(data stored in ACNUC7421 zone)

EMBL: FM180568.DNAE

FM180568.DNAE        Location/Qualifiers
FT   CDS_pept        215127..218609
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="E2348C_0189"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07737"
FT                   /db_xref="GOA:B7UJ85"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJ85"
FT                   /protein_id="CAS07737.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFP
FT                   DRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMSTEDYLVKRAKEGLEERLVFLFPDEEERLKRRPEYDERLDTELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVTTAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
     atgtctgaac cacgtttcgt acacctgcgg gtgcacagcg actactcgat gatcgatggc        60
     ctggccaaaa ccgcaccgct ggtaaaaaag gcggcggcgt tgggtatgcc agcactggcg       120
     atcaccgatt tcaccaacct ttgcggtctg gtgaagttct acggagcggg acatggcgca       180
     gggattaagc ccatcgtcgg ggcggatttt aacgtccagt gcgacctgct gggtgatgag       240
     ttaacccacc tgacggtgct ggcggcgaac aataccggct atcagaatct gacgttgctg       300
     atctcaaaag cgtatcagcg cgggtacggt gccgccgggc cgatcatcga tcgcgactgg       360
     cttatcgaat taaacgaagg gttgatcctt ctttccggcg ggcgcatggg cgacgtcgga       420
     cgcagtcttt tgcgtggtaa tagcgcgctg gtagatgagt gtgtcgcgtt ttatgaagaa       480
     cacttcccgg atcgctattt tctcgagctg atccgcactg gaaggccgga cgaagaaagc       540
     tatctgcacg cggcggtgga actggcggaa gcgcgcggtt tacccgtcgt ggcgaccaac       600
     gacgtgcgct ttatcgacag cagcgacttt gacgcacacg aaatccgcgt cgcgatccac       660
     gacggcttta ccctcgacga tcctaaacgc ccgcgtaact attcgccgca gcaatatatg       720
     cgtagcgaag aggagatgtg tgagctgttt gccgatatcc ccgaagccct tgccaacacc       780
     gttgagatcg ccaaacgttg taacgtaact gtgcgtctgg gtgaatactt cttgccgcaa       840
     ttcccgaccg gggacatgag taccgaagat tatctggtca agcgtgcaaa agaaggcctg       900
     gaagagcgtc tggtattttt attccctgac gaggaagaac gtcttaagcg tcgtccggag       960
     tatgacgaac gtctggatac tgaacttcag gttatcaacc agatgggctt cccgggttac      1020
     ttcctcatcg ttatggaatt tatccagtgg tcgaaagata acggtgtacc ggtagggcca      1080
     ggccgtggtt ctggtgcagg gtcactggtg gcctacgcgt taaaaatcac cgatctcgat      1140
     ccgctggaat ttgacctgct gttcgaacgt ttccttaacc cggagcgtgt ctccatgcct      1200
     gacttcgacg ttgacttctg tatggagaaa cgcgaccagg ttatcgagca cgtagcggac      1260
     atgtacggtc gtgatgcggt atcgcagatt atcaccttcg gtacgatggc ggcgaaagcg      1320
     gtgatccgcg acgtaggccg cgtgctgggg catccgtacg gctttgtcga ccgtatctcg      1380
     aaactgatcc cgcccgatcc gggtatgacg ctggcgaaag cgtttgaagc cgagccgcag      1440
     ctgccggaaa tctacgaagc ggatgaagaa gttaaggcgc tgatcgacat ggcgcgcaaa      1500
     ctggaagggg tcacccgtaa cgccggtaag cacgccggtg gggtggttat cgcgccgacc      1560
     aaaattactg attttgcgcc gctttattgc gatgaagagg gcaaacatcc ggtcacccag      1620
     tttgataaaa gcgacgttga atacgccggg ctggtgaagt tcgacttcct cggtttgcgt      1680
     acgctcacca tcatcaactg ggcgctggag atgatcaaca agcggcgggc gaagaatggc      1740
     gagccgccgc tggatatcgc cgcgatcccg ctggatgaca agaaaagctt cgacatgctg      1800
     caacgctcgg aaaccacggc ggtattccag cttgaatcgc gcggcatgaa ggacctgatc      1860
     aagcgtctgc aacctgactg cttcgaagat atgatcgcac tggtggcact gttccgcccc      1920
     ggcccgttgc aatcagggat ggtggataac tttatcgacc gtaaacatgg tcgcgaagag      1980
     atctcctatc cggacgtgca gtggcagcat gaaagcctga aaccggtact ggagccaacc      2040
     tacggcatca tcctgtatca ggaacaggtt atgcagattg cccaggtgct ttctggttat      2100
     accctcggtg gcgcggatat gctgcgtcgt gcgatgggta agaaaaagcc agaagagatg      2160
     gctaagcagc gttctgtatt tgctgaaggt gcagaaaaga acggaatcaa cgccgaactg      2220
     gcgatgaaaa tcttcgacct ggtggagaaa ttcgcgggtt acggatttaa caaatcgcac      2280
     tctgcggcct atgctttggt gtcatatcaa acgttatggc tgaaagcgca ctatccggcg      2340
     gagtttatgg cggcggtaat gaccgccgat atggacaaca ccgagaaggt ggtgggcctg      2400
     gtggatgagt gctggcggat ggggctgaaa atcctaccgc cggatataaa ctccggtctt      2460
     taccatttcc acgtcaacga cgacggcgaa atcgtgtatg gtattggcgc gatcaaaggg      2520
     gtaggtgaag gtccgattga ggccatcatc gaagcccgta ataaaggcgg ctacttccgc      2580
     gaactgtttg atctctgcgc ccgtaccgac accaaaaagt taaaccggcg ggtgctggaa      2640
     aaactgatca tgtccggggc gtttgaccgt cttgggccac accgcgcggc gctgatgaac      2700
     tcgctgggtg atgcgttaaa agcggcagat caacacgcga aagcggaagc tatcggtcag      2760
     gccgatatgt tcggcgtgct ggccgaagag ccggaacaaa ttgaacaatc ctacgccagc      2820
     tgccaaccgt ggccggagca ggtggtgtta gatggggaac gtgaaacgtt aggtctgtac      2880
     ctgacgggac accctatcaa ccagtattta aaagagattg agcgttatgt cggaggcgta      2940
     aggctgaaag acatgcaccc gacagaacgt ggtaaagtca ccacggctgc ggggctcgtt      3000
     gttgctgcgc gggttatggt caccaagcgc ggcaatcgta tcggtatctg cacgctggat      3060
     gaccgttccg ggcggctgga agtgatgttg tttactgacg ccctggataa ataccagcaa      3120
     ttgctggaaa aagaccgcat acttatcgtc agcggacagg tcagctttga tgacttcagc      3180
     ggtgggctta aaatgaccgc tcgcgaagtg atggatattg acgaagcccg ggaaaaatat      3240
     gctcgcgggc ttgctatctc gctgacggac aggcaaattg atgaccagct tttaaaccga      3300
     ctccgtcagt ctctggaacc ccaccgctct gggacaattc cagtacatct ctactatcag      3360
     agggcggatg cacgcgcgcg attgcgtttt ggcgcgacgt ggcgtgtctc tccgagcgat      3420
     cgtttattaa acgatctccg tggcctcatt ggttcggagc aggtggaact ggagtttgac      3480
     taa                                                                    3483
//

If you have problems or comments...

PBIL Back to PBIL home page