(data stored in ACNUC7421 zone)

EMBL: FM180568.FABZ

FM180568.FABZ        Location/Qualifiers
FT   CDS_pept        212107..212562
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="E2348C_0185"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07733"
FT                   /db_xref="GOA:B7UJ81"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJ81"
FT                   /protein_id="CAS07733.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
     ttgactacta acactcatac tctgcagatt gaagagattt tagaacttct gccgcaccgt        60
     ttcccgttct tactggtgga tcgcgtgctg gattttgaag aaggtcgttt tctgcgcgca       120
     gtaaaaaatg tctctgtcaa tgagccattc ttccagggcc atttccctgg aaaaccgatt       180
     tttccgggtg tgctgattct ggaagcaatg gcacaggcaa caggtattct ggcgtttaaa       240
     agcgtaggaa aactggaacc gggtgagctg tactacttcg ccggtattga cgaagcgcgc       300
     tttaagcgcc cggtcgtgcc tggcgatcaa atgatcatgg aagtcacttt cgaaaaaacg       360
     cgccgcggcc tgacccgttt taaaggggtt gctctggtcg acggtaaagt agtttgcgaa       420
     gcaacgatga tgtgtgctcg tagccgggag gcctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page