(data stored in ACNUC7421 zone)

EMBL: FM180568.CARB

FM180568.CARB        Location/Qualifiers
FT   CDS_pept        33729..36950
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="E2348C_0033"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07581"
FT                   /db_xref="GOA:B7UI78"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI78"
FT                   /protein_id="CAS07581.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHSMEEALAVAAEVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANAT
FT                   VTTIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
     atgccaaaac gtacagatat aaaaagtatc ctgattctgg gtgcgggccc gattgttatc        60
     ggtcaggcgt gtgagtttga ctactctggc gcgcaagcgt gtaaagccct gcgtgaagag       120
     ggctaccgcg tcattctggt gaactccaac ccggcgacta tcatgaccga cccggaaatg       180
     gctgatgcaa cctacatcga gccgattcac tgggaagtgg tacgcaaaat tattgaaaaa       240
     gagcgcccgg acgcggtgct gccaaccatg ggggggcaga cggcgctgaa ctgtgcgctg       300
     gagcttgagc gtcagggcgt gctggaagag ttcggcgtca ccatgattgg tgccactgcc       360
     gatgcgattg ataaagccga agaccgccgc cgtttcgacg tagcgatgaa gaaaatcggt       420
     ctggaaactg cgcgttccgg tatcgctcat tcaatggaag aagcgctggc ggttgccgct       480
     gaagttggct tcccgtgcat tattcgccca tcctttacca tgggtggtag cggcggcggt       540
     atcgcttata accgcgaaga gtttgaagaa atttgcgccc gcggtctgga tctctctccg       600
     actaaagagc tgctgattga tgagtcgctg atcggctgga aagagtacga gatggaagtg       660
     gtgcgtgata aaaacgacaa ctgcatcatc gtctgctcta tcgaaaactt cgatgcgatg       720
     ggcatccata ccggtgactc catcactgtc gcgccagccc aaacgctgac cgacaaagaa       780
     tatcaaatca tgcgtaacgc ctcgatggcg gtactgcgtg aaatcggcgt tgaaaccggt       840
     ggttccaacg tccagtttgc ggtgaacccg aaaaacggtc gcctgattgt tatcgaaatg       900
     aacccgcgcg tgtctcgctc ctctgcgctg gcgtcgaaag ccactggttt cccgattgcc       960
     aaagtggcgg cgaaactggc ggtgggttac accctcgacg agctgatgaa cgacatcacc      1020
     ggtgggcgta ctccggcctc cttcgagccg tccatcgact atgtggttac taaaattcct      1080
     cgcttcaact tcgagaaatt cgccggtgct aacgaccgtc tgaccactca gatgaaatcg      1140
     gttggcgaag tgatggcgat tggtcgcacg cagcaggaat ccctgcaaaa agcgctgcgc      1200
     ggcctggaag tgggcgcaac tggcttcgat ccgaaagtga gtctcgacga cccggaagcg      1260
     ctgactaaaa tccgccgcga actgaaagat gctggcgcag agcgtatctg gtatatcgct      1320
     gatgccttcc gcgcgggcct gtctgtagac ggcgtgttta atttgaccaa cattgaccgc      1380
     tggttcctgg tacagattga agagctggtg cgtctggaag agaaagtcgc agaagtgggc      1440
     atcactggcc tgaacgctga attcctgcgc cagctgaaac gcaaaggctt tgccgatgcg      1500
     cgtctggcaa aactcgcggg cgtgcgtgaa gcagagatcc gcaagctgcg cgaccagtat      1560
     gatctgcacc cggtttataa gcgcgtggat acctgtgcgg cagagttcgc caccgacacc      1620
     gcttacatgt actccactta tgaagaagag tgcgaagcga atccgtctac cgaccgtgaa      1680
     aaaatcatgg tgctcggcgg cggcccgaac cgtatcggtc agggtatcga attcgactac      1740
     tgctgtgtac acgcctcgct ggcgctgcgc gaagatggtt atgaaaccat tatggttaac      1800
     tgtaacccgg aaaccgtctc caccgactac gacacctccg accgcctcta cttcgagccg      1860
     gtaactctgg aagacgtgct ggaaattgtg cgtattgaga agccgaaagg tgttatcgtc      1920
     cagtacggcg gtcagacccc gctgaaactg gcgcgcgcgc tggaagctgc tggcgtaccg      1980
     gttatcggta ccagcccgga tgccatcgac cgtgcggaag accgtgaacg cttccagcat      2040
     gcggttgagc gtctgaaact gaaacaaccg gcgaacgcca ccgttaccac catcgaaatg      2100
     gcggttgaga aagcgaaaga gattggctac ccgctggtgg tgcgtccgtc ttacgttctc      2160
     ggcggtcggg cgatggaaat cgtctatgac gaagctgacc tgcgtcgcta cttccagaca      2220
     gcggtcagcg tatctaacga tgcgccagtg ttgctggacc acttccttga tgacgcagta      2280
     gaagttgacg tggatgccat ctgcgacggc gaaatggtgc tgattggcgg catcatggag      2340
     catattgagc aggcgggcgt gcactccggt gactccgcat gttcgctgcc agcctacacc      2400
     ttaagtcagg aaattcagga tgtgatgcgc cagcaggtgc agaaactggc cttcgaattg      2460
     caggtacgcg gcctgatgaa cgtgcagttt gcggtgaaaa acaacgaagt ctacctgatt      2520
     gaagttaacc cgcgtgcggc gcgtaccgtt ccgttcgtct ccaaagccac cggcgtaccg      2580
     ctggcaaaag tggcggcgcg tgtgatggct ggcaaatcgc tggctgagca gggcgtaacc      2640
     aaagaagtta tcccgccgta ctactcggtg aaagaagtgg tgctgccgtt caataaattc      2700
     ccgggcgttg acccgctgtt agggccagaa atgcgatcta ccggggaagt aatgggcgtg      2760
     ggccgcacct tcgctgaagc gtttgccaaa gcgcagctgg gcagcaactc caccatgaag      2820
     aaacacggtc gtgcgctgct ttccgtgcgc gaaggcgata aagaacgcgt ggtggacctg      2880
     gcggcaaaac tgctgaaaca gggcttcgag ctggatgcga ctcacggcac ggcgattgtg      2940
     ctgggcgaag cgggtatcaa tccgcgtctg gtgaacaagg tgcatgaagg ccgtccgcac      3000
     attcaggacc gtattaagaa tggcgaatat acctacatca tcaacaccac ctcaggtcgt      3060
     cgtgcgattg aagactcccg cgtgatccgt cgcagtgcgc tgcaatataa agtgcattac      3120
     gacaccaccc tgaacggcgg ctttgccacc gcgatggcgc tgaatgccga tgcgaccgaa      3180
     aaagtaattt cggtgcagga aatgcacgcg cagatcaaat aa                         3222
//

If you have problems or comments...

PBIL Back to PBIL home page