(data stored in ACNUC7421 zone)

EMBL: FM180568.BTUF

FM180568.BTUF        Location/Qualifiers
FT   CDS_pept        complement(188422..189222)
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="E2348C_0165"
FT                   /product="vitamin B12 transporter subunit:
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07713"
FT                   /db_xref="GOA:B7UIK5"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIK5"
FT                   /protein_id="CAS07713.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLYAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATSIEQIANALRQLAPWSPQPDKAEKAAQSLLDQYAQLKAQYADKSKKRVFLQFG
FT                   INPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIP
FT                   KIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
     atggctaagt cactgttcag ggcgctggtc gccctgtctt ttctcgcgcc gctgtggctc        60
     tatgccgcgc cgcgcgtcat cacgctttct cccgccaaca ctgaacttgc ctttgccgcc       120
     gggatcacgc cggttggggt cagcagctat tccgactatc ctccacaagc gcaaaagatt       180
     gagcaggttt ccacctggca ggggatgaat ctggaacgca ttgtggcgct gaaacccgat       240
     ctggtgattg cctggcgtgg aggtaatgcc gagcggcagg ttgaccagct ggcttcgctg       300
     ggaataaaag tgatgtgggt cgatgcgaca agcattgaac aaattgccaa tgcgttacgt       360
     caactggccc cctggagtcc gcaaccggat aaggccgaaa aagccgcgca atccctgctg       420
     gatcagtacg cgcaattgaa agcgcaatat gctgataaat ctaaaaaacg tgtttttctg       480
     caattcggca ttaatccgcc atttaccagt ggaaaagagt cgattcagaa ccaggtactc       540
     gaagtttgtg gcggagaaaa catctttaaa gacagccggg ttccctggcc gcaagttagc       600
     cgcgaacagg tgttagcacg ctcgccacag gcgattgtca ttacaggcgg accggaccaa       660
     attcctaaaa tcaaacaata ctggggtgaa cagctcaaaa ttcccgttat tcctctcacg       720
     agtgactggt ttgaacgtgc aagcccacgt attatcctcg ctgcacaaca gctctgtaat       780
     gcgctttcac aggtagatta a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page