(data stored in ACNUC7421 zone)

EMBL: FM180568.AROP

FM180568.AROP        Location/Qualifiers
FT   CDS_pept        complement(126177..127550)
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="E2348C_0115"
FT                   /product="aromatic amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07663"
FT                   /db_xref="GOA:B7UIG0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIG0"
FT                   /protein_id="CAS07663.1"
FT                   /translation="MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VVAMIIFGGWLLFSGNGGPQATVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVS
FT                   ALVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPA
FT                   LLYPLGNWICLLFMAAVLVIMLMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH"
     atgatggaag gtcaacagca cggcgagcag ctaaagcgcg gccttaaaaa ccgccacata        60
     cagcttatcg cgctgggagg cgcgataggg acagggctat tcctgggtag cgcctccgta       120
     atacagtccg cagggccagg gattatcctg ggttacgcca ttgctggttt tatcgccttc       180
     ctgatcatgc gtcagctagg tgaaatggtg gtcgaagaac ctgtcgcagg ctcctttagc       240
     cactttgctt ataaatactg gggcagtttt gccggtttcg cctctggctg gaactactgg       300
     gtactgtacg ttttagttgc catggcagag ctgactgccg tgggtaaata cattcagttc       360
     tggtatccgg aaatcccaac ctgggtttct gccgccgtgt tctttgtggt gattaacgcc       420
     atcaacctga ccaacgttaa agtgtttggc gagatggagt tctggtttgc cattatcaaa       480
     gttatcgcgg tggtagcgat gatcatcttc ggcggctggc tgctattcag tggcaacggc       540
     ggcccgcagg cgaccgttag caacctgtgg gatcagggtg gtttcctgcc gcacggcttc       600
     accgggttgg tgatgatgat ggcgattatc atgttctctt tcggtggtct ggaactggtg       660
     ggcatcaccg cagcagaagc agataacccg gagcaaagta ttccaaaagc gactaaccag       720
     gttatctacc gcatcctgat tttctatatt ggttcgttag ccgttctgct ctcgctgatg       780
     ccgtggacac gcgttactgc tgataccagt ccgtttgtac tgatcttcca cgaattgggc       840
     gatacctttg tggctaatgc gctgaacatc gtggtactga ctgctgcgct ctccgtgtac       900
     aacagctgcg tatattgcaa cagccgtatg ctgtttggtc tggcacaaca gggcaacgcg       960
     ccaaaagcgc tggcgtctgt cgataaacgc ggcgtaccag tcaataccat tctggtatct      1020
     gcgctggtta cggcattgtg cgtactgatt aactaccttg caccggaatc cgcattcgga      1080
     ctgttaatgg cgctggtggt atctgcactg gtaatcaact gggcgatgat tagcctggcg      1140
     catatgaaat tccgtcgcgc caagcaggaa caaggcgtgg taactcgctt ccctgctctg      1200
     ctttatccgc tgggtaactg gatctgcctg ctgtttatgg cggcggtact ggtgattatg      1260
     ctgatgaccc caggaatggc gatttcggta tacctgatcc cggtatggct gatcgtgtta      1320
     ggtatcggct atctgtttaa agagaaaacc gccaaagccg taaaagcgca ttaa            1374
//

If you have problems or comments...

PBIL Back to PBIL home page