(data stored in ACNUC7421 zone)

EMBL: FM180568.AMPE

FM180568.AMPE        Location/Qualifiers
FT   CDS_pept        125280..126134
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="E2348C_0114"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07662"
FT                   /db_xref="GOA:B7UIF9"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIF9"
FT                   /protein_id="CAS07662.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRTLQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFHTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
     atgacgctat ttacaacctt actggtgtta attttcgagc gcctgtttaa gttgggcgag        60
     cactggcagc ttgatcatcg tcttgaagcg ttctttcggc gggtgaaaca tttttctctc       120
     gggcgcacat taggcatgac cattattgcg atgggcgtga cttttttact gttacgcaca       180
     ttgcagggag tattattcaa cgttcccacg ctgctggtgt ggctgctgat tggtttgctg       240
     tgtattggcg caggtaaagt tcgtcttcat tatcatgctt atctgacagc tgcttcacgt       300
     aatgatagcc atgcccgtgc cacgatggct ggcgaactca ccatgattca cggcgtcccg       360
     gcaggctgcg atgaacgtga gtatttgcgt gagctgcaaa atgcattgct gtggattaac       420
     tttcgttttt atcttgcacc gctgttctgg ctgattgtgg ggggaacctg gggacccgtt       480
     acgctgatgg ggtatgcgtt tttgcgtgca tggcaatact ggctggcgcg ttaccagacg       540
     ccgcatcatc gtttacagtc cggcattgat gccgtgcttc atgtactgga ttgggtgccg       600
     gttcgtcttg cgggtgtggt atatgccttg atcggtcatg gggagaaagc gttaccggcc       660
     tggtttgctt cgctgggtga tttccatact tcgcaatatc aggtattaac gcgtctggca       720
     cagttctctc tggcgcgtga accgcatgtc gataaggtgg agacgccgaa ggcagcggtt       780
     tccatggcga agaaaacctc gttcgtggtc gtggtggtaa ttgcgctact gacgatttac       840
     ggggcgttgg tgtaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page