(data stored in ACNUC7421 zone)

EMBL: FM180568.CSTA

FM180568.CSTA        Location/Qualifiers
FT   CDS_pept        560775..562880
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="E2348C_0500"
FT                   /product="carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08048"
FT                   /db_xref="GOA:B7UKP1"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKP1"
FT                   /protein_id="CAS08048.1"
FT                   /translation="MNKSGKYLVWTVLSVMGAFALGYIALNRGEQINALWIVVASVCIY
FT                   LIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLALFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAESPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFAITPDTLNQIASEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKVGFLAIANKFQAMIDSGNIPSQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALVALKEPKPTAKETPYEPMPENVEEIV
FT                   AQAKGAH"
     atgaacaaat cagggaaata cctcgtctgg acagtgctct ctgtaatggg agcatttgct        60
     ctgggataca ttgctttaaa tcgtggggaa cagatcaacg cgctgtggat tgtggtggcg       120
     tcggtctgta tctatctgat cgcttaccgt ttttatgggc tgtatatcgc caaaaatgtg       180
     ctggcggttg acccgacgcg tatgacgcca gcggtgcgcc ataacgacgg gctggactat       240
     gtgccgacgg acaaaaaagt gctgttcggt caccattttg cggccattgc cggagcaggt       300
     ccgttggttg ggccggtact ggcggcgcaa atgggctacc tgccggggat gatctggctg       360
     ctcgccgggg tggttctcgc cggtgcggtg caggatttca tggtgctgtt tgtttctacg       420
     cgccgtgacg gtcgctcgct gggtgagctg gtcaaagaag agatggggcc aaccgccggg       480
     gtgattgcgc tggtggcctg ctttatgatc atggtcatta tccttgccgt gctggcgatg       540
     atcgtggtga aagccctgac tcatagcccg tggggaacgt ataccgttgc gttcactatt       600
     ccgctggcgc tgtttatggg gatctatctg cgctatctgc gtccggggcg tattggcgaa       660
     gtgtcggtca tcggcctggt gttccttatt ttcgccatta tctctggcgg ctgggtggca       720
     gaaagtccga cctgggcacc gtactttgac tttaccggcg tgcagctgac ctggatgctg       780
     gtgggttacg gttttgtggc ggcggtgctg ccagtgtggc tgttgctggc cccgcgcgac       840
     tacctctcaa ccttcctgaa aatcgggact atcgtcggtc tggcggtggg cattttgatt       900
     atgcgcccga cgctgaccat gcctgcgcta actaaatttg tcgatggcac tggcccggta       960
     tggaccggta acctgttccc gttcctgttt atcaccatcg cctgtggcgc ggtgtctggc      1020
     ttccatgcac tgatctcttc cggcactaca ccgaagatgc tggcgaacga agggcaggcg      1080
     tgctttatcg gctacggtgg gatgttgatg gaatccttcg tggcgattat ggcgctggtt      1140
     tccgcctgta tcatcgatcc gggtgtgtac ttcgccatga acagcccgat ggcggtgctg      1200
     gctccggcag ggacggcgga tgtggttgct tctgccgcgc aggtggtgag tagctggggc      1260
     tttgcgatta ccccggatac gctaaaccag attgccagcg aagtgggtga acagtcgatc      1320
     atttctcgtg cgggcggtgc gccgaccctg gcggtgggga tggcctacat tctgcacggt      1380
     gcgctgggcg gcatgatgga tgtggcgttc tggtatcact tcgccattct gtttgaagca      1440
     ctgtttattc tgacggcggt ggatgcgggt acgcgtgctg cgcgctttat gttgcaggat      1500
     ctgctgggcg tggtgtctcc gggcctgaaa cggaccgatt cactgcctgc taacctgctg      1560
     gcaacggcgc tgtgcgtgct ggcgtggggc tacttcctgc atcagggcgt ggtcgatccg      1620
     ctgggcggta ttaacacctt gtggccgctg tttggtattg ccaaccagat gctggcaggg      1680
     atggcgctga tgctctgtgc tgtggtgctg ttcaaaatga aacgtcaacg ttacgcctgg      1740
     gtggcgctgg taccaacggc ctggctgctg atttgtaccc tgaccgcagg ctggcagaaa      1800
     gcgtttagcc cggatgcgaa agtcggcttc ctggcgattg ctaacaagtt ccaggcaatg      1860
     atcgacagcg gcaatattcc gtcgcagtat actgagtcac aactggcgca actggtgttc      1920
     aacaaccgtc tggatgccgg attaaccatc ttctttatgg tggttgtggt ggttctggcg      1980
     ctgttctcga ttaagacggc actggtggca ttgaaagagc cgaagccaac ggcgaaagaa      2040
     acgccatatg agccgatgcc ggaaaatgtc gaggagatcg tggcgcaggc gaaaggcgcg      2100
     cactaa                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page