(data stored in SCRATCH zone)

HOGENOMDNA: FLAJ1_1

ID   FLAJ1_1; SV 1; empty ; DNA; empty ; PRO; 6096872 BP.
XX
AC   NC_009441;
XX
PR   Project: 58493;
XX
DE   Flavobacterium johnsoniae UW101, complete genome.
XX
OS   Flavobacterium johnsoniae UW101
OC   Bacteria; Bacteroidetes; Flavobacteria; Flavobacteriales;
OC   Flavobacteriaceae; Flavobacterium.
XX
RN   [1]
RP   1-6096872
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Pitluck,S., Goltsman,E., Singan,V.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N.,
RA   Xie,G., McBride,M. and Richardson,P.;
RT   "Complete sequence of Flavobacterium johnsoniae UW101";
RL   Unpublished
XX
RN   [2]
RP   1-6096872
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (08-MAY-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-6096872
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Pitluck,S., Goltsman,E., Singan,V.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N.,
RA   Xie,G., McBride,M. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (24-APR-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000685.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000268
CC   Source DNA available from Mark McBride (mcbride@uwm.edu)
CC   Bacteria available from ATCC: ATCC 17061
CC   Contacts: Mark McBride (mcbride@uwm.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..6096872
FT                   /strain="UW101; ATCC 17061"
FT                   /mol_type="genomic DNA"
FT                   /organism="Flavobacterium johnsoniae UW101"
FT                   /db_xref="ATCC:17061"
FT                   /db_xref="taxon:376686"
FT   gene            96..1145
FT                   /db_xref="GeneID:5091988"
FT                   /locus_tag="Fjoh_0001"
FT   CDS_pept        96..1145
FT                   /locus_tag="Fjoh_0001"
FT                   /gene_family="HOG000257443" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase, zinc-binding; bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="GI:146297767"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="GeneID:5091988"
FT                   /translation="MNKHEKYIKRCIELARNGFGTTYPNPMVGSVIVYEDTIIGEGWHK
FT                   KAGEPHAEVNAVRSVKDKSLLKKATIYVSLEPCSHFGKTPPCCDLIIANKIPNVVVGTV
FT                   DPNEKVAGRGIKKLIEAGANVVVGILEDECNELNKRFFTFHQKKRPYIILKWAESLDGF
FT                   LAPEKEIDQERKPVWITNQYSRQLVHKWRSEEQAILAGTQTVVDDNPKLNVRDWSGNNP
FT                   VRVILDQNNRISKDSFVFDESVKTIVFTKSENMISTENTIFEKIDFDKNSIENILAVLY
FT                   QHQIQSIIIEGGRQTLESFINENIWDEARIFIGKNTFKKGTKAPELQKQNAIKTYIQND
FT                   ELIYVRNHD"
FT                   /protein_id="YP_001192358.1"
FT   misc_feature    117..461
FT                   /note="Riboflavin-specific deaminase. Riboflavin
FT                   biosynthesis protein RibD
FT                   (Diaminohydroxyphosphoribosylaminopyrimidine deaminase)
FT                   catalyzes the deamination of
FT                   2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate,
FT                   which is an intermediate step in the...; Region:
FT                   Riboflavin_deaminase-reductase; cd01284"
FT                   /db_xref="CDD:29827"
FT                   /locus_tag="Fjoh_0001"
FT   misc_feature    order(246..254,324..329,354..356)
FT                   /note="catalytic motif; other site"
FT                   /db_xref="CDD:29827"
FT                   /locus_tag="Fjoh_0001"
FT   misc_feature    order(246..248,252..254,327..329,354..356)
FT                   /note="Zn binding site; other site"
FT                   /db_xref="CDD:29827"
FT                   /locus_tag="Fjoh_0001"
FT   misc_feature    534..>1037
FT                   /note="Dihydrofolate reductase (DHFR). Reduces
FT                   7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as
FT                   a cofactor. This is an essential step in the biosynthesis
FT                   of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate
FT                   is required to regenerate 5,10-...; Region: DHFR; cl00161"
FT                   /db_xref="CDD:174011"
FT                   /locus_tag="Fjoh_0001"
FT   gene            1138..1740
FT                   /db_xref="GeneID:5091158"
FT                   /locus_tag="Fjoh_0002"
FT   CDS_pept        1138..1740
FT                   /locus_tag="Fjoh_0002"
FT                   /gene_family="HOG000025211" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HAD family hydrolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="GI:146297768"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="GeneID:5091158"
FT                   /translation="MIDTIIFDFGDIFINLNKQGTISGLQKLGLKEWNAELDRLNLLFE
FT                   TGDISYDDFVSGFQEQLPNASIEEILEAWNAVLADFPSYRLDFVKELSKKYRLFLLSNT
FT                   DSIHIATFEKTVGVPFYTDFYNCFEKVHFSFEIGKRKPNANSYQHLIDEHNLVPEQTLF
FT                   VDDKKENTDAAAALGLHVWNLQVGQEDVVDLFTKGLL"
FT                   /protein_id="YP_001192359.1"
FT   misc_feature    <1270..1728
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Fjoh_0002"
FT   gene            1918..2550
FT                   /db_xref="GeneID:5091159"
FT                   /locus_tag="Fjoh_0003"
FT   CDS_pept        1918..2550
FT                   /locus_tag="Fjoh_0003"
FT                   /gene_family="HOG000075268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0029"
FT                   /db_xref="GI:146297769"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="GeneID:5091159"
FT                   /translation="MEYNDTYQTIARKSEEVLFKEKGSKFFGYAFPIENEEEVKPIIED
FT                   LRKLHPHAVHYCYAYQLGTAPKISYRANDDGEPSNTAGAPIYGQIQSFGVTNVLVVVVR
FT                   IFGGTKLGVGGLIAAYRTTAQMTLEVCEIVEKTIDVHFLISFDYKNMNKVMRVIKEKKL
FT                   EITSQEMEIDENSGLPIGKIITKTRKKNAEMIFDIFDLMFEIDVKII"
FT                   /protein_id="YP_001192360.1"
FT   misc_feature    1978..2304
FT                   /note="Uncharacterized protein family UPF0029; Region:
FT                   UPF0029; pfam01205"
FT                   /db_xref="CDD:144705"
FT                   /locus_tag="Fjoh_0003"
FT   gene            complement(2582..2986)
FT                   /db_xref="GeneID:5091160"
FT                   /locus_tag="Fjoh_0004"
FT   CDS_pept        complement(2582..2986)
FT                   /locus_tag="Fjoh_0004"
FT                   /gene_family="HOG000004132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="GI:146297770"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="GeneID:5091160"
FT                   /translation="MKKHQTQVRVRYSETDQMGVVYHGNYVPYFEIGRVEWLRNKGISY
FT                   KSMEESGIGLPIVSMQINYKKSARYDELLTIHTTFKSQSSVKIEFDCEIYNEANELLTT
FT                   AVFILVFISLKTGRPTAPPDYILELFKTME"
FT                   /protein_id="YP_001192361.1"
FT   misc_feature    complement(2648..2977)
FT                   /note="4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes
FT                   the final step in the 4-chlorobenzoate degradation pathway
FT                   in which 4-chlorobenzoate is converted to 4-hydroxybenzoate
FT                   in certain soil-dwelling bacteria. 4HBT forms a
FT                   homotetramer with four active...; Region: 4HBT; cd00586"
FT                   /db_xref="CDD:48031"
FT                   /locus_tag="Fjoh_0004"
FT   misc_feature    complement(order(2726..2737,2816..2818,2822..2824,
FT                   2894..2896))
FT                   /note="active site"
FT                   /db_xref="CDD:48031"
FT                   /locus_tag="Fjoh_0004"
FT   gene            3174..4601
FT                   /db_xref="GeneID:5091161"
FT                   /locus_tag="Fjoh_0005"