(data stored in ACNUC7421 zone)

EMBL: FM180568.FTSL

FM180568.FTSL        Location/Qualifiers
FT   CDS_pept        97149..97514
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="E2348C_0088"
FT                   /product="membrane-bound cell division protein at septum
FT                   containing leucine zipper motif"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07636"
FT                   /db_xref="GOA:B7UID3"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B7UID3"
FT                   /protein_id="CAS07636.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     atgatcagca gagtgacaga agctctaagc aaagttaaag gatcgatggg aagccacgag        60
     cgccatgcct tgcctggcgt tatcggtgac gatcttttgc gatttgggaa gctgccactc       120
     tgcctgttca tttgcattat tttgacggcg gtgaccgtgg taaccacggc gcaccatacc       180
     cgtttactga ccgctcagcg cgaacaactg gtgctggagc gagatgcttt agacattgaa       240
     tggcgcaacc tgatccttga agagaatgcg ctcggcgacc atagccgggt ggaaagaata       300
     gccacggaaa agctgcaaat gcagcatgtt gatccgtcac aagaaaatat cgttgtgcaa       360
     aaataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page