(data stored in ACNUC7421 zone)

EMBL: FM180568.FEPB

FM180568.FEPB        Location/Qualifiers
FT   CDS_pept        complement(554621..555577)
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="E2348C_0494"
FT                   /product="iron-enterobactin transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08042"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKN5"
FT                   /protein_id="CAS08042.1"
FT                   /translation="MRLAPLYRTALLLTGLLLSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTALVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF"
     gtgagactcg ccccgctcta ccgcaccgcc cttctattaa caggactttt gctttcagga        60
     atagccgcag tgcaggccgc cgactggccg cgtcagatta ctgacagccg tggcactcat       120
     accctggaaa gccagccgca gcgtatagtt tccaccagcg tcaccctgac cggctcactg       180
     ctggcgattg atgctccggt gatcgccagc ggcgcgacca cgccaaataa ccgcgtcgcg       240
     gatgaccagg gctttttacg ccagtggagc aaggtggcga aagaacgcaa actgcaacgg       300
     ctctatatcg gcgaaccgag tgcagaagcc gttgccgcgc aaatgccgga tctgatttta       360
     attagcgcaa ccggcgggga ttcggcgctg gcgctgtacg atcagctttc taccatcgcc       420
     ccaacattaa tcatcaatta cgacgacaaa agctggcagt cgctgttaac gcagcttggc       480
     gaaattaccg ggcatgagaa acaagcggca gagcggattg cacagtttga taagcaactg       540
     gcggcggcga aagagcaaat caaattaccg ccgcagccgg tcactgccct tgtctatacc       600
     gccgctgcac acagtgccaa tctctggacg ccggaatcag cacaagggca gatgctggaa       660
     caactcggct ttacgctggc gaagttgccc gcagggttaa acgccagcca aagccagggc       720
     aaacgccatg acatcattca gcttggtgga gaaaatctgg ctgcagggtt aaatggcgag       780
     tcactattcc tgttcgccgg tgatcagaaa gacgccgatg ctatttatgc taatccgctg       840
     ctcgcgcacc tgcctgcagt acaaaacaag caggtttatg cgctgggaac cgagacgttc       900
     cgcctggatt actacagcgc catgcaagtg ctggatagac ttaaggcgct gttttaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page