(data stored in ACNUC7421 zone)

EMBL: FM180568.FHUC

FM180568.FHUC        Location/Qualifiers
FT   CDS_pept        180661..181458
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="E2348C_0158"
FT                   /product="iron-hydroxamate transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07706"
FT                   /db_xref="GOA:B7UIJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ8"
FT                   /protein_id="CAS07706.1"
FT                   /translation="MQEYTNHSDTTFALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAEIMRGETLEMIYGIPMGILPHPAGAAPVSFVY"
     atgcaggaat acacgaatca ttccgatacc acttttgcac tgcgtaatat ctcctttcgt        60
     gtgcccgggc gcacgctttt gcatccgctg tcgttaacct ttcctgccgg gaaagtgacc       120
     ggtctgattg gtcacaacgg ttctggtaaa tccactttgc tcaaaatgct tggtcgtcac       180
     cagccaccgt cggaagggga gattctcctt gatgcccagc cgctggaaag ctggagcagc       240
     aaagcgtttg cccgcaaagt ggcttatttg ccgcagcagc ttcctccggc agaagggatg       300
     accgtgcgtg aactggtggc gattggtcgt tacccgtggc atggcgcact ggggcgcttt       360
     ggtgcggcag atcgcgaaaa ggtcgaagag gcgatttcgc tggttggctt aaaaccgctg       420
     gcgcatcggc tggtcgatag tctctctggc ggcgaacgtc agcgggcgtg gatcgctatg       480
     ctggtggcac aggatagccg ttgtctgttg ctcgacgaac cgacctcggc gctggatatc       540
     gcccaccagg ttgacgtgct ggcgctggtg catcgtttaa gtcaggaacg tggtctgacg       600
     gtcattgccg tgctgcacga tattaatatg gcggcgcgct actgtgatta tctggtcgcc       660
     ctacgcggcg gtgaaatgat tgctcaggga acgcctgcgg aaattatgcg cggcgaaacc       720
     ctcgaaatga tttatggcat cccgatgggt attctgccgc atccggcggg tgctgcacct       780
     gtgagttttg tttattga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page