(data stored in ACNUC7421 zone)

EMBL: FM180568.AHPC

FM180568.AHPC        Location/Qualifiers
FT   CDS_pept        569752..570315
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="E2348C_0508"
FT                   /product="alkyl hydroperoxide reductase, C22 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08056"
FT                   /db_xref="GOA:B7UKP9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKP9"
FT                   /protein_id="CAS08056.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
     atgtccttga ttaacaccaa aattaaacct tttaaaaacc aggcattcaa aaacggcgaa        60
     ttcatcgaaa tcaccgaaaa agataccgaa ggccgctgga gcgtcttctt cttctacccg       120
     gctgacttta ctttcgtatg cccgaccgaa ctgggtgacg ttgctgacca ttacgaagaa       180
     ctgcagaaac tgggcgtaga cgtatacgca gtatctaccg atacccactt cacccacaaa       240
     gcatggcaca gcagctctga aaccatcgct aaaatcaaat atgcgatgat cggcgacccg       300
     actggcgccc tgacccgtaa cttcgacaac atgcgtgaag atgaaggtct ggctgaccgt       360
     gcgaccttcg ttgttgaccc gcagggtatc atccaggcaa tcgaagttac cgctgaaggc       420
     attggccgtg acgcgtctga cctgctgcgt aaaatcaaag cagcacagta cgtagcttct       480
     cacccaggtg aagtttgccc ggctaaatgg aaagaaggtg aagcaactct ggctccgtct       540
     ctggacctgg ttggtaaaat ctaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page