(data stored in ACNUC7421 zone)

EMBL: FM180568.FEPC

FM180568.FEPC        Location/Qualifiers
FT   CDS_pept        complement(550451..551266)
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="E2348C_0490"
FT                   /product="iron-enterobactin transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08038"
FT                   /db_xref="GOA:B7UKN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKN1"
FT                   /protein_id="CAS08038.1"
FT                   /translation="MTESVARLRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCG
FT                   KSTLLRTLSRLMTPAHGHVWLDGEHIQHYASKEVARRIGLLAQNATTPGDITVQELVAR
FT                   GRYPHQPLFTRWRKEDEDAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETA
FT                   IMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALREGKI
FT                   VAQGAPKEIVTAELIERIYGLRCMIIDDPVAGTPLVVPLGRTAPSTAKI"
     atgaccgaat cagtagcccg tttgcgcggc gaacagttaa ccctcggata tggcaaatat        60
     accgttgcgg aaaatctgac tgtagaaata cctgatggtc acttcacggc gattatcggg       120
     ccaaatggct gtggtaaatc cacgttactg cgtaccttaa gccgcctgat gacgcctgct       180
     cacgggcatg tctggctgga tggcgagcac attcaacatt acgccagtaa agaggttgca       240
     cgccggattg gtctgttggc gcaaaatgct accactccgg gcgatatcac cgtgcaagag       300
     ctggtggcgc gtgggcgtta cccgcatcaa ccgctattta cccgctggcg caaagaagat       360
     gaagacgcgg taacaaaagc gatgcaggcc acgggaataa ctcatctggc ggatcaaagc       420
     gtggacaccc tttctggcgg acaacgccag cgagcgtgga tcgcgatggt gctggcccag       480
     gaaacggcaa ttatgctgct cgacgaaccc acgacctggc tggatatcag tcatcagatt       540
     gatctactgg aactgttaag cgaactgaac cgcgagaaag gctataccct cgcggcggtg       600
     ctgcacgatc ttaatcaggc ctgtcgttac gccagccatt tgattgcatt gcgggaaggg       660
     aaaattgttg ctcagggagc gccgaaagag attgtcactg ctgaactgat cgagcgcatt       720
     tatggtctgc gctgcatgat aattgacgat ccggttgccg gaacgccgct cgtggtgccg       780
     ctcggacgaa cggcaccttc aaccgcaaag atttaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page