(data stored in ACNUC7421 zone)

EMBL: FM180568.AROL

FM180568.AROL        Location/Qualifiers
FT   CDS_pept        365561..366085
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="E2348C_0324"
FT                   /product="shikimate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07872"
FT                   /db_xref="GOA:B7UJL2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJL2"
FT                   /protein_id="CAS07872.1"
FT                   /translation="MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTV
FT                   AEIVEREEWAGFRARETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPV
FT                   SVLVNRLQAAPEEDLRPTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISE
FT                   IRSALAQTINC"
     atgacacaac ctctttttct gatcgggcct cggggctgtg gtaaaacaac ggtcggaatg        60
     gcccttgccg attcgcttaa ccgtcggttt gtcgataccg accagtggtt gcaatcacag       120
     ctcaatatga cggtcgcgga gatcgtcgaa agggaagagt gggcgggatt ccgcgccaga       180
     gaaacggcgg cactggaagc ggtaactgcg ccatccaccg ttatcgccac gggcggcggc       240
     attattctga cggaatttaa tcgtcacttc atgcaaaata acgggatcgt ggtttatttg       300
     tgtgcgccag tatcagtcct ggttaaccga ctgcaagctg caccggaaga agatttacga       360
     ccaaccttaa cgggaaaacc actgagcgaa gaagttcagg aagtgctgga agaacgcgat       420
     gcgctatatc gcgaagttgc gcatattatc atcgacgcaa caaacgaacc cagccaggtg       480
     atttctgaaa ttcgcagcgc tctggcacag acgatcaatt gttga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page