(data stored in ACNUC7421 zone)

EMBL: FM180568.CUSF

FM180568.CUSF        Location/Qualifiers
FT   CDS_pept        529464..529796
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="E2348C_0473"
FT                   /product="periplasmic copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08021"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKL5"
FT                   /protein_id="CAS08021.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVK
FT                   GVDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     atgaaaaaag cactgcaagt cgcaatgttt agtctgttta ccgttattgg ctttaatgcc        60
     caggctaacg aacatcatca tgaaaccatg agcgaagcac aaccacaggt tattagcgcc       120
     actggcgtgg taaaaggtgt tgatctggaa agcaaaaaaa tcaccatcca tcacgatccg       180
     attgctgccg tgaactggcc ggagatgact atgcgcttta ccatcacccc gcagacgaaa       240
     atgagcgaaa ttaaaaccgg cgataaagta gcgtttaatt ttgtccaaca gggcaacctt       300
     tctttattac aggatattaa agtcagccag taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page