(data stored in ACNUC7421 zone)

EMBL: FM180568.DNAQ

FM180568.DNAQ        Location/Qualifiers
FT   CDS_pept        246248..246979
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="E2348C_0215"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07763"
FT                   /db_xref="GOA:B7UJB1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJB1"
FT                   /protein_id="CAS07763.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNATFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEL
FT                   AAHEARLDLVQKKGGTCLWRA"
     atgagcactg caattacacg ccagatcgtt ctcgataccg aaaccaccgg tatgaaccag        60
     attggtgcgc actatgaagg ccacaagatc attgagattg gtgccgttga agtggtgaac       120
     cgtcgcctga cgggcaataa cttccatgtt tatctcaaac ccgatcggct ggtggatccg       180
     gaagcctttg gcgtacatgg tattgccgat gaatttttgc tcgataagcc cacgtttgcc       240
     gaggtagccg atgagttcat ggactatatc cgcggagcgg agctggtgat ccataacgca       300
     acgttcgata tcggctttat ggactacgag ttttcgttgc ttaagcgcga tattccgaag       360
     accaatacct tctgtaaggt caccgatagc cttgcggtgg cgaggaaaat gtttcccggt       420
     aaacgcaaca gcctcgatgc gttatgtgcc cgctacgaaa tagataacag taaacgaacg       480
     ctgcatgggg cattactcga tgcccagatc cttgcggaag tttatctggc gatgaccggt       540
     ggtcaaacgt caatggcttt tgcgatggaa ggagagacac aacagcaaca aggtgaagca       600
     acaattcagc gcattgtgcg tcaggcaagt aagttacgcg ttgtttttgc gacagatgaa       660
     gagcttgcag cacatgaagc ccgtcttgat ctggtgcaga agaagggcgg aacctgcctc       720
     tggcgggcat aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page