(data stored in ACNUC7421 zone)

EMBL: FM180568.FIXA

FM180568.FIXA        Location/Qualifiers
FT   CDS_pept        45277..46047
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="E2348C_0042"
FT                   /product="predicted electron transfer flavoprotein subunit,
FT                   ETFP adenine nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07590"
FT                   /db_xref="GOA:B7UI87"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UI87"
FT                   /protein_id="CAS07590.1"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASVL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
     atgaagatta ttacttgcta taagtgcgtg cctgatgaac aggatattgc ggtcaataat        60
     gctgatggtt cgttagactt cagcaaagcc gatgccaaaa taagccaata cgatctcaac       120
     gctattgaag cggcttgcca gctaaagcaa caggcagcag aggcgcaggt gacggcctta       180
     agtgtgggcg gtaaagccct gaccaacgcc aaagggcgta aagatgtgct atcgcgcggt       240
     ccggatgaac tgattgtggt gattgatgac cagttcgagc aggcactgcc gcaacaaacg       300
     gcgagcgtac tggctgcagc cgctcagaaa gcaggctttg atttgatcct ctgtggcgat       360
     ggttcttccg acctttatgc ccagcaggtt ggtttgctgg taggcgaaat ccttaatatt       420
     ccggcagtta acggcgtcag caaaattatc tccctgactg cagataccct caccgttgag       480
     cgcgaactgg aagatgaaac agaaacctta agcattccgc tgcctgcggt tgttgctgtt       540
     tccactgata tcaactcccc acaaattcct tcgatgaaag ccattctcgg cgcggcgaaa       600
     aagccagtcc aggtatggtc ggcggcggat atcggtttta acgcagaggc agcctggtca       660
     gaacaacagg ttgccgcgcc gaaacagcgc gagcgtcagc gcatcgtgat tgaaggcgac       720
     ggcgaagaac agatcgccgc atttgctgaa aatcttcgca aagtcattta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page