(data stored in ACNUC7421 zone)

EMBL: FM180568.CUSS

FM180568.CUSS        Location/Qualifiers
FT   CDS_pept        complement(525786..527228)
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="E2348C_0470"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CusR, senses copper ions"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08018"
FT                   /db_xref="GOA:B7UKL2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKL2"
FT                   /protein_id="CAS08018.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGA
FT                   PDIREFARDAIPDKDTRGGEVYLLSGPTIMMPGHGHGHMEHSNWRMISLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVHYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELRFVGDECQVAGDPLMLRRALSNLLSNALRYTPTGETIVV
FT                   RCQTVDHLVQVTVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSDARGTRFVIILPA"
     atggtcagta agccatttca gcgcccgttt tcgctggcaa cacgcctgac cttttttatc        60
     agcctggcca ccatcgcggc gtttttcgcc tttgcatgga tcatgatcca ctcagtaaaa       120
     gtgcattttg ccgagcagga tattaatgat ttaaaagaga ttagcgccac ccttgaacgg       180
     gtacttaatc accctgacga aacgcaagcc cgacgcttaa tgacgctgga agatatcgtc       240
     agtggttatt ccaacgtgtt gatttccctg gcagatagcc acggcaaaac ggtgtatcac       300
     tcccccggtg cgcctgatat ccgcgagttt gcacgtgatg ccatacccga taaagacacg       360
     cggggcggcg aggtgtatct cctttccggc ccgacgatta tgatgccggg ccacggtcac       420
     gggcatatgg aacacagcaa ctggcggatg attagcttgc cggttggccc actggtggac       480
     ggcaaaccga tttatacgct ctacattgcg ctttcgatcg attttcatct tcattacatc       540
     aatgatttga tgaataaact tattatgacc gcatcggtaa tcagcatcct gatcgtcttt       600
     atcgtgctgt tggcggtaca taaaggtcac gcgccgatcc gcagcgtcag ccgtcaaatc       660
     cagaacatta cctcgaaaga tctcgacgtt cgccttgacc cgcagaccgt gccgattgag       720
     ctggaacagc tggtactgtc gttcaaccat atgatcgagc gtattgagga tgtctttacc       780
     cgccagtcca atttctcagc ggatatcgcc cacgaaattc gcacacctat tactaatctc       840
     attacgcaaa cggaaatcgc cctcagccag tcgcgcagcc agaaagagct ggaagatgtg       900
     cactactcta atctcgaaga actgacgcga atggcgaaaa tggtcagcga tatgctgttt       960
     ctcgctcagg ccgataacaa ccagctaatc cccgaaaaga aaatgctcaa cctggcggat      1020
     gaagtcggca aagtgttcga ttttttcgag gcgttagcag aagatcgcgg cgtggagctg      1080
     cggtttgttg gcgacgagtg tcaggttgcg ggcgatccgc tgatgctgcg tcgggcgtta      1140
     agcaacctgc tttctaatgc cctgcgttat acgccaaccg gagagacaat tgttgtgcgc      1200
     tgccagacgg tcgatcacct ggtgcaagtt accgtcgaaa accccggtac gcccattgcg      1260
     cccgaacact taccgcgatt gtttgaccgt ttctaccgcg ttgatccttc ccgccagcga      1320
     aaaggcgaag gtagcggcat tggtctggcg atagtgaaat cgattgttgt cgcgcataaa      1380
     ggcactgttg cagtaacgtc agatgcacgg gggacaaggt ttgttatcat attacccgct      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page