(data stored in ACNUC7421 zone)

EMBL: FM180568.ACCA

FM180568.ACCA        Location/Qualifiers
FT   CDS_pept        218622..219581
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="E2348C_0190"
FT                   /product="acetyl-CoA carboxylase, carboxytransferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07738"
FT                   /db_xref="GOA:B7UJ86"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJ86"
FT                   /protein_id="CAS07738.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLSVPTICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
     atgagtctga atttccttga ttttgaacag ccgattgcag agctggaagc gaaaatcgat        60
     tctctgactg cggttagccg tcaggatgag aaactggata ttaacatcga tgaagaagtg       120
     catcgtctgc gtgaaaaaag cgtagaactg acgcgtaaaa tcttcgccga tctcggtgca       180
     tggcagattg cgcaactggc acgccatcca cagcgtcctt ataccctgga ttacgttcgc       240
     ctggcatttg atgaatttga cgaactggct ggcgaccgcg cgtatgcaga cgataaagct       300
     atcgtcggtg gtatcgcccg tctcgatggt cgtccggtga tgatcattgg tcatcaaaaa       360
     ggtcgtgaaa ccaaagaaaa aattcgccgt aactttggta tgccagcgcc agaaggttac       420
     cgcaaagcac tgcgtctgat gcaaatggct gaacgtttta aaatgcctat catcaccttt       480
     atcgacaccc cgggggctta tccgggcgtg ggcgcagaag agcgcggtca gtctgaagcc       540
     attgcacgca acctgcgtga aatgtctcgc cttagcgtac cgactatttg taccgttatc       600
     ggtgaaggtg gttctggtgg tgcgctggcg attggcgtgg gcgataaagt gaatatgctg       660
     caatacagca cctattccgt tatctcgccg gaaggttgtg cgtccattct gtggaagagc       720
     gctgacaaag cgccgctggc ggctgaagcg atgggtatca tcgctccgcg tctgaaagag       780
     ctgaaactga tcgactccat catcccggaa ccgctgggcg gcgctcaccg taacccggaa       840
     gcgatggcgg catcgttgaa agcgcaactg ctggcggatc tggccgatct cgacgtgtta       900
     agcactgaag atttaaaaaa tcgtcgttat cagcgcctga tgagctacgg ttacgcgtaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page