(data stored in ACNUC7421 zone)

EMBL: FM180568.CITF

FM180568.CITF        Location/Qualifiers
FT   CDS_pept        complement(577436..578968)
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="E2348C_0516"
FT                   /product="citrate lyase, citrate-ACP transferase (alpha)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08064"
FT                   /db_xref="GOA:B7UKQ7"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKQ7"
FT                   /protein_id="CAS08064.1"
FT                   /translation="MTQKIEQSQRQERVAAWNRRAECDLAAFQNSPKQTYQAEKARDRK
FT                   LCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH
FT                   APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVA
FT                   FLGVPSCDEFGNANGYSGKACCGSLGYAMVDADNAKQVVMLTEELLPYPHNPASIEQDQ
FT                   VDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGA
FT                   SLAVTRFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARN
FT                   PNHIEISANQYANWGSKGAAVDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCD
FT                   TAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQ
FT                   EAGIKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQVKE"
     atgacgcaga aaattgaaca atctcaacga caagaacggg tagcggcctg gaatcgtcgc        60
     gctgaatgcg atcttgccgc tttccagaac tcgccaaagc aaacctacca ggctgaaaaa       120
     gcgcgcgatc gcaaactgtg cgccaacctg gaagaagcga ttcgtcgctc tggtttacag       180
     gacggcatga cggtttcctt ccatcacgct ttccgtggcg gtgacctgac cgtcaatatg       240
     gtgatggacg tcatcgcgaa gatgggcttt aaaaacctga ctctggcctc cagctccctg       300
     agtgattgcc atgcgccgct ggtagaacac attcgccagg gcgtggttac ccgcatttat       360
     acctctggcc tgcgcggtcc actggcggaa gaaatctccc gtggtctgct ggcggaaccg       420
     gtgcaaatcc actctcacgg cggacgtgtg catctggtac agagcggcga actgaatatc       480
     gatgtggctt tcctcggcgt cccgtcctgt gatgaattcg gtaatgccaa cggctactcc       540
     ggtaaagcct gctgcggctc cctcggctat gcaatggttg atgccgacaa cgcaaaacag       600
     gtcgtgatgc ttaccgaaga actgctgcct tatccgcata atccggcaag cattgagcaa       660
     gatcaggttg atctgatcgt caaagttgat cgcgttggcg atgctgcaaa aatcggcgct       720
     ggtgctaccc gtatgaccac taacccgcgc gaactgctta ttgcccgtag cgctgcggat       780
     gtgattgtta actctggcta cttcaaagaa ggtttctcca tgcagaccgg caccggcggc       840
     gcttcgctgg cggtaacccg tttcctggaa gacaaaatgc gtagccgcga tattcgcgcc       900
     gacttcgccc tcggcggtat taccgcaacg atggttgatc tgcacgaaaa aggtttgatc       960
     cgcaaactgc tggatgtgca gagctttgac agccatgctg cgcaatcgct ggcccgtaac      1020
     cccaatcaca tcgaaatcag cgccaaccag tacgctaact gggggtcgaa aggcgcagcg      1080
     gttgatcgtc tcgacgtggt ggtactgagc gcgctggaaa ttgacaccca gttcaacgtt      1140
     aacgtgctga ccggctctga cggcgtactg cgtggtgctt ccggtggtca ctgcgatacc      1200
     gcgattgcct ctgcgctttc catcatcgtc gcgccgctgg tacgcggtcg tattccgacg      1260
     ctggtggata acgtgctgac ctgcatcacc ccgggctcca gtgtcgatat tctggtcaca      1320
     gaccacggca tcgctgttaa cccggcacgt ccggagctgg cagaacgtct gcaggaagcg      1380
     gggatcaaag tggtttctat tgagtggctg cgtgaacgtg cgcgtctgct gaccggtgaa      1440
     ccacagccga ttgaattcac cgaccgcgtc gttgccgttg tgcgttaccg cgatggctcg      1500
     gtgatcgatg ttgtgcatca ggtgaaggaa taa                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page