(data stored in ACNUC7421 zone)

EMBL: FM180568.CITA

FM180568.CITA        Location/Qualifiers
FT   CDS_pept        581633..583291
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="E2348C_0520"
FT                   /product="sensory histidine kinase CitA in two-component
FT                   regulatory system with CitB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08068"
FT                   /db_xref="GOA:B7UKR1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKR1"
FT                   /protein_id="CAS08068.1"
FT                   /translation="MLQLNENKQFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASF
FT                   EDYLTLHVRDMAMNQAKIIASNDSIISAVKTRDYKRLATIADKLQRDTDFDYVVIGDRH
FT                   SIRLYHPNPEKIGYPMQFTKPGALEKGESYFITGKGSIGMAMRAKTPIFDDDGKVIGVV
FT                   SIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVR
FT                   QQEALFSSVYEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIAEVVRPADFFTE
FT                   QIDEKRQDVVANFNGLSVIANREAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVE
FT                   SLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGESQAQQQLIDSLREAFADRQVAGLL
FT                   FGKVQRARELGLKMVIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRSDEGNKIV
FT                   ELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRC
FT                   GGVITLEDNDPCGTLFSIYIPKVKPNDSSINPIDR"
     atgttgcagc ttaacgagaa taaacagttt gcatttttcc aaagactggc atttccgctg        60
     cgtatctttt tgctgattct ggtgttctca atatttgtca ttgcagccct ggcgcaatat       120
     tttacagcca gttttgagga ctatttaacg cttcatgtgc gcgacatggc aatgaatcag       180
     gcaaaaatta ttgcttctaa tgacagtatc atcagtgcag tgaaaacgcg tgactacaag       240
     aggctggcga ccatcgctga caaattacaa agagatactg atttcgatta tgtggtgatt       300
     ggcgatcggc actcgattcg tctttaccat cctaatccgg agaaaattgg ttatcctatg       360
     cagttcacca aaccgggcgc gctggagaaa ggggagagct acttcatcac cgggaaaggg       420
     tcaattggca tggcgatgcg tgccaaaacg ccaatctttg atgacgatgg aaaagtcatc       480
     ggcgtggtgt cgattggcta cctggtgagt aaaatcgata gctggcgggc tgagttttta       540
     ttaccgatgg caggcgtgtt tgtcgtgctg ttagggattt tgatgttgct gtcgtggttc       600
     ctggccgcgc atatccgtcg gcagatgatg ggcatggagc caaagcaaat cgctcgcgtg       660
     gtccgtcagc aagaggcgct gtttagttcg gtttatgaag ggctgattgc ggtggatccg       720
     cacgggtaca ttaccgccat caatcgtaac gcaagaaaga tgctggggct gagctccccc       780
     ggacggcaat ggttgggtaa acccattgct gaagtggtca ggcccgccga tttctttacc       840
     gaacagattg atgaaaaacg tcaggatgtg gtggcgaact ttaacggtct gagcgttatt       900
     gccaaccggg aagctattcg ttctggcgat gatttactgg gggccattat tagctttcgt       960
     agtaaagacg aaatttccac cctcaatgcg caactgacgc aaattaaaca atacgtcgag      1020
     agccttcgta cattgcgaca cgagcatctc aattggatgt cgacgctcaa tggtctgttg      1080
     cagatgaaag agtatgatcg cgtgctggcg atggtgcagg gggagtctca ggcccagcaa      1140
     cagcttattg acagcctgcg tgaggcgttt gccgatcgcc aggtggcggg gctgcttttt      1200
     ggtaaagtgc agcgcgcccg cgaactgggg ctaaaaatgg tcatcgtccc cggtagccag      1260
     ctttcgcagc tgccgccagg actggacagc accgagtttg cagccattgt tggcaattta      1320
     cttgataacg ccttcgaagc aagcctgcgt agcgatgaag gaaacaagat cgttgaatta      1380
     ttcctcagcg atgaaggcga tgatgtggtg attgaagtcg ccgatcaggg ctgcggcgtt      1440
     ccagagtctc tacgagacaa aatatttgag cagggtgtca gtacgcgtgc tgacgagccc      1500
     ggtgaacatg gcattgggtt gtacttgatt gccagctacg taacgcgctg cggtggtgtt      1560
     atcactctcg aagataatga tccctgcggt accttatttt caatctatat tccgaaagtg      1620
     aaacctaatg acagctccat taaccctatt gatcgttga                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page