(data stored in ACNUC7421 zone)

EMBL: FM180568.CITE

FM180568.CITE        Location/Qualifiers
FT   CDS_pept        complement(578979..579887)
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="E2348C_0517"
FT                   /product="citrate lyase, citryl-ACP lyase (beta) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08065"
FT                   /db_xref="GOA:B7UKQ8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKQ8"
FT                   /protein_id="CAS08065.1"
FT                   /translation="MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLED
FT                   SVALREKDTARRMVYHALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPK
FT                   TDTAQDVLDIEKEILRIEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALG
FT                   AEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIK
FT                   QLGFDGKSLINPRQIDLLHNLYAPTQKEVDHARRVVEAAEAAAREGLGVVSLNGKMVDG
FT                   PVIDRARLVLSRAELSGIREE"
     atgatttccg cttcgctgca acaacgtaaa actcgcaccc gccgcagcat gctgtttgtg        60
     ccaggtgcca atgccgcgat ggtcagcaac tcattcatct acccggctga tgccctgatg       120
     tttgacctcg aagactccgt ggcattgcgt gaaaaagaca ccgcccgccg catggtttac       180
     cacgcgctgc aacatccgct gtatcgcgat attgaaacca ttgtgcgtgt aaacgcgctg       240
     gattccgaat ggggtgttaa cgacctggaa gccgtcgttc gcggtggtgc ggacgttgtg       300
     cgtctgccga aaaccgatac cgctcaggat gttctggata tcgaaaaaga gatcctgcgc       360
     atcgaaaaag cctgtggtcg tgaacccggc agcaccggcc tgctggcggc gattgaatct       420
     ccgctgggca ttacccgcgc ggtagaaatc gctcacgctt ccgagcgttt gatcggtatc       480
     gccctcggtg cagaagacta tgtgcgcaac ctgcgtacag aacgctcccc ggaaggaact       540
     gaactgctgt tcgctcgctg ctccattttg caggccgcgc gttctgcggg tattcaggcg       600
     ttcgataccg tctattccga cgctaacaac gaagccggat tcctgcaaga agccgcccac       660
     atcaaacagc tgggctttga cggcaaatcg ctgatcaacc cgcgtcagat tgatctgctg       720
     cacaacctct acgcaccgac ccagaaagaa gtggatcacg cccgccgcgt cgtagaagcc       780
     gctgaagccg ccgctcgcga aggcctcggc gtggtttccc tgaacggcaa gatggtggac       840
     ggtccggtta tcgatcgcgc ccgtctggtg ctctcccgtg cagaactttc cggcatccgc       900
     gaagaataa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page