(data stored in ACNUC7421 zone)

EMBL: FM180568.AROM

FM180568.AROM        Location/Qualifiers
FT   CDS_pept        366584..367261
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="E2348C_0326"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07874"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJL4"
FT                   /protein_id="CAS07874.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNQLAHVSRRKVERDLQGVVEVLDNQGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEELLTVQAQKWQILQKPPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFNQRHRDLLQKQLDVTVLLSNVLIARLAAE
FT                   LLV"
     atgagtgcgt cgttggcgat cctgactatc ggcattgtac ctatgcagga agttttgccg        60
     ctcctgacag aatacattga cgaagataat atttcccatc atagcctgct ggggaagtta       120
     agccgcgaag aagtgatggc ggagtacgcg ccagaagcag gcgaagacac aattctcaca       180
     ttattaaatg acaaccagct ggcccatgtt tcgcgtcgca aagtggagcg agacctgcaa       240
     ggtgtggttg aagtgctcga taatcagggt tacgacgtca ttatattaat gagtacagca       300
     aacattagta gtatgaccgc gcgtaatacg atctttcttg agccgtcgcg gatattgcca       360
     ccgctggttt cctctattgt tgaagatcat caggtggggg ttatcgtacc ggttgaggag       420
     ttgctgaccg ttcaggcgca aaaatggcaa attttgcaga aaccgccagt attttcattg       480
     ggtaacccca ttcatgattc ggaacaaaaa atcattgatg ccgggaaaga attactggca       540
     aaaggggctg atgtcatcat gctggattgt ttgggattta accagcgtca tcgcgattta       600
     ctgcaaaaac agctcgatgt tactgtcttg ctctctaacg tattgattgc acggctggct       660
     gcggaattac tggtgtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page