(data stored in ACNUC7421 zone)

EMBL: FM180568.FIXB

FM180568.FIXB        Location/Qualifiers
FT   CDS_pept        46062..47003
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="E2348C_0043"
FT                   /product="predicted electron transfer flavoprotein,
FT                   NAD/FAD-binding domain and ETFP adenine
FT                   nucleotide-bindingdomain-like"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07591"
FT                   /db_xref="GOA:B7UI88"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UI88"
FT                   /protein_id="CAS07591.1"
FT                   /translation="MNTFSQVWVFSDTPSRLPELMNGAQALANQINTFVLNDADGAQAI
FT                   QLGANHVWKLSGKPDDRMIEDYADVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLN
FT                   AAVSNDASAVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDVAQPDASRTG
FT                   ETHTVEWQAPAVAITRTATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAIN
FT                   KDKNAPIFQFADYGIVGDAVKILPALTAALAR"
     atgaacacgt tttctcaagt ctgggtattc agcgataccc cttctcgtct gccggaactg        60
     atgaacggtg cgcaggcttt agctaatcaa atcaacacgt tcgtcctcaa tgatgccgac       120
     ggcgcacagg caatccagct cggcgctaat catgtctgga aattaagcgg caaaccggac       180
     gatcggatga tcgaagatta cgccgatgtc atggctgaca ctattcgcca gcacggcgca       240
     gacggtctgg tgctgttgcc aaacacccgt cgcggcaaat tactggcggc gaaactgggt       300
     taccgcctta acgcggcggt gtctaacgat gccagcgctg ttagcgtgca ggacggtaaa       360
     gcgacagtga aacacatggt ttacggcggt ctggcgattg gcgaagaacg cattgccacg       420
     ccgtatgcgg tactgaccat cagcagcggc acgttcgatg tggctcagcc agacgcgtca       480
     cgcactggcg aaacgcacac cgtggagtgg caggctccgg ctgtggcgat tacccgcacg       540
     gcaacccagg cgcgtcagag caacagcgtc gatctcgaca aagcccgcct ggtggtcagc       600
     gttggtcgcg gtattggcag caaagagaac attgcgctgg cagaacagct ttgcaaggcg       660
     ataggtgcgg agttggcctg ttctcgtccg gtggcggaaa acgaaaaatg gatggagcac       720
     gaacgctatg tcggtatctc caacctgatg ctgaaacctg aactgtacct ggcggtgggg       780
     atctccgggc agatccagca catggttggc gctaatgcgt cgcaaaccat tttcgccatc       840
     aacaaagata aaaatgcgcc gatcttccag ttcgcggatt acggcattgt tggcgacgcc       900
     gtgaagatcc ttccggcact gaccgcagct ttagcgcgtt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page