(data stored in ACNUC7421 zone)

EMBL: FM180568.ACPH

FM180568.ACPH        Location/Qualifiers
FT   CDS_pept        complement(383380..383961)
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="E2348C_0339"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07887"
FT                   /db_xref="GOA:B7UJM7"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJM7"
FT                   /protein_id="CAS07887.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRNETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFTCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQSVLNGMASRRPRLDALRDSW
FT                   YDLDAHYDALETRFWQFYPRMMEQASRKAL"
     atgaattttt tagctcacct gcatttagcc catctcgcgg aaagctcgct ttccggcaat        60
     ttactggctg atttcgtacg cggaaatcct gaagaaagtt ttccgcccga cgtcgtggct       120
     ggtattcata tgcatcggcg aatcgacgta ttaaccgaca atctgccaga agtccgcgaa       180
     gcgcgggagt ggtttcgtaa tgaaacgcgc cgtgtcgcgc ctattacgct ggatgtgatg       240
     tgggatcact ttctgtcccg ccactggtcg cagctgtcgc ccgattttcc gctacaggaa       300
     tttacctgtt atgcccggga gcaagtgatg actattcttc cagactcacc gccacgcttt       360
     atcaatctga acaactactt atggtcagag cagtggttgg tgcgctatcg cgatatggat       420
     ttcatccaga gcgtgttaaa cggcatggca agccgtcgcc cacgtctgga tgccctgcgt       480
     gactcctggt acgatttaga cgcccattac gatgctctcg aaacccgctt ctggcagttt       540
     tatccgcgga tgatggagca ggcgtcacgc aaggcgttat aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page