(data stored in ACNUC7421 zone)

EMBL: FM180568.FTSI

FM180568.FTSI        Location/Qualifiers
FT   CDS_pept        97530..99296
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="E2348C_0089"
FT                   /product="transpeptidase involved in septal peptidoglycan
FT                   synthesis (penicillin-binding protein 3)"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07637"
FT                   /db_xref="GOA:B7UID4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B7UID4"
FT                   /protein_id="CAS07637.1"
FT                   /translation="MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWL
FT                   QVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLTLSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTVPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERV
FT                   FPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEF
FT                   VINQGEGTGGRS"
     atgaaagcag cggcgaaaac gcagaaacca aaacgtcagg aagaacatgc caactttatc        60
     agttggcgtt ttgcgttgtt atgcggctgt attctcctgg cgctggcttt tctgctcgga       120
     cgcgtagcgt ggttacaagt tatctccccg gatatgctgg tgaaagaggg cgacatgcgt       180
     tctcttcgcg ttcagcaagt ttccacctcc cgcggcatga ttactgaccg ttctggtcgc       240
     ccgttagcgg tgagtgtgcc agtaaaagcg atttgggctg acccgaaaga agtgcatgac       300
     gctggcggta tcagcgtcgg tgaccgctgg aaggcgctgg ctaacgcgct caatattccg       360
     ctggatcagc tctcagcccg cattaacgcc aacccgaaag ggcgctttat ttatctggcg       420
     cgtcaggtaa accctgacat ggcggactac atcaaaaaac tgaaactgcc ggggattcat       480
     ctgcgtgaag aatctcgccg ttattatcca tccggcgaag tgactgctca cctcattggc       540
     tttactaacg tcgatagcca agggattgag ggcgtcgaga agagtttcga taaatggctt       600
     accgggcagc cgggtgagcg cattgtgcgt aaagaccgct atggtcgcgt aattgaagat       660
     atttcttcta ctgacagcca ggcagcgcac aacctgacgc tgagtattga tgaacgcctg       720
     caggcgctgg tttatcgcga actgaacaac gcggtggcct ttaacaaggc tgaatctggt       780
     agcgccgtgc tggtggatgt caacaccggt gaagtgctgg cgatggctaa cagcccgtca       840
     tacaacccaa ataatctgag cggcacgccg aaagaggcga tgcgtaaccg taccatcacc       900
     gacgtgtttg aaccgggctc aacggttaaa ccgatggtgg tgatgaccgc gttgcaacgt       960
     ggcgtggtgc gggaaaactc ggtactcaat accgttcctt atcgaattaa cggccacgaa      1020
     atcaaagacg tggcgcgcta cagcgaatta accctgaccg gggtattaca gaagtcgagt      1080
     aacgtcggtg tttccaaact ggcgttagcg atgccgtcct cagcgttagt agatacttac      1140
     tcacgttttg gactgggaaa agcgaccaat ttggggttgg tcggagaacg cagtggctta      1200
     tatcctcaaa aacaacggtg gtctgacata gagagggcca ccttctcttt cggctacggg      1260
     ctaatggtaa caccgttaca gttagcgcga gtctacgcaa ctatcggcag ctacggcatt      1320
     tatcgcccac tgtcgattac caaagttgac cccccggttc ccggtgaacg tgtcttcccg      1380
     gaatccattg ttcgcaccgt ggtgcatatg atggaaagcg tggcgctacc gggcggcggc      1440
     ggcgtgaagg cggcgattaa aggctatcgt atcgccatta aaaccggtac cgcgaaaaag      1500
     gtcgggccgg acggtcgcta catcaataaa tatattgctt ataccgcagg cgttgcgcct      1560
     gcgagtcagc cgcgcttcgc gctggttgtt gttatcaacg atccgcaggc gggtaaatac      1620
     tacggcggcg ccgtttccgc gccggtcttt ggtgccatca tgggcggcgt attgcgtacc      1680
     atgaacatcg agccggatgc gctgacaacg ggcgataaaa atgaatttgt gattaatcaa      1740
     ggcgagggta caggtggcag atcgtaa                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page