(data stored in ACNUC7421 zone)

EMBL: FM180568.CRCB

FM180568.CRCB        Location/Qualifiers
FT   CDS_pept        complement(586941..587324)
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="E2348C_0525"
FT                   /product="predicted inner membrane protein associated with
FT                   chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08073"
FT                   /db_xref="GOA:B7UKR6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKR6"
FT                   /protein_id="CAS08073.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     gtgttacaac ttcttttagc agtttttatc ggcggtggta cgggaagcgt ggcgagatgg        60
     ctgttaagta tgcgatttaa cccgctgcat caggcgattc cgttggggac gctggcagca       120
     aacctgattg gggcattcat cataggaatg ggattcgcct ggttcagcag gatgacgaac       180
     attgatccag tgtggaaagt attaatcacc accggatttt gtggcggtct aacaaccttc       240
     tcaacatttt cggcagaagt ggtgtttttg ttacaagagg gccgctttgg ctgggcgtta       300
     ctgaacgttt tcgtcaatct tttggggtct tttgccatga ccgcactggc tttctggctg       360
     ttttcggcct caaccgcaca ctaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page