(data stored in ACNUC7421 zone)

EMBL: FM180568.CARA

FM180568.CARA        Location/Qualifiers
FT   CDS_pept        32563..33711
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="E2348C_0032"
FT                   /product="carbamoyl phosphate synthetase small subunit,
FT                   glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07580"
FT                   /db_xref="GOA:B7UI77"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI77"
FT                   /protein_id="CAS07580.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEPYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIALIEQYRKTAK"
     ttgattaagt cagcgctatt ggttctggaa gacggaaccc agtttcacgg tcgggccata        60
     ggggcaacag gttcggcggt tggggaagtc gttttcaata cttcaatgac cggttatcaa       120
     gaaatcctca ctgatccttc ctattctcgt caaatcgtta ctcttactta tccccatatt       180
     ggcaatgtcg gcactaatga cgccgatgaa gaatcttctc aggtacatgc ccaaggtctg       240
     gtgattcgcg acctgccgct gattgccagc aacttccgta ataccgaaga cctctcttct       300
     tacctgaagc gccataacat cgtggcgatt gccgatatcg atacccgtaa gctgacgcgt       360
     ttactgcgcg agaaaggcgc acagaatggc tgcattattg cgggtgacaa cccggatgcg       420
     gcgctggcgt tagaaaaagc ccgcgcgttc cctggcctga atggcatgga tctggcaaaa       480
     gaagtgacta ccgcagaacc ctatagctgg acacaaggga gctggacgct gaccggcggc       540
     ctgccagaag cgaaaaaaga agacgagctg ccgttccacg tcgtggctta tgattttggt       600
     gccaagcgca acatcctgcg gatgctggtg gatagaggtt gtcgcctgac catcgttccg       660
     gcacaaactt ctgcggaaga tgtgctgaaa atgaatccgg acggcatctt cctctccaac       720
     ggtcctggcg acccggcccc gtgcgattac gccattaccg ccatccagaa attcctcgaa       780
     accgatattc cggtattcgg catctgcctc ggtcatcagc tgctggcgct ggcgagcggt       840
     gcgaagactg taaaaatgaa atttggtcac cacggcggca accatccggt taaagatgtt       900
     gagaaaaatg tggtgatgat taccgcccag aaccacggtt ttgcggtgga tgaagcaaca       960
     ttacctgcaa acctgcgtgt cacacataaa tccctgttcg acggtacgtt acagggcatt      1020
     catcgtaccg ataaaccggc gttcagcttc cagggacacc cggaagccag ccctggtcca      1080
     cacgacgccg cgccgttgtt tgaccacttt atcgcgttaa ttgagcagta ccgtaaaacc      1140
     gctaagtaa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page