(data stored in ACNUC7421 zone)

EMBL: FM180568.AHPF

FM180568.AHPF        Location/Qualifiers
FT   CDS_pept        570486..572051
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="E2348C_0509"
FT                   /product="alkyl hydroperoxide reductase, F52a subunit,
FT                   FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08057"
FT                   /db_xref="GOA:B7UKQ0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKQ0"
FT                   /protein_id="CAS08057.1"
FT                   /translation="MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAE
FT                   LSDKVTFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKE
FT                   AQSLLEQIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEI
FT                   TDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGP
FT                   AGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYD
FT                   VDVIDSQSASKLIPAAVEGGLHQIETTSGAVLKARSIIVATGAKWRNMNVPGEDQYRTK
FT                   GVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDK
FT                   LRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWL
FT                   EGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIR
FT                   TKTA"
     atgctcgaca caaatatgaa aactcaactc aaggcttacc ttgagaaatt gaccaagcct        60
     gttgagttaa ttgccacgct ggatgacagc gctaaatcgg cagaaatcaa ggaactgttg       120
     gctgaaatcg cagaactgtc agacaaagtc acctttaaag aagataacag cttgccggtg       180
     cgtaagccgt ctttcctgat caccaaccca ggttccaacc agggaccacg ttttgcaggc       240
     tccccgctgg gccacgagtt cacctcgctg gtactggcgt tgttgtggac cggtggtcat       300
     ccgtcgaaag aagcgcagtc tctgctggag cagattcgcc atattgacgg tgattttgaa       360
     ttcgaaacct attactcgct ctcttgccac aactgcccgg acgtggtgca ggcgctgaac       420
     ctgatgagcg tactgaaccc gcgcatcaag cacactgcaa ttgacggcgg caccttccag       480
     aacgaaatca ccgatcgcaa cgtgatgggc gttccggcag tgttcgtaaa cgggaaagag       540
     tttggtcagg gccgcatgac gttgactgaa atcgttgcca aaattgatac tggtgcggaa       600
     aaacgtgcgg cagaagagct gaataagcgt gatgcttatg acgtattaat cgttggttcc       660
     ggcccggcgg gtgcagcggc agcaatttac tccgcacgta aaggcatccg taccggtttg       720
     atgggcgaac gttttggtgg tcagatcctc gataccgttg atatcgaaaa ctacatttct       780
     gtaccgaaga ccgaaggcca gaaactggca ggtgcgctga aagttcatgt tgatgaatac       840
     gacgttgatg tgatcgacag ccagagcgcg agcaaactga tcccggcagc ggttgaaggc       900
     ggcttgcatc agattgaaac aacttctggc gcggtactga aagcacgcag cattatcgtg       960
     gcgactggtg caaaatggcg caacatgaac gttcctggcg aagatcagta tcgcaccaaa      1020
     ggcgtgacct attgcccgca ctgcgacggc ccgctgttta aaggcaaacg cgtagcggtt      1080
     atcggcggcg gtaactccgg cgtggaagcg gcaattgacc tggcgggtat cgttgagcac      1140
     gtaacgctgc tggaatttgc gccagaaatg aaagccgacc aggttctgca ggacaaactg      1200
     cgcagcctga aaaacgtcga cattattctg aatgcgcaaa ccacggaagt gaaaggcgac      1260
     ggtagcaaag tcgtaggtct ggaatatcgc gatcgtgtca gcggcgatat tcacaacatc      1320
     gaactggccg gtattttcgt ccagattggt ctgctgccga acaccaactg gctggaaggc      1380
     gcagtcgaac gtaatcgcat gggcgagatt atcattgatg cgaaatgcga aaccaacgtc      1440
     aaaggcgtgt tcgcagcggg tgactgtacg acggttccgt acaagcagat catcatcgcc      1500
     actggcgaag gtgccaaagc ctctctgagt gcttttgact acctgattcg caccaaaact      1560
     gcataa                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page