(data stored in ACNUC7421 zone)

EMBL: FM180568.FEPG

FM180568.FEPG        Location/Qualifiers
FT   CDS_pept        complement(551263..552255)
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="E2348C_0491"
FT                   /product="ferric enterobactin transport protein FepG;
FT                   membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08039"
FT                   /db_xref="GOA:B7UKN2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKN2"
FT                   /protein_id="CAS08039.1"
FT                   /translation="MIYVSRRLIITCLLLLIACVMAGVWGLRSGAVTLETSQVFAALMG
FT                   DAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALAAMVGGIVTSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAAALLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLVADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
     atgatttacg tctctcgccg attaattatc acctgtctac tgttgctaat agcttgtgta        60
     atggcaggcg tgtggggatt acgcagcggt gccgtcacgc tggaaacctc gcaggtattc       120
     gccgcgctga tgggcgatgc gccgcgcagt atgacgatgg tggtcaccga atggcgttta       180
     ccacgcgtgc tgatggcgct gttgattggc gcggcgctgg gcgtcagcgg cgcgattttt       240
     cagtcgctga tgcgtaaccc gctcggcagc cctgacgtaa tgggctttaa caccggggcg       300
     tggagcggcg tgctggtggc gatggtgctg tttggtcagg acctgacggc tatcgccctg       360
     gcagcaatgg tgggcggcat tgtcacttcg ctgttggtct ggctgctcgc ctggcgtaac       420
     ggtatcgaca cctttcggtt gattattatc ggtatcggcg ttcgcgccat gctggtggcc       480
     tttaatacct ggctgttgct gaaagcgtct ttagaaacgg cgctaacagc gggtttgtgg       540
     aatgccggat cgctcaatgg cctgacgtgg gcaaaaacct caccttccgc acccatcatt       600
     atattaatgt taattgccgc tgccttgctg gtgcggcgaa tgcgcttgct ggaaatgggc       660
     gatgataccg cgtgtgcgct gggcgtcagc gtcgaacgtt cgcggctgtt aatgatgctg       720
     gtcgccgtag tgcttaccgc agctgccact gccctggcgg ggccgatttc ctttattgct       780
     ttagtcgcgc cgcacattgc ccgacgcatt agtggcaccg ctcgctgggg gctgacccag       840
     gcggcgctgt gcggggcgct gttactgctg gtggccgatc tctgcgccca acaactgttt       900
     atgccgtatc aacttccggt tggcgtcgtt accgtcagcc tcggcggtat ttaccttatc       960
     gtcttgttaa ttcaggagtc tcgcaaaaaa tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page