(data stored in ACNUC7421 zone)

EMBL: FM180568.FRSA

FM180568.FRSA        Location/Qualifiers
FT   CDS_pept        263832..265076
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="E2348C_0232"
FT                   /product="hydrolase, binds to enzyme IIA (Glc)"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07780"
FT                   /db_xref="GOA:B7UJC7"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJC7"
FT                   /protein_id="CAS07780.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFSHGAQLPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACAEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGLQEITDWIEKRLC"
     atgacacagg caaacctgag cgaaaccctg ttcaaacccc gctttaaaca tcctgaaacc        60
     tcgacgctag tccgccgctt tagtcacggc gcacaactgc ctgtgcagtc ggctcttgat       120
     ggtaaaacca tccctcactg gtatcgcatg attaaccgtc tgatgtggat ctggcgcggc       180
     attgacccac gtgaaatcct cgatgtccag gcgcgtattg tgatgagcga tgccgaacgt       240
     accgacgatg atttatacga tacggtgatt ggctaccgcg gcggcaactg gatttatgag       300
     tgggctaccc aggcgatggt gtggcaacaa aaagcctgtg cggaagaaga tccgcaactc       360
     agcggtcgac actggctgca tgcggctacg ttgtacaaca ttgctgccta tcctcatctg       420
     aaaggagatg acctggccga gcaagcgcag gctttgtcaa accgcgccta tgaagaggcc       480
     gctcagcgtc tgccgggcac gatgcgacag atggagttta ccgtacccgg cggtgcgccc       540
     atcaccggct ttttgcatat gccgaaaggt gatggcccgt tcccgacagt attaatgtgt       600
     ggtggtctgg atgcgatgca gacggactat tacagcctgt atgaacgtta ttttgcgccg       660
     cgcggcattg cgatgctgac tattgatatg ccgtcggtgg gcttttcttc aaaatggaag       720
     ctcacccagg actccagcct gttgcatcag cacgtcttaa aggcgctgcc taacgtaccg       780
     tgggtagatc acactcgcgt cgcggccttt ggtttccgtt tcggcgctaa cgttgccgtg       840
     cgtctggcat accttgaatc gccgcgtctg aaagcggttg cctgtcttgg tccggtagtt       900
     cataccctgt tgagtgattt taagtgccag caacaggtgc cggaaatgta tcttgacgtg       960
     ctggcgagcc gtttggggat gcatgatgct tccgacgaag cgttgcgcgt ggagctgaat      1020
     cgctattcat taaaagtgca aggattgctg ggacgtcgct gcccaacgcc aatgttatca      1080
     ggctactgga agaacgatcc gttcagcccg gaagaggact cacgcttaat cacctcatca      1140
     tctgctgacg gtaaattgtt agagatccca tttaacccgg tgtatcggaa ttttgacaaa      1200
     ggtcttcagg aaatcaccga ctggatcgaa aaacgattgt gttaa                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page