(data stored in ACNUC7421 zone)

EMBL: FM180568.FIXX

FM180568.FIXX        Location/Qualifiers
FT   CDS_pept        48337..48624
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="E2348C_0045"
FT                   /product="predicted 4Fe-4S ferredoxin-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07593"
FT                   /db_xref="GOA:B7UI90"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI90"
FT                   /protein_id="CAS07593.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
     atgacttctc ccgtcaatgt ggacgtcaaa ctgggcgtca ataaattcaa tgtcgatgaa        60
     gagcatccgc acatcgttgt gaaggccgat gctgataaac aggccctgga gctgctggtg       120
     aaagcgtgcc ccgcaggtct gtacaagaag caggatgacg gcagtgtgcg cttcgattac       180
     gccggatgtc tggagtgcgg cacctgtcgc attctggggc tggggtcggc gctggaacag       240
     tgggaatacc cgcgcggcac ctttggtgtg gagttccgtt acggctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page