(data stored in ACNUC7421 zone)

EMBL: FM180568.ECPC

FM180568.ECPC        Location/Qualifiers
FT   CDS_pept        complement(277247..279772)
FT                   /transl_table=11
FT                   /gene="ecpC"
FT                   /locus_tag="E2348C_0247"
FT                   /product="predicted outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07795"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJD9"
FT                   /protein_id="CAS07795.1"
FT                   /translation="MPLRRFSPGLKAQFAFGMVFLFVQPDASAADISAQQIGGVIIPQA
FT                   FSQALQDGMSVPLYIHLAGSQGRQDDQRIGSAFIWLDDGQLRIRKIQLEESEDNASVSE
FT                   QTRQQLMTLANAPFNEALTIPLTDNAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQ
FT                   SSVNTLSSNLSYNFGVYNNQLRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQ
FT                   DSELYKAMYERDFAGHRFAGGMLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTIFDSS
FT                   QSATPVIAFLPAAGEVHLTRDGRLLSVQNFTMGNHEVDTRGLPYGIYDVEVEVIVNGRV
FT                   ISKRTQRVNKLFSRGRGVGAPLAWQIWGGSFHMDRWSENGKKTRPAKESWLAGASTSGS
FT                   LSTFSWAATGYGYDNQAVGETRLTLPLGVAINVNLQNMLASDSSWSNIASISATLPGGF
FT                   SSLWVNQEKTRIGNQLRRSDADNRAIGGTLNLNSLWSKLGTFSISYNDDRRYNSHYYTA
FT                   DYYQSVYSGTFGSLGLRAGIQRYNNGDSSANTGKYIALDLSLPLGNWFSAGMTHQNGYT
FT                   MANLSARKQFDEGTIRTVGANLSRAISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAA
FT                   DGYINTNLTANGSVGWQGKNIAASGRTDGNAGVIFDTGLENDGQISAKINGRIFPLNGK
FT                   RNYLPLSPYGRYEVELQNSKNSLDSYDIVSGRKSHLTLYPGNVAVIEPEVKQMVTVSGR
FT                   IRAEDGTLLANARINNHIGRTRTDENGEFVMDVDKKYPTIDFRYSGNKTCEVALELNQA
FT                   RGAVWVGDVVCSGLSSWAAVTQTGEENES"
     atgcctttac gacggttctc cccaggactg aaagcccagt ttgccttcgg catggtcttt        60
     ttgttcgttc agcccgatgc cagcgctgct gacataagtg cgcagcaaat aggtggggtg       120
     attattccgc aggccttcag tcaggcgctt caggacggca tgagcgtccc gctctatatt       180
     catctcgccg gtagccaggg tcgccaggac gatcagcgaa tcggcagcgc ttttatctgg       240
     ttggatgatg gacagttacg catccggaaa atacagctgg aagagagtga agataacgcc       300
     agtgtcagcg aacaaactcg acagcaactg atgactctgg ccaacgcccc gttcaatgag       360
     gcccttacca tccccctgac tgacaacgcg cagttggatc tcagcttgcg ccaactgctg       420
     ctgcagctgg tggtcaagcg cgaagcgctg ggcaccgtac tacgctcacg tagcgaagac       480
     atcgggcagt ccagtgttaa taccctcagc agtaatctga gctataactt cggtgtctat       540
     aacaaccagt tgcgtaacgg cgggagcaac acctccagct atctgtcgct gaataacgtt       600
     actgcgctgc gcgaacatca cgtggtgctc gacggctcac tgtacgggat tggtagcggt       660
     caacaggaca gtgaattata taaagcgatg tatgaacgcg attttgctgg tcaccgattt       720
     gccggtggaa tgctcgacac ctggaacttg cagtccttag ggccgatgac cgccatttca       780
     gcagggaaga tttacggcct ttcctgggga aaccaggcca gctccaccat cttcgacagc       840
     agccagtcgg ccacgccagt gatcgccttt ttaccggcag cgggcgaagt acatctcacc       900
     cgtgatgggc gactactaag cgttcagaac ttcaccatgg gcaatcatga agtggatacc       960
     cggggtctac cgtacggtat ttacgatgtg gaagttgagg taatcgttaa cggtcgcgtg      1020
     atcagcaaac gcacccagcg ggtcaataag ctgtttagcc gggggcgtgg cgtcggtgca      1080
     ccgctggcgt ggcagatatg gggcggtagc tttcatatgg atcgctggtc ggaaaacggg      1140
     aaaaagacgc gaccagccaa agagagttgg ctggcaggtg cctcgacctc cggctcactg      1200
     agtacgttta gctgggcggc aacaggatat ggatacgata atcaggcggt gggtgaaacc      1260
     cgtctgacgc tgccgcttgg ggtggcgatc aacgttaacc tgcaaaacat gctggccagt      1320
     gacagctcat ggagcaacat cgccagcatc agcgccactc tacctggagg cttcagttcg      1380
     ctgtgggtta accaggaaaa aacccgcatt ggcaatcaat tgcgacgtag cgatgccgac      1440
     aaccgtgcaa tcggcggcac actcaacctg aactcactgt ggtcgaagct gggtacgttc      1500
     agcatcagct acaatgatga ccgccgctac aacagccatt attacacggc agattactat      1560
     cagagtgtct acagcggtac ctttggttcg cttggcctgc gggccggtat tcagcgctat      1620
     aacaacggcg acagcagcgc caatacaggg aaatatatcg ctctcgatct ctcgctacca      1680
     ctgggcaact ggtttagcgc agggatgacc catcaaaacg gctacaccat ggcaaacctg      1740
     tcagcacgca aacagtttga tgaaggaacc attcgcactg ttggtgccaa tctgtcacga      1800
     gccatctccg gcgataccgg tgatgacaaa accctcagcg gtggggcgta tgcacagttc      1860
     gacgctcgtt acgccagcgg aacgctgaac gtcaatagcg cggcggacgg ctacatcaat      1920
     accaatttga ccgccaacgg cagcgtcggc tggcagggta aaaacatcgc tgccagcggg      1980
     cggaccgatg gcaacgctgg ggtgatattc gacactggcc tggagaacga tggtcagatc      2040
     agcgccaaaa tcaacgggcg gattttcccg cttaacggca agcgtaacta tctcccgctc      2100
     tctccctatg gaagatatga ggtggagtta cagaacagca aaaactcact cgacagttac      2160
     gatatcgtca gcggtcgcaa aagtcatctg actctctatc caggcaatgt cgctgtcatt      2220
     gagccagagg tgaagcagat ggttaccgtc tccggtcgta tccgtgcgga agacggcaca      2280
     ctgctggcta acgcacggat taacaaccat atcggccgaa cccgaaccga tgaaaacggc      2340
     gagtttgtca tggacgtgga taagaaatac cccactatcg attttcgcta cagtggcaat      2400
     aaaacctgcg aagtggcact ggaactcaac caggcgcgcg gtgccgtctg ggtcggtgat      2460
     gtggtctgca gcggcctctc atcgtgggcg gcggtgacgc agacaggaga agagaatgag      2520
     agttaa                                                                 2526
//

If you have problems or comments...

PBIL Back to PBIL home page