVVLIGGAVTLAYLSKSTEAATNNFA
FT                   PGEVTTEIEEKPEVVGSTIKKDPAVKNIGPSACIVRMRVTISPGSIAERVNNKQENEIK
FT                   INFDEKAWKYNEADGFWYYQAVVPVDGRTTALFDEITGITDQAGKPLKDFEDFQITLYQ
FT                   EAVQTEVTINGKPVKATDATGNYNSENAMKIWAEFDKKDNQ"
FT                   /protein_id="YP_003958602.1"
FT   gene            608412..608984
FT                   /db_xref="GeneID:9882524"
FT                   /locus_tag="ELI_0624"
FT   CDS_pept        608412..608984
FT                   /locus_tag="ELI_0624"
FT                   /gene_family="HOG000085954" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal peptidase I"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826246"
FT                   /db_xref="GeneID:9882524"
FT                   /translation="MKKIYHILTSLILVILIALAAILFLPKLLGMTPLAVLSGSMEPTY
FT                   HVGSLIYVKDADPQDVQIGDPITFKISDDTMVTHRVVAIDTEAQTFQTKGDANDNVDGG
FT                   AVAYENLVGKPVFTIPYMGYLAVYANTTTGMIVMVTVILVILILTFLPDFLMKDDDEEE
FT                   KETKKDPRRERTAESKKTDTQKRKKKE"
FT                   /protein_id="YP_003958603.1"
FT   gene            608984..609052
FT                   /db_xref="GeneID:9882525"
FT                   /locus_tag="ELI_0625"
FT   CDS_pept        608984..609052
FT                   /locus_tag="ELI_0625"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826247"
FT                   /db_xref="GeneID:9882525"
FT                   /translation="MIKQGLQKALFFYLKRIDVTVL"
FT                   /protein_id="YP_003958604.1"
FT   gene            609127..609831
FT                   /db_xref="GeneID:9882526"
FT                   /locus_tag="ELI_0626"
FT   CDS_pept        609127..609831
FT                   /locus_tag="ELI_0626"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826248"
FT                   /db_xref="GeneID:9882526"
FT                   /translation="MKKKRAGLVLTSLLVVAVIAVGLTLALLSTSTGTKTNAFSSNKNI
FT                   DIQLREDQWDGYTFNDGEGDSTTGQTVNPAYEGNKEDLGLVQAQSYLPGQVIPKNPTVK
FT                   NNNNDGKGVETNVALKVTYYLENEDGTEKQVSYGTFKETLLAENGIEFDESWKNITEES
FT                   LPTQIFLYNKTLDLNEETTALFSSVPLSKNIEANENGELPKFNIKVQAYAIQAGVEGMN
FT                   IETEMVKFINAN"
FT                   /protein_id="YP_003958605.1"
FT   gene            609957..610727
FT                   /db_xref="GeneID:9882527"
FT                   /locus_tag="ELI_0627"
FT   CDS_pept        609957..610727
FT                   /locus_tag="ELI_0627"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826249"
FT                   /db_xref="GeneID:9882527"
FT                   /translation="MDKKKKRLAKGLVAAALVGVIAVGSTLAYLSANTGQKTNKFTGAK
FT                   IEGSTEENFTPPESYLPGQNIEKQPWIQIKAGSAKANVAIVVDYIGDDGNTKLSQEEFK
FT                   RYAEVKDWNLGEEGSATWRKVADSKDGKSELYIYNEVVDASTSKQDVSTQFLFNSVTVN
FT                   PNLRTVTDADKDTTQVYSGKNKTGLTDFSKVTDTIAGTYYYDQNNNVLIKNNLPEFTID
FT                   VSGFAVQSENLGDSTASAELTKLANEGRTGNQQF"
FT                   /protein_id="YP_003958606.1"
FT   gene            610767..611435
FT                   /db_xref="GeneID:9882528"
FT                   /locus_tag="ELI_0628"
FT   CDS_pept        610767..611435
FT                   /locus_tag="ELI_0628"
FT                   /gene_family="HOG000166297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826250"
FT                   /db_xref="GeneID:9882528"
FT                   /translation="MTKKKKGAILISALALIAVIVIGGTLAYFTDQDDAKNVFTLGKVQ
FT                   GDLTEDTKDYEVDTPGGGTHPVKPGTLTEDGISYDKIVPGDWLSKEPRVSLTGDSEDAY
FT                   VRVRLSVPNSTKLNQEQVAELITAKCLNFGEKWVVGVDGYIYYQEKLTRDSSGKSQTDP
FT                   VFTMVKIPEEWGNSTAEASFEITIQADLVQAENFETSLGHNAAGQIDSWGGVTIEKAAQ
FT                   "
FT                   /protein_id="YP_003958607.1"
FT   gene            611560..611769
FT                   /db_xref="GeneID:9882529"
FT                   /locus_tag="ELI_0629"
FT   CDS_pept        611560..611769
FT                   /locus_tag="ELI_0629"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826251"
FT                   /db_xref="GeneID:9882529"
FT                   /translation="MRMEKIINASNQTFVLEIKSTRNNTWQGTILWVQTQEKVAFRSAL
FT                   EAIKILDSALTDEGADETPKLQIV"
FT                   /protein_id="YP_003958608.1"
FT   gene            complement(611839..612675)
FT                   /db_xref="GeneID:9882530"
FT                   /locus_tag="ELI_0630"
FT   CDS_pept        complement(611839..612675)
FT                   /locus_tag="ELI_0630"
FT                   /gene_family="HOG000039326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DegV family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826252"
FT                   /db_xref="GeneID:9882530"
FT                   /translation="MENKIIVDSCLDFNPEIFTADLPLERIPFKLRIDDEELVDQDLST
FT                   MLLVDKMKLSKNKVSTACPSPQEYLDAIDPERVNYIITISSKLSGSYNSAVMAAVMAQE
FT                   KYPDCQVHVLDSESAAAGEDLLFMKLQSFLEENLPTSEIVSKLMDFITNMRTMFILNSL
FT                   DNLAKNGRISGTMALLGKVLKVVPIMTDNGEGEIALKEKVRGKKKAFSRLVEIIADEVS
FT                   DASEKILAIAHVHAQETAENLKKAIEEKCNFKDVVIFEAGGLSTVYADNGGVIVAY"
FT                   /protein_id="YP_003958609.1"
FT   gene            complement(612762..613658)
FT                   /db_xref="GeneID:9882531"
FT                   /locus_tag="ELI_0631"
FT   CDS_pept        complement(612762..613658)
FT                   /locus_tag="ELI_0631"
FT                   /gene_family="HOG000156003" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826253"
FT                   /db_xref="GeneID:9882531"
FT                   /translation="MKNIQTKNKTLLADLALITVALIWGVGFIASKAALVTITPLWVMT
FT                   FRFLGSGVLLLILFLKRVRRLDKRTVLMGMVVGSFMFTGMVFQTIGLDHTTASNQAFLI
FT                   PSYVVLVPFVSWMMTRVKPRALDVAAALLTFAGVAVISLKPDFSMNLGDALTLIFAVVY
FT                   SFQIVFLGLFVKETDVMSFTVVQMLTAGGLSLFAALVFAPPLDGVSATSAFGILYLVVF
FT                   NTALAFLIQNIAQQYTTSTHASLLISLESVFGLIVSVIFLHDPFGPRMALGCGLVFAAV
FT                   LLSKLELKKEKAPLSLK"
FT                   /protein_id="YP_003958610.1"
FT   gene            complement(613701..614636)
FT                   /db_xref="GeneID:9882532"
FT                   /locus_tag="ELI_0632"
FT   CDS_pept        complement(613701..614636)
FT                   /locus_tag="ELI_0632"
FT                   /gene_family="HOG000059047" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sufB/sufD domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826254"
FT                   /db_xref="GeneID:9882532"
FT                   /translation="MNEIPMNDVARELLKDVADIDGKPEGVAFNIREDSQCAGRNSTDN
FT                   IQIVSKEDGSGIDIIVQPGTKNDKVFIPALVTCSGVHDLVYNDFYIGEDADVTIVAGCG
FT                   VSTDGCDGSEHNGIHRFFLKPGSKVLYIEKHIGVGEGTGKRVINPETYIEQEAGSYMEM
FT                   NTTQIKGVDSTKRKSAAKLGEGAKLVIKEKLMTHGDQYAETAFEVDMDGAGSSCTLSSR
FT                   SVARDRSRQLFLSKINGNNQCAGHSECDAIIMDEGVVSAIPEITANDLEAELIHEAAIG
FT                   KIAGDQIIKLRTLGLTEHEAEQHIIEGFLK"
FT                   /protein_id="YP_003958611.1"
FT   gene            complement(614638..615360)
FT                   /db_xref="GeneID:9882533"
FT                   /locus_tag="ELI_0633"
FT   CDS_pept        complement(614638..615360)
FT                   /locus_tag="ELI_0633"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826255"
FT                   /db_xref="GeneID:9882533"
FT                   /translation="MLELKNICFEVEDEKKGILKDVSLKIDSGKFVVITGPNGGGKSTL
FT                   ARIISGILTPTSGQILFDGQDITGLDITERAKLGISFAFQQPVRFKGITVHDLISLAAG
FT                   SPLNQVEACQYLSEVGLCARDYIDRELNDSLSGGEIKRIEIATILARGTKLSIFDEPEA
FT                   GIDLWSFKNLIAVFQKMYEKINGSIMIISHQERILNIADEIIVLANGKIISQGAREDIL
FT                   PRLLNGTDKVDFCPRMEE"
FT                   /protein_id="YP_003958612.1"
FT   gene            complement(615364..616059)
FT                   /db_xref="GeneID:9882534"
FT                   /locus_tag="ELI_0634"
FT   CDS_pept        complement(615364..616059)
FT                   /locus_tag="ELI_0634"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HAD-superfamily hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826256"
FT                   /db_xref="GeneID:9882534"
FT                   /translation="MQKTFKAIIFDFNGTLFFDSDKHDAAFDRFTLEQCGRHITPEEMH
FT                   GFYGQTNATIIPAILKDRELTAEEITAFGDDKEALYRELCLEDTENLHLVSGAPELLDW
FT                   ICASQIPHTIASSSELANMAFFFKTFALGKWFDFDTTVFDNHTFPGKPSPDIYRLAAEK
FT                   LGVCPEACIVVEDGLSGIQSAHAAGIGHIIAIAAPERHDYFMQVPGVNAVISNYHEFDR
FT                   SLLERSVKE"
FT                   /protein_id="YP_003958613.1"
FT   gene            complement(616127..617428)
FT                   /db_xref="GeneID:9882535"
FT                   /locus_tag="ELI_0635"
FT   CDS_pept        complement(616127..617428)
FT                   /locus_tag="ELI_0635"
FT                   /gene_family="HOG000246356" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826257"
FT                   /db_xref="GeneID:9882535"
FT                   /translation="MTTTMLERGKTAKKAGIQLSATDTQTRSAALTAIADALEKNRAAL
FT                   IAANQADYERSAAENLAAPLLGRLTFDDHKIDDVIDGIHSLIELEDPLGATRMATELDT
FT                   GLELYKITCPIGVIGIIFESRPDAFVQISTLCLKSGNAVLLKGGREALETNRLLCKVIS
FT                   EATASVGIPDGWIQNLESREDVNAMLALDDYIDLIIPRGSNSFVKYIMDHSNIPVMGHS
FT                   DGICHAYVDASADPDKAVSIAVDAKTQYVSACNTIETLLVHKDIAGEFLPRLKAGMDQK
FT                   QVHLKGDDRVRAVIDVEPATDDDWSTEYLDYILSIKVVDSLEDAIDHINTYGSGHTDVI
FT                   VTEDEDHAKKFTTLVDSAGVYVNCSSRFADGFRYGFGAEVGISTSKLHARGPVGLDGLL
FT                   SYKYKLIGHGDIVSDFADGKRSFTHKSLDQDCPL"
FT                   /protein_id="YP_003958614.1"
FT   gene            617493..617708
FT                   /db_xref="GeneID:9882536"
FT                   /locus_tag="ELI_0636"
FT   CDS_pept        617493..617708
FT                   /locus_tag="ELI_0636"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826258"
FT                   /db_xref="GeneID:9882536"
FT                   /translation="MPRILNEMAAAGRCLNRFFDRKSVHQFSILNSALSIVLILLMIGL
FT                   IFYDLKRPVNLFQQHDAEQLVGEGHL"
FT                   /protein_id="YP_003958615.1"
FT   gene            complement(617610..618089)
FT                   /db_xref="GeneID:9882537"
FT                   /locus_tag="ELI_0637"
FT   CDS_pept        complement(617610..618089)
FT                   /locus_tag="ELI_0637"
FT                   /gene_family="HOG000218433" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha/beta knot family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826259"
FT                   /db_xref="GeneID:9882537"
FT                   /translation="MNIKIITVGKIKEKYLRMAIDEYSKRLGAYCRLEIIEVKDEKIEE
FT                   RFSDAEKARAVALEGERIARYLKDNEIIAALKITGRQLTSPDFAKKIEHYGLQGKSSLT
FT                   FVIGGSLGLAPEIEARAHWDLSFSKMTFPHQLFRVMLLEQVYRAFKIIKNETYHK"
FT                   /protein_id="YP_003958616.1"
FT   gene            complement(618108..618260)
FT                   /db_xref="GeneID:9882538"
FT                   /locus_tag="ELI_0638"
FT   CDS_pept        complement(618108..618260)
FT                   /locus_tag="ELI_0638"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826260"
FT                   /db_xref="GeneID:9882538"
FT                   /translation="MANNKNNPTKKTKQKPPKQSHQSNIKNSYRIGALILVIIIIVSLL
FT                   TMYSF"
FT                   /protein_id="YP_003958617.1"
FT   gene            complement(618250..618846)
FT                   /db_xref="GeneID:9882539"
FT                   /locus_tag="ELI_0639"
FT   CDS_pept        complement(618250..618846)
FT                   /locus_tag="ELI_0639"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826261"
FT                   /db_xref="GeneID:9882539"
FT                   /translation="MKIIEAGVSAPEGLADITEQVREYIREVRLKDGFVHIQIPERTCA
FT                   VTITINDDFNIDKDFLNKINRFLPKYNGMQFTGWTTSNVKASLVGMSEQVMVESGELIL
FT                   GLHQSIYMVEFNGPSTDRRIYLSHMGTTLAEGEEPRLPQVLEDLYAADLAKEQAEKEEQ
FT                   DRIIAEMRAEYAERIRKQKEEAARAAAESEQKDGE"
FT                   /protein_id="YP_003958618.1"
FT   gene            618954..619030
FT                   /db_xref="GeneID:9882540"
FT                   /locus_tag="ELI_0640"
FT   tRNA            618954..619030
FT                   /db_xref="GeneID:9882540"
FT                   /locus_tag="ELI_0640"
FT                   /product="tRNA-Pro"
FT   gene            complement(619032..619154)
FT                   /db_xref="GeneID:9882541"
FT                   /locus_tag="ELI_0641"
FT   CDS_pept        complement(619032..619154)
FT                   /locus_tag="ELI_0641"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826262"
FT                   /db_xref="GeneID:9882541"
FT                   /translation="MNHWGWPLPVSLFLFILYHISLNFSKNKKQPYPYMTDHLL"
FT                   /protein_id="YP_003958619.1"
FT   gene            complement(619495..620709)
FT                   /db_xref="GeneID:9882542"
FT                   /locus_tag="ELI_0642"
FT   CDS_pept        complement(619495..620709)
FT                   /locus_tag="ELI_0642"
FT                   /gene_family="HOG000072912" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826263"
FT                   /db_xref="GeneID:9882542"
FT                   /translation="MKIFDVIVLGGGPAGYTAALYCARANLKTMILEKMWPGGQMATTS
FT                   QVDNYPGFNEGIDGHELSERMKLGAERFGVVSEYGEVISIEATGQPKRIKTNSAEYECK
FT                   ALIIATGAAPRSLNLPHEEELRGRGVAYCATCDGLFFKNKVVAVVGGGNSAVADALYLS
FT                   KICKKVYLIHRRNRLNATKTYLALLDETENIEFIWNSQVVEPIYGDVLTGIKLENTETG
FT                   AVSQLDCDGLFIAIGRRPNTDLFEGIVDIDEAGYIIADETTQTNVEGVYAVGDVRTKPL
FT                   RQIITAASDGAVASKFIEDYFVQLCGRNHKAKSLRYKSEPNRFFVQTPENYEVGELNLE
FT                   PTTDNTFIITHVGVDNSYNGLGIAKELVRQTVEAARQNHWKLIPRCPFAKAEYDKHPEY
FT                   KDTLA"
FT                   /protein_id="YP_003958620.1"
FT   gene            620947..621882
FT                   /db_xref="GeneID:9882543"
FT                   /locus_tag="ELI_0643"
FT   CDS_pept        620947..621882
FT                   /locus_tag="ELI_0643"
FT                   /gene_family="HOG000072911" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826264"
FT                   /db_xref="GeneID:9882543"
FT                   /translation="MENNKFDVIILGGGPGGYTAALYCARAGLSTMVLEKMWPGGQMAT
FT                   TSRVDNYPGFEEGVDGIELSGKMQQSAERFGVVTQIGEVLSIDLESQPKVIRTGKGDLE
FT                   AKAVILATGAAPRTLGIPGEDELRGRGMAYCATCDGMFYRNRTVVVVGGGNSAVADALF
FT                   LAKICKKVYIVHRRDTLRASKTYMKTLEKTENIEFVWDSRVVEVLHDDLVTGVKVENVK
FT                   TGDVTELSCEGVFVAVGRTPNTDMFKGVLDLDGQGYLIADETTRTNIPGVFAVGDVRTK
FT                   PLRQIVTATADGAVASKYAEEYLAELCAGE"
FT                   /protein_id="YP_003958621.1"
FT   gene            621974..622255
FT                   /db_xref="GeneID:9882544"
FT                   /locus_tag="ELI_0644"
FT   CDS_pept        621974..622255
FT                   /locus_tag="ELI_0644"
FT                   /gene_family="HOG000167986" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:310826265"
FT                   /db_xref="GeneID:9882544"
FT                   /translation="MIEYKNGDNRIYAVTEDGTEVGQIEFVPTGESMFIISHTEVAEDM
FT                   GGLGIGKVLVEKAVQKARDEDKKIIPLCPFARAEFDKHPEYRELEANA"
FT                   /protein_id="YP_003958622.1"
FT   gene            622419..624