(data stored in ACNUC7421 zone)

EMBL: FM180568.CLPX

FM180568.CLPX        Location/Qualifiers
FT   CDS_pept        416330..417604
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="E2348C_0373"
FT                   /product="ATPase and specificity subunit of ClpX-ClpP
FT                   ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07921"
FT                   /db_xref="GOA:B7UJR1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJR1"
FT                   /protein_id="CAS07921.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIDGQSKPLLIYGKPEAQQASGE"
     atgacagata aacgcaaaga tggctcaggc aaattgctgt attgctcttt ttgcggcaaa        60
     agccagcatg aagtgcgcaa gctgattgcc ggtccatccg tgtatatctg cgacgaatgt       120
     gttgatttat gtaacgacat cattcgcgaa gagattaaag aagttgcacc gcatcgtgaa       180
     cgcagtgcgc taccgacgcc gcatgaaatt cgcaaccacc tggacgatta cgttatcggt       240
     caggaacagg cgaaaaaagt gctggcggtc gcggtataca accactacaa acgtctgcgc       300
     aacggagata ccagcaatgg cgtcgagttg ggcaaaagta acattctgct gatcggtccg       360
     accggttccg gtaaaacgct gctggccgaa acgctggcgc gcctgctgga cgttccgttc       420
     accatggctg acgcaaccac gctgaccgaa gccggttatg tgggcgaaga cgttgaaaac       480
     atcattcaga agctgttgca gaagtgcgat tacgacgtac agaaagcgca gcgcgggatt       540
     gtctacatcg atgaaatcga caagatttct cgtaagtcag acaacccgtc cattacccga       600
     gacgtttccg gtgaaggcgt acagcaggca ctgttgaaac tgatcgaagg tacggtagct       660
     gctgttccgc cgcaaggtgg gcgtaaacat ccgcaacagg aattcttgca ggttgatacc       720
     tctaagatcc tgtttatctg tggcggtgcg tttgccggtc tggataaagt gatttcccat       780
     cgtgtagaaa ccggttccgg cattggtttt ggcgcgacgg taaaagcgaa gtccgacaaa       840
     gcaagcgaag gcgagctgct ggcgcaggtt gaaccggaag atctgatcaa gtttggtctg       900
     atccctgagt tcattggtcg tctgccggtt gtcgcaacgt tgaatgaact gagcgaagaa       960
     gctctgattc agatcctcaa agagccgaaa aacgccctga ccaagcagta tcaggcgctg      1020
     tttaatctgg aaggcgtgga tctggaattc cgtgacgagg cgctggatgc tatcgctaag      1080
     aaagcgatgg cgcgtaaaac cggtgcccgt ggcctgcgtt ctatcgtaga agccgcactg      1140
     ctcgatacca tgtacgatct gccgtccatg gaagatgtcg aaaaagtggt tatcgacgag      1200
     tcggtaattg atggtcaaag caaaccgttg ctgatttatg gtaagccgga agcgcaacag      1260
     gcatctggtg aataa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page