(data stored in ACNUC7421 zone)

EMBL: FM180568.BRNQ

FM180568.BRNQ        Location/Qualifiers
FT   CDS_pept        378634..379953
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="E2348C_0336"
FT                   /product="predicted branched chain amino acid transporter
FT                   (LIV-II)"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07884"
FT                   /db_xref="GOA:B7UJM4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJM4"
FT                   /protein_id="CAS07884.1"
FT                   /translation="MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSALPLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIIWPAGSISTATEAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQIS
FT                   VPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSW
FT                   AQRLPLAEQGLAWLMPTVVMVVLAIIWDRAAGRQVTSSAH"
     atgacccatc aattaagatc gcgcgatatc atcgctctgg gctttatgac atttgcgttg        60
     ttcgtcggcg caggtaacat tattttccct ccaatggtcg gcttgcaggc aggcgaacac       120
     gtctggactg cggcattcgg cttcctcatt actgccgttg gcctaccggt attaacggta       180
     gtggcgctgg caaaagttgg cggcggtgtt gacagtctca gcacgccaat tggtaaagtc       240
     gctggcgtac tgctggcaac agtttgttac ctggcggtgg ggccgctttt cgctacgccg       300
     cgtacagcta ccgtttcttt tgaagtgggc attgcgccgc tgacgggtga ttccgcgctg       360
     ccgctgttta tttacagcct ggtctatttc gctatcgtta ttctggtttc gctctatccg       420
     ggcaagctgc tggataccgt gggcaacttc cttgcgccgc tgaaaattat cgcactggtc       480
     atcctgtctg ttgccgcaat tatctggccg gcgggttcta tcagcacggc gactgaggct       540
     tatcaaaacg ctgcgttttc taacggcttc gtcaacggct atctgaccat ggatacgctg       600
     ggcgcaatgg tgtttggtat cgttattgtt aacgcggcgc gttctcgtgg cgttaccgaa       660
     gcgcgtctgc tgacccgtta taccgtctgg gctggcctga tggcgggtgt tggtctgact       720
     ctgctgtacc tggcgctgtt ccgtctgggt tcagacagcg cgtcgctggt cgatcagtct       780
     gcaaacggtg cggcgatcct gcatgcttac gttcagcata cctttggcgg cggcggtagc       840
     ttcctgctgg cggcgttaat cttcatcgcc tgcctggtca cggcggttgg cctgacctgt       900
     gcttgtgcag aattcttcgc ccagtacgta ccgctctctt atcgtacgct ggtgtttatc       960
     ctcggcggct tctcgatggt ggtgtctaac ctcggcttga gccagctgat tcagatctct      1020
     gtaccggtgc tgaccgccat ttatccgccg tgtatcgcac tggttgtatt aagttttaca      1080
     cgctcatggt ggcataattc gtcccgcgtg attgctccgc cgatgtttat cagcctgctt      1140
     tttggtattc tcgacgggat caaggcatct gcattcagcg atatcttacc gtcctgggcg      1200
     cagcgtttac cgctggccga acaaggtctg gcgtggttaa tgccaacagt ggtgatggtg      1260
     gttctggcca ttatctggga tcgcgcggca ggtcgtcagg tgacctccag cgctcactaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page