(data stored in ACNUC7421 zone)

EMBL: FM180568.FHUD

FM180568.FHUD        Location/Qualifiers
FT   CDS_pept        181458..182348
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="E2348C_0159"
FT                   /product="iron-hydroxamate transporter subunit FhuD"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07707"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ9"
FT                   /protein_id="CAS07707.1"
FT                   /translation="MSGLPLISRRRLLTTMALSPLLWQMNTAHAAVIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLTHYEDFIR
FT                   SMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAVYKDVDVLCFDHDNSKDVDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRILDNAIGGKA"
     atgagcggct tacctcttat ttcgcgccgc cgactgttaa cgacgatggc gctttctccg        60
     ttgttatggc agatgaatac cgcccacgcg gcggttattg atcccaatcg tattgtggca       120
     ctggagtggt tgccggtgga gttactgctg gcgctcggca tcgtgcctta cggcgtggcg       180
     gacaccatca actatcgcct gtgggtcagc gaaccgccat tgccggactc agtgattgac       240
     gttggtttgc gtacagaacc caaccttgaa ctgctgaccg aaatgaaacc gtcgtttatg       300
     gtctggtcgg caggatatgg cccttcacca gaaatgctgg cacgtattgc gccggggcgc       360
     ggatttaact tcagcgacgg caaacagcca ctggcgatgg cgcgtaaatc actgacggaa       420
     atggcagatt tacttaacct gcaaagcgca gcagaaacgc atttaacgca ctatgaagac       480
     tttatccgca gcatgaaacc ccgctttgtg aagcgtggtg cacgcccgtt attgctgacg       540
     acgcttatcg atccgcgcca tatgttggtc ttcggtccaa acagcttgtt ccaggaaatt       600
     ctcgatgagt acggcatccc aaatgcctgg caaggggaaa ccaacttttg gggcagtacc       660
     gccgtcagta tcgatcgtct ggcagtgtat aaagacgttg atgtgctctg ttttgatcac       720
     gacaacagca aagacgtgga tgcgctaatg gcaaccccgc tgtggcaggc catgccgttt       780
     gttcgcgccg gacgctttca gcgcgttccg gcggtctggt tctatggtgc gacgctttct       840
     gcaatgcact ttgtgcgtat tctggataac gccatcggag gtaaagcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page