(data stored in ACNUC7421 zone)

EMBL: FM180568.FIXC

FM180568.FIXC        Location/Qualifiers
FT   CDS_pept        47054..48340
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="E2348C_0044"
FT                   /product="predicted oxidoreductase with FAD/NAD(P)-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07592"
FT                   /db_xref="GOA:B7UI89"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI89"
FT                   /protein_id="CAS07592.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLEHIIPGFADSAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVILADGVN
FT                   SILAEKLGMAKRVKPTDVAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMG
FT                   GGFLYTNENTLSLGLVCGLHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVV
FT                   PEAGINMLPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDF
FT                   SKQKLAEYRQHLESGPLRDMRMYQKLPAFLDNPRMFSGYPELAVGVARDLFTIDGSAPE
FT                   LMRKKILRHGKKVGFINLIKDGMKGVTVL"
     atgtccgaag atatctttga cgccatcatc gtcggtgcag ggcttgccgg ttcggttgcc        60
     gcactggtgc tcgcccgcga aggtgcgcaa gtgttagtta tcgagcgagg caattccgca       120
     ggtgccaaga acgtcaccgg cgggcgtctc tatgcccaca gtctggaaca cattattcct       180
     ggtttcgctg actccgcccc cgtagaacgc ctgatcaccc atgaaaaact tgcgtttatg       240
     acggaaaagt cagcgatgac tatggactac tgcaatggcg acgaaacctc gccatcccag       300
     cgttcttact ccgttttacg cagtaaattt gatgcctggc tgatggagca ggctgaagaa       360
     gcgggcgcgc agttaattac cgggatccgc gtcgataacc tcgtacagcg cgatggcaaa       420
     gtcgtcggtg tagaagccga tggcgatgtg attgaagcga aaacggtgat ccttgctgat       480
     ggggtgaatt ccatccttgc cgaaaagctg gggatggcaa aacgtgttaa accgacggat       540
     gtggcggttg gcgtgaagga actgatcgag ttaccgaagt cggttatcga agaccgtttt       600
     cagttgcagg gtaatcaggg cgcggcttgc ctgtttgcgg gatcacccac cgatggcctg       660
     atgggcggtg gcttccttta taccaatgaa aataccctgt cgctggggct ggtttgtggt       720
     ttgcatcatc tgcatgacgc aaaaaaatcg gtgccgcaaa tgctggaaga tttcaaacaa       780
     catccggccg ttgcaccgct gatcgcgggc ggcaagctgg tggaatattc cgctcacgta       840
     gtgccggaag caggtatcaa catgctgccg gagttggttg gtgacggcgt attgattgcc       900
     ggtgatgccg ccggaatgtg tatgaacctc ggttttacca ttcgcggtat ggatctggcg       960
     attgccgccg gggaagcagc agcaaaaact gtgctttcag cgatgaaaag cgacgatttc      1020
     agtaagcaaa aactcgcgga atatcgtcag catcttgaga gtggcccgct gcgcgatatg      1080
     cgcatgtacc agaaactacc ggcgttcctt gataacccac gcatgtttag cggctacccg      1140
     gaactggcgg tgggcgtggc gcgtgacctg ttcaccattg acggcagtgc gccggaactg      1200
     atgcgcaaga aaatcctccg ccacggcaag aaagtgggct tcatcaatct gatcaaggat      1260
     ggcatgaaag gagtgaccgt tttatga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page