(data stored in ACNUC7421 zone)

EMBL: FM180568.FTSA

FM180568.FTSA        Location/Qualifiers
FT   CDS_pept        110099..111361
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="E2348C_0099"
FT                   /product="ATP-binding cell division protein FtsA involved
FT                   in recruitment of FtsK to Z ring"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07647"
FT                   /db_xref="GOA:B7UIE4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIE4"
FT                   /protein_id="CAS07647.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
     atgatcaagg cgacggacag aaaactggta gtaggactgg agattggtac cgcgaaggtt        60
     gccgctttag taggggaagt tctgcccgac ggtatggtca atatcattgg cgtgggtagt       120
     tgcccgtcgc gtggtatgga taaaggtggg gtgaacgacc tcgaatccgt ggtcaagtgc       180
     gtacaacgcg ccattgacca ggcagaattg atggcagatt gtcagatctc ttcggtatat       240
     ctggcgcttt ctggtaagca catcagctgc cagaatgaaa ttggtatggt gcctatttct       300
     gaagaagaag tgacgcaaga agatgtggaa aacgtcgtcc ataccgcgaa atcggtgcgt       360
     gtgcgcgatg agcatcgtgt gttgcatgtg atcccgcaag agtatgcgat tgactatcag       420
     gaagggatca agaatccggt agggctttcg ggcgtgcgga tgcaggcaaa agtgcacctg       480
     atcacatgtc acaatgatat ggcgaaaaac atcgtcaaag cggttgaacg ttgtgggctg       540
     aaagttgacc aactgatatt tgccggtctg gcatcaagtt attcggtatt gacggaagat       600
     gaacgtgaac tgggtgtctg cgtcgttgat atcggtggtg gtacaatgga tatcgccgtt       660
     tataccggtg gggcattgcg ccacacgaag gtaattcctt atgctggcaa tgtcgtgacc       720
     agtgatatcg cttacgcctt tggcacaccg ccaagtgacg ccgaagcgat taaagttcgc       780
     cacggttgtg cgctgggctc catcgttgga aaagatgaga gcgtggaagt gccgagcgta       840
     ggcggtcgtc cgccgcggag tctacaacgt cagaccctgg cagaggtgat cgagccgcgc       900
     tataccgagc tgctcaatct ggtcaacgaa gagatattgc agttgcagga aaagcttcgc       960
     caacaagggg ttaaacatca cctggcggca ggcattgtat taaccggtgg cgcagcgcag      1020
     atcgaaggtc ttgcagcctg tgctcagcgc gtgtttcata cgcaagtgcg tatcggcgcg      1080
     ccgctgaaca ttaccggttt aacggattat gctcaggagc cgtattattc gacggcggtg      1140
     ggattgcttc actatgggaa agagtcacat cttaacggtg aagctgaagt agaaaaacgt      1200
     gttacagcat cagttggctc gtggatcaag cgactcaata gttggctgcg aaaagagttt      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page